BLASTX 2.2.10 [Oct-19-2004] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 20060611S-012682 (1187 letters) Database: RefSeqSP 1040 sequences; 434,620 total letters Searching...done Score E Sequences producing significant alignments: (bits) Value Alignment gi|NP_998939.1| CD74 antigen [Sus scrofa] 244 5e-90 >ref|NP_998939.1| CD74 antigen [Sus scrofa] Length = 214 Score = 244 bits (624), Expect(2) = 5e-90 Identities = 120/154 (77%), Positives = 134/154 (87%) Frame = +3 Query: 264 RLDELTVPSHNLRLEILRMKLHKPSAPLSRMRVSAPMLMHALPMEGPEPMRYAT*YGDMT 443 RLD+LTV S NL+LE LRMKL KPS PLS+MRVSAPMLM ALPMEGPEPMR AT YG+MT Sbjct: 61 RLDKLTVTSQNLQLESLRMKLPKPSKPLSKMRVSAPMLMQALPMEGPEPMRNATKYGNMT 120 Query: 444 HDHVMHLLVNSDPLGVYPNLMGSLPEHLKHLKNTMYGVNWKLFENWLREWLLFDMSNNSL 623 DHVMHLL+ SDPLGVYP L GSLPE+LKHLKNTM GVNWKLFENWLR+WLLF+MS NSL Sbjct: 121 QDHVMHLLLKSDPLGVYPKLKGSLPENLKHLKNTMDGVNWKLFENWLRQWLLFEMSKNSL 180 Query: 624 EDTCFVVPHTDPLQTDDLTSRLGVTKHDLGQVLV 725 E+T F VP DPL+T+DL+S LGVTK DLGQV++ Sbjct: 181 EETPFEVPPKDPLETEDLSSGLGVTKQDLGQVIL 214 Score = 100 bits (250), Expect(2) = 5e-90 Identities = 49/60 (81%), Positives = 52/60 (86%) Frame = +2 Query: 83 MEDQRDLISDHEQLPLLGHRPGAPDINCSRGALYPGFSVLVALLLAGHATTTYFLY*LQG 262 MEDQRDLIS+HEQLP+LG RPGAP+ CSRGALY GFSVLVALLLAG ATT YFLY QG Sbjct: 1 MEDQRDLISNHEQLPMLGQRPGAPESKCSRGALYTGFSVLVALLLAGQATTAYFLYQQQG 60 Database: RefSeqSP Posted date: Aug 1, 2006 7:14 PM Number of letters in database: 434,620 Number of sequences in database: 1040 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 1,227,556 Number of Sequences: 1040 Number of extensions: 35491 Number of successful extensions: 107 Number of sequences better than 1.0e-05: 1 Number of HSP's better than 0.0 without gapping: 93 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 107 length of database: 434,620 effective HSP length: 79 effective length of database: 352,460 effective search space used: 111377360 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
Search to RefSeqBP
BLASTX 2.2.10 [Oct-19-2004] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 20060611S-012682 (1187 letters) Database: RefSeqBP 33,508 sequences; 16,112,626 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Alignment gi|NP_001029907.1| similar to CD74 antigen isoform b [Bos taurus] 191 2e-71 >ref|NP_001029907.1| similar to CD74 antigen isoform b [Bos taurus] Length = 204 Score = 191 bits (485), Expect(2) = 2e-71 Identities = 92/144 (63%), Positives = 116/144 (80%) Frame = +3 Query: 264 RLDELTVPSHNLRLEILRMKLHKPSAPLSRMRVSAPMLMHALPMEGPEPMRYAT*YGDMT 443 RLD+LTV S NL+LE LRMKL KP+ P+S+MR++ PMLM ALPM GPEPM+ AT YG+MT Sbjct: 61 RLDKLTVTSQNLQLENLRMKLPKPAKPMSQMRMATPMLMRALPMAGPEPMKNATKYGNMT 120 Query: 444 HDHVMHLLVNSDPLGVYPNLMGSLPEHLKHLKNTMYGVNWKLFENWLREWLLFDMSNNSL 623 DHVMHLL+ +DPL VYP L GSLPE+LKHLK++M G++WKLFE+WL +WLLF+MS NSL Sbjct: 121 QDHVMHLLLKADPLKVYPQLKGSLPENLKHLKDSMDGLDWKLFESWLHQWLLFEMSKNSL 180 Query: 624 EDTCFVVPHTDPLQTDDLTSRLGV 695 E+ F P DP++ + +S LGV Sbjct: 181 EEKPFEGPPKDPMEMEYPSSGLGV 204 Score = 97.8 bits (242), Expect(2) = 2e-71 Identities = 48/60 (80%), Positives = 51/60 (85%) Frame = +2 Query: 83 MEDQRDLISDHEQLPLLGHRPGAPDINCSRGALYPGFSVLVALLLAGHATTTYFLY*LQG 262 MEDQRDLIS+HEQLP+LG RPGA + CSRGALY GFSVLVALLLAG ATT YFLY QG Sbjct: 1 MEDQRDLISNHEQLPMLGQRPGAQESKCSRGALYTGFSVLVALLLAGQATTAYFLYQQQG 60 Database: RefSeqBP Posted date: Aug 1, 2006 7:14 PM Number of letters in database: 16,112,626 Number of sequences in database: 33,508 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 46,610,291 Number of Sequences: 33508 Number of extensions: 1400804 Number of successful extensions: 5284 Number of sequences better than 1.0e-05: 1 Number of HSP's better than 0.0 without gapping: 4357 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5260 length of database: 16,112,626 effective HSP length: 104 effective length of database: 12,627,794 effective search space used: 3674688054 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
Search to RefSeqHP
BLASTX 2.2.10 [Oct-19-2004] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 20060611S-012682 (1187 letters) Database: RefSeqHP 39,411 sequences; 17,774,539 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Alignment gi|NP_004346.1| CD74 antigen isoform b [Homo sapiens] 178 7e-67 Alignment gi|NP_001020330.1| CD74 antigen isoform a [Homo sapiens] 158 7e-61 Alignment gi|NP_001020329.1| CD74 antigen isoform c [Homo sapiens] 96 1e-38 >ref|NP_004346.1| CD74 antigen isoform b [Homo sapiens] Length = 232 Score = 178 bits (451), Expect(2) = 7e-67 Identities = 91/154 (59%), Positives = 115/154 (74%), Gaps = 2/154 (1%) Frame = +3 Query: 264 RLDELTVPSHNLRLEILRMKLHKPSAPLSRMRVSAPMLMHALPMEG-PE-PMRYAT*YGD 437 RLD+LTV S NL+LE LRMKL KP P+S+MR++ P+LM ALPM P+ PM+ AT YG+ Sbjct: 77 RLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGN 136 Query: 438 MTHDHVMHLLVNSDPLGVYPNLMGSLPEHLKHLKNTMYGVNWKLFENWLREWLLFDMSNN 617 MT DHVMHLL N+DPL VYP L GS PE+L+HLKNTM ++WK+FE+W+ WLLF+MS + Sbjct: 137 MTEDHVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKVFESWMHHWLLFEMSRH 196 Query: 618 SLEDTCFVVPHTDPLQTDDLTSRLGVTKHDLGQV 719 SLE P + L+ +D +S LGVTK DLG V Sbjct: 197 SLEQKPTDAPPKESLELEDPSSGLGVTKQDLGPV 230 Score = 95.5 bits (236), Expect(2) = 7e-67 Identities = 46/64 (71%), Positives = 52/64 (81%) Frame = +2 Query: 71 QVRTMEDQRDLISDHEQLPLLGHRPGAPDINCSRGALYPGFSVLVALLLAGHATTTYFLY 250 Q M+DQRDLIS++EQLP+LG RPGAP+ CSRGALY GFS+LV LLLAG ATT YFLY Sbjct: 13 QKPVMDDQRDLISNNEQLPMLGRRPGAPESKCSRGALYTGFSILVTLLLAGQATTAYFLY 72 Query: 251 *LQG 262 QG Sbjct: 73 QQQG 76 >ref|NP_001020330.1| CD74 antigen isoform a [Homo sapiens] Length = 296 Score = 158 bits (399), Expect(2) = 7e-61 Identities = 78/123 (63%), Positives = 98/123 (79%), Gaps = 2/123 (1%) Frame = +3 Query: 264 RLDELTVPSHNLRLEILRMKLHKPSAPLSRMRVSAPMLMHALPMEG-PE-PMRYAT*YGD 437 RLD+LTV S NL+LE LRMKL KP P+S+MR++ P+LM ALPM P+ PM+ AT YG+ Sbjct: 77 RLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGN 136 Query: 438 MTHDHVMHLLVNSDPLGVYPNLMGSLPEHLKHLKNTMYGVNWKLFENWLREWLLFDMSNN 617 MT DHVMHLL N+DPL VYP L GS PE+L+HLKNTM ++WK+FE+W+ WLLF+MS + Sbjct: 137 MTEDHVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKVFESWMHHWLLFEMSRH 196 Query: 618 SLE 626 SLE Sbjct: 197 SLE 199 Score = 95.5 bits (236), Expect(2) = 7e-61 Identities = 46/64 (71%), Positives = 52/64 (81%) Frame = +2 Query: 71 QVRTMEDQRDLISDHEQLPLLGHRPGAPDINCSRGALYPGFSVLVALLLAGHATTTYFLY 250 Q M+DQRDLIS++EQLP+LG RPGAP+ CSRGALY GFS+LV LLLAG ATT YFLY Sbjct: 13 QKPVMDDQRDLISNNEQLPMLGRRPGAPESKCSRGALYTGFSILVTLLLAGQATTAYFLY 72 Query: 251 *LQG 262 QG Sbjct: 73 QQQG 76 >ref|NP_001020329.1| CD74 antigen isoform c [Homo sapiens] Length = 160 Score = 95.5 bits (236), Expect(2) = 1e-38 Identities = 46/64 (71%), Positives = 52/64 (81%) Frame = +2 Query: 71 QVRTMEDQRDLISDHEQLPLLGHRPGAPDINCSRGALYPGFSVLVALLLAGHATTTYFLY 250 Q M+DQRDLIS++EQLP+LG RPGAP+ CSRGALY GFS+LV LLLAG ATT YFLY Sbjct: 13 QKPVMDDQRDLISNNEQLPMLGRRPGAPESKCSRGALYTGFSILVTLLLAGQATTAYFLY 72 Query: 251 *LQG 262 QG Sbjct: 73 QQQG 76 Score = 84.0 bits (206), Expect(2) = 1e-38 Identities = 45/70 (64%), Positives = 55/70 (78%), Gaps = 2/70 (2%) Frame = +3 Query: 264 RLDELTVPSHNLRLEILRMKLHKPSAPLSRMRVSAPMLMHALPMEG-PE-PMRYAT*YGD 437 RLD+LTV S NL+LE LRMKL KP P+S+MR++ P+LM ALPM P+ PM+ AT YG+ Sbjct: 77 RLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGN 136 Query: 438 MTHDHVMHLL 467 MT DHVMHLL Sbjct: 137 MTEDHVMHLL 146 Database: RefSeqHP Posted date: Aug 2, 2006 12:57 AM Number of letters in database: 17,774,539 Number of sequences in database: 39,411 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 53,151,381 Number of Sequences: 39411 Number of extensions: 1662076 Number of successful extensions: 6614 Number of sequences better than 1.0e-05: 3 Number of HSP's better than 0.0 without gapping: 4967 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6599 length of database: 17,774,539 effective HSP length: 104 effective length of database: 13,675,795 effective search space used: 3979656345 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
Search to RefSeqCP
BLASTX 2.2.10 [Oct-19-2004] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 20060611S-012682 (1187 letters) Database: RefSeqCP 33,732 sequences; 19,266,565 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Alignment gi|XP_536468.2| PREDICTED: similar to HLA class II histocompati... 164 3e-64 >ref|XP_536468.2| PREDICTED: similar to HLA class II histocompatibility antigen, gamma chain (HLA-DR antigens associated invariant chain) (Ia antigen-associated invariant chain) (Ii) (p33) (CD74 antigen) [Canis familiaris] Length = 272 Score = 164 bits (415), Expect(2) = 3e-64 Identities = 82/130 (63%), Positives = 101/130 (77%), Gaps = 2/130 (1%) Frame = +3 Query: 264 RLDELTVPSHNLRLEILRMKLHKPSAPLSRMRVSAPMLMHALPMEG-PE-PMRYAT*YGD 437 RLD+LTV S NL+LE LRMKL KP PLS+MRV+ PM+M ALP++ P+ P + AT YG+ Sbjct: 61 RLDKLTVTSQNLQLESLRMKLPKPPKPLSKMRVATPMMMQALPIQSLPQGPTQNATEYGN 120 Query: 438 MTHDHVMHLLVNSDPLGVYPNLMGSLPEHLKHLKNTMYGVNWKLFENWLREWLLFDMSNN 617 MT DHVMHLL+ +DPL VYP L GS PE+LKHLKNTM ++WK+FENW+ +WLLF+MS N Sbjct: 121 MTQDHVMHLLLEADPLKVYPKLKGSFPENLKHLKNTMETLDWKVFENWMYQWLLFEMSKN 180 Query: 618 SLEDTCFVVP 647 SLE VP Sbjct: 181 SLEKKSTEVP 190 Score = 100 bits (250), Expect(2) = 3e-64 Identities = 49/60 (81%), Positives = 52/60 (86%) Frame = +2 Query: 83 MEDQRDLISDHEQLPLLGHRPGAPDINCSRGALYPGFSVLVALLLAGHATTTYFLY*LQG 262 MEDQRDLIS+HEQLP+LG RPGAP+ CSRGALY GFSVLVALLLAG ATT YFLY QG Sbjct: 1 MEDQRDLISNHEQLPILGQRPGAPESKCSRGALYTGFSVLVALLLAGQATTAYFLYQQQG 60 Database: RefSeqCP Posted date: Aug 1, 2006 9:25 PM Number of letters in database: 19,266,565 Number of sequences in database: 33,732 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 54,545,613 Number of Sequences: 33732 Number of extensions: 1639874 Number of successful extensions: 6199 Number of sequences better than 1.0e-05: 1 Number of HSP's better than 0.0 without gapping: 4875 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6186 length of database: 19,266,565 effective HSP length: 105 effective length of database: 15,724,705 effective search space used: 4560164450 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
Search to RefSeqMP
BLASTX 2.2.10 [Oct-19-2004] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 20060611S-012682 (1187 letters) Database: RefSeqMP 45,328 sequences; 21,768,885 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Alignment gi|NP_034675.1| Ia-associated invariant chain [Mus musculus] 167 1e-61 >ref|NP_034675.1| Ia-associated invariant chain [Mus musculus] Length = 215 Score = 167 bits (424), Expect(2) = 1e-61 Identities = 85/155 (54%), Positives = 114/155 (73%), Gaps = 3/155 (1%) Frame = +3 Query: 264 RLDELTVPSHNLRLEILRMKLHKPSAPLSRMRVSAPMLMHALPMEGP--EPMRYAT*YGD 437 RLD+LT+ S NL+LE LRMKL K + P+S+MR++ P+LM + M+ P++ T YG+ Sbjct: 60 RLDKLTITSQNLQLESLRMKLPKSAKPVSQMRMATPLLMRPMSMDNMLLGPVKNVTKYGN 119 Query: 438 MTHDHVMHLLVNSDPLGVYPNLMGSLPEHLKHLKNTMYGVNWKLFENWLREWLLFDMSNN 617 MT DHVMHLL S PL YP L G+ PE+LKHLKN+M GVNWK+FE+W+++WLLF+MS N Sbjct: 120 MTQDHVMHLLTRSGPLE-YPQLKGTFPENLKHLKNSMDGVNWKIFESWMKQWLLFEMSKN 178 Query: 618 SLED-TCFVVPHTDPLQTDDLTSRLGVTKHDLGQV 719 SLE+ P +PL +DL+S LGVT+ +LGQV Sbjct: 179 SLEEKKPTEAPPKEPLDMEDLSSGLGVTRQELGQV 213 Score = 88.6 bits (218), Expect(2) = 1e-61 Identities = 45/60 (75%), Positives = 50/60 (83%) Frame = +2 Query: 83 MEDQRDLISDHEQLPLLGHRPGAPDINCSRGALYPGFSVLVALLLAGHATTTYFLY*LQG 262 M+DQRDLIS+HEQLP+LG+RP P+ CSRGALY G SVLVALLLAG ATT YFLY QG Sbjct: 1 MDDQRDLISNHEQLPILGNRPREPE-RCSRGALYTGVSVLVALLLAGQATTAYFLYQQQG 59 Database: RefSeqMP Posted date: Aug 2, 2006 12:58 AM Number of letters in database: 21,768,885 Number of sequences in database: 45,328 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 61,907,781 Number of Sequences: 45328 Number of extensions: 1821953 Number of successful extensions: 6627 Number of sequences better than 1.0e-05: 1 Number of HSP's better than 0.0 without gapping: 5397 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6613 length of database: 21,768,885 effective HSP length: 106 effective length of database: 16,964,117 effective search space used: 4902629813 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)