Animal-Genome cDNA 20060611C-000324


Search to RefSeqBP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611C-000324
         (1089 letters)

Database: RefSeqBP 
           33,508 sequences; 16,112,626 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_899207.1| double substrate-specificity short chain dehydr...   410   e-114
Alignment   gi|XP_870721.1| PREDICTED: similar to Retinol dehydrogenase 11 ...   266   2e-71
Alignment   gi|XP_582373.2| PREDICTED: similar to Retinol dehydrogenase 11 ...   259   2e-69
Alignment   gi|XP_582319.2| PREDICTED: similar to retinol dehydrogenase 14 ...   191   9e-49
Alignment   gi|XP_592820.2| PREDICTED: similar to retinol dehydrogenase 11 ...   174   1e-43
Alignment   gi|XP_584642.2| PREDICTED: similar to retinol dehydrogenase 11 ...   127   1e-29
Alignment   gi|XP_591168.2| PREDICTED: similar to dehydrogenase/reductase (...   119   3e-27
Alignment   gi|XP_584810.2| PREDICTED: similar to retinol dehydrogenase 13 ...   108   6e-24
Alignment   gi|XP_876208.1| PREDICTED: similar to WW domain-containing oxid...    91   2e-18
Alignment   gi|XP_584629.2| PREDICTED: similar to Retinol dehydrogenase 13,...    90   3e-18

>ref|NP_899207.1| double substrate-specificity short chain dehydrogenase/reductase 2
           [Bos taurus]
          Length = 316

 Score =  410 bits (1053), Expect = e-114
 Identities = 209/259 (80%), Positives = 219/259 (84%), Gaps = 1/259 (0%)
 Frame = +1

Query: 205 QLHPSGARVYIACRDVLKGESAASEIRADTKNSQVLVRKLDLSDTKSIRASAEGFLTEEK 384
           +L   GARVYIACRDVLKGESAASEI+ADTKNSQVLVRKLDLSDTKSIRA AEGFL EEK
Sbjct: 58  ELARRGARVYIACRDVLKGESAASEIQADTKNSQVLVRKLDLSDTKSIRAFAEGFLAEEK 117

Query: 385 QLHILINNAGVMLCPYSKTADGFETHLGVNXXXXXXXXXXXXXXXKASAPARVVNLSSVV 564
           QLHILINNAGVMLCPYSKTADGFETHL VN               K SAPARVVNLSSV 
Sbjct: 118 QLHILINNAGVMLCPYSKTADGFETHLAVNHLGHFLLTHLLLGRLKESAPARVVNLSSVA 177

Query: 565 HHAGKIRFHDLQGEKHYNRGFAYCHSKLANVLFTRELAKRLQGTGVTTYAVHPGIVQSEL 744
           HH GKIRFHDLQG+K+YN GFAYCHSKLANVLFTRELAKRL+GTGVTTYAVHPGIV+S+L
Sbjct: 178 HHLGKIRFHDLQGDKYYNLGFAYCHSKLANVLFTRELAKRLKGTGVTTYAVHPGIVRSKL 237

Query: 745 VRHSFLLCLLWRLFSRFLKTAREGAQTQLHCALAEGLEPLSGQYFSDCKRAWVSQGPRNT 924
           VRHSFLLCLLWRLFS FLKT  EGAQT LHCALAEGLEPLSG+YFSDCK+ WVS   RN 
Sbjct: 238 VRHSFLLCLLWRLFSPFLKTTWEGAQTSLHCALAEGLEPLSGKYFSDCKKTWVSPRARNN 297

Query: 925 -NGRALVNVSCELLGIQWE 978
                L NVSCELLGI+WE
Sbjct: 298 KTAERLWNVSCELLGIRWE 316


>ref|XP_870721.1| PREDICTED: similar to Retinol dehydrogenase 11 (Retinal reductase
           1) (RalR1) (Prostate short-chain dehydrogenase/reductase
           1) (Androgen-regulated short-chain
           dehydrogenase/reductase 1) (HCV core-binding protein
           HCBP12) isoform 2 [Bos taurus]
          Length = 314

 Score =  266 bits (680), Expect = 2e-71
 Identities = 138/256 (53%), Positives = 178/256 (69%), Gaps = 1/256 (0%)
 Frame = +1

Query: 205 QLHPSGARVYIACRDVLKGESAASEIRADTKNSQVLVRKLDLSDTKSIRASAEGFLTEEK 384
           +L   GARVY+ACRDV  GE  A EI+  T N QVLVRKLDL+DTKSIRA A+ FL + K
Sbjct: 34  ELARRGARVYLACRDVQNGELVAREIQMMTGNQQVLVRKLDLADTKSIRAFAKRFLEDHK 93

Query: 385 QLHILINNAGVMLCPYSKTADGFETHLGVNXXXXXXXXXXXXXXXKASAPARVVNLSSVV 564
            +H++ ++   ++C +  ++ G ++                    + SAP+RVVN+SS+ 
Sbjct: 94  YIHLINSSPHFLICGFPGSSAGKDSACNTGYLGHFLLTHLLLEKLEESAPSRVVNVSSLA 153

Query: 565 HHAGKIRFHDLQGEKHYNRGFAYCHSKLANVLFTRELAKRLQGTGVTTYAVHPGIVQSEL 744
           H  G+I FH+LQGEK Y  G AYCHSKLAN+LFT+ELA+RL+G+GVT Y+VHPG V SEL
Sbjct: 154 HLLGRIHFHNLQGEKFYQSGLAYCHSKLANILFTQELARRLKGSGVTVYSVHPGTVNSEL 213

Query: 745 VRHSFLLCLLWRLFSRFLKTAREGAQTQLHCALAEGLEPLSGQYFSDCKRAWVSQGPRN- 921
           VRHS L+  +W +FS F+KT ++GAQT L+CAL EGLE LSG +FSDC  AWVS   RN 
Sbjct: 214 VRHSALMRWIWWIFSFFIKTPQQGAQTSLYCALTEGLEVLSGNHFSDCHVAWVSAQARNE 273

Query: 922 TNGRALVNVSCELLGI 969
           T  R L +VSC+LLGI
Sbjct: 274 TVARRLWDVSCDLLGI 289


>ref|XP_582373.2| PREDICTED: similar to Retinol dehydrogenase 11 (Retinal reductase
           1) (RalR1) (Prostate short-chain dehydrogenase/reductase
           1) (Androgen-regulated short-chain
           dehydrogenase/reductase 1) (HCV core-binding protein
           HCBP12) isoform 1 [Bos taurus]
          Length = 308

 Score =  259 bits (663), Expect = 2e-69
 Identities = 141/256 (55%), Positives = 176/256 (68%), Gaps = 1/256 (0%)
 Frame = +1

Query: 205 QLHPSGARVYIACRDVLKGESAASEIRADTKNSQVLVRKLDLSDTKSIRASAEGFLTEEK 384
           +L   GARVY+ACRDV  GE  A EI+  T N QVLVRKLDL+DTKSIRA A+ FL + K
Sbjct: 34  ELARRGARVYLACRDVQNGELVAREIQMMTGNQQVLVRKLDLADTKSIRAFAKRFLEDHK 93

Query: 385 QLHILINNAGVMLCPYSKTADGFETHLGVNXXXXXXXXXXXXXXXKASAPARVVNLSSVV 564
            +H LIN+ G     +  ++ G ++                    + SAP+RVVN+SS+ 
Sbjct: 94  YIH-LINSVG-----FPGSSAGKDSACNTGYLGHFLLTHLLLEKLEESAPSRVVNVSSLA 147

Query: 565 HHAGKIRFHDLQGEKHYNRGFAYCHSKLANVLFTRELAKRLQGTGVTTYAVHPGIVQSEL 744
           H  G+I FH+LQGEK Y  G AYCHSKLAN+LFT+ELA+RL+G+GVT Y+VHPG V SEL
Sbjct: 148 HLLGRIHFHNLQGEKFYQSGLAYCHSKLANILFTQELARRLKGSGVTVYSVHPGTVNSEL 207

Query: 745 VRHSFLLCLLWRLFSRFLKTAREGAQTQLHCALAEGLEPLSGQYFSDCKRAWVSQGPRN- 921
           VRHS L+  +W +FS F+KT ++GAQT L+CAL EGLE LSG +FSDC  AWVS   RN 
Sbjct: 208 VRHSALMRWIWWIFSFFIKTPQQGAQTSLYCALTEGLEVLSGNHFSDCHVAWVSAQARNE 267

Query: 922 TNGRALVNVSCELLGI 969
           T  R L +VSC+LLGI
Sbjct: 268 TVARRLWDVSCDLLGI 283


>ref|XP_582319.2| PREDICTED: similar to retinol dehydrogenase 14 (all-trans and
           9-cis) [Bos taurus]
          Length = 420

 Score =  191 bits (485), Expect = 9e-49
 Identities = 106/241 (43%), Positives = 145/241 (60%), Gaps = 17/241 (7%)
 Frame = +1

Query: 220 GARVYIACRDVLKGESAASEIRADT---------KNS----QVLVRKLDLSDTKSIRASA 360
           GARV + CRD  + E AA ++R +           NS    +++V++LDL+   S+R+  
Sbjct: 151 GARVIMGCRDRERAEEAAGQLRREVCPAGGPDSGPNSGGAGELVVKELDLASLSSVRSFC 210

Query: 361 EGFLTEEKQLHILINNAGVMLCPYSKTADGFETHLGVNXXXXXXXXXXXXXXXKASAPAR 540
           +  L EE +L +LINNAGV  CPY KT DGFE   GVN               K+SAP+R
Sbjct: 211 QEMLQEEPRLDVLINNAGVFQCPYMKTEDGFEMQFGVNHLGHFLLTNLLLGLLKSSAPSR 270

Query: 541 VVNLSSVVHHAGKIRFHDLQGEKHYNRGFAYCHSKLANVLFTRELAKRLQGTGVTTYAVH 720
           +V +SS ++  G I F DL  E+ YN+ F Y  SKLAN+LFTRELA+RL+GT VT   +H
Sbjct: 271 IVVVSSKLYKYGDINFEDLNSEQSYNKSFCYSRSKLANILFTRELARRLEGTSVTVNVLH 330

Query: 721 PGIVQSELVRHSFLLCLLWRLFS----RFLKTAREGAQTQLHCALAEGLEPLSGQYFSDC 888
           PGIV++ L RH  +  L+  LF+     F KT  EGAQT ++ A +  +E +SG+YF DC
Sbjct: 331 PGIVRTNLGRHIHIPLLVRPLFNLVSWAFFKTPEEGAQTAVYLASSPEVEGVSGRYFGDC 390

Query: 889 K 891
           K
Sbjct: 391 K 391


>ref|XP_592820.2| PREDICTED: similar to retinol dehydrogenase 11 (predicted) [Bos
           taurus]
          Length = 377

 Score =  174 bits (440), Expect = 1e-43
 Identities = 108/235 (45%), Positives = 144/235 (61%), Gaps = 7/235 (2%)
 Frame = +1

Query: 205 QLHPSGARVYIACRDVLKGESAASEIRADTKNSQVLVRKLDLSDTKSIRASAEGFLTEEK 384
           +L   GARV +ACR   +GE+AA ++R ++ N++V+   LDL+   S+RA A  FL+ E 
Sbjct: 55  ELARRGARVVLACRSRERGEAAAFDLRQESGNNEVIFMALDLASLASVRAFATAFLSSEP 114

Query: 385 QLHILINNAGVMLCPYSKTADGFETHLGVNXXXXXXXXXXXXXXXKASAPARVVNLSSVV 564
           +L ILI+NAG+  C   +T + F   L VN               K SAP+RVV +SS  
Sbjct: 115 RLDILIHNAGISSC--GRTREPFNLLLRVNHIGPFLLTHLLLPRLKTSAPSRVVVVSSAA 172

Query: 565 HHAGKIRF----HDLQGEKHYNRGFAYCHSKLANVLFTRELAKRLQGTGVTTYAVHPGIV 732
           H  G++ F    H + G +   R  AY +SKLANVLF RELA +L+GTGVT YA HPG V
Sbjct: 173 HRRGRLDFTRLDHPVVGWQQELR--AYANSKLANVLFARELATQLEGTGVTCYAAHPGPV 230

Query: 733 QSEL-VRH--SFLLCLLWRLFSRFLKTAREGAQTQLHCALAEGLEPLSGQYFSDC 888
            SEL +RH   +L  LL  L    L+  R GAQT L+CAL EG+EPLSG+YF++C
Sbjct: 231 NSELFLRHVPGWLRPLLRPLAWLVLRAPRGGAQTPLYCALQEGIEPLSGRYFANC 285


>ref|XP_584642.2| PREDICTED: similar to retinol dehydrogenase 11 (predicted) [Bos
           taurus]
          Length = 330

 Score =  127 bits (320), Expect = 1e-29
 Identities = 83/230 (36%), Positives = 132/230 (57%), Gaps = 4/230 (1%)
 Frame = +1

Query: 205 QLHPSGARVYIACRDVLKGESAASEIRADTKNSQVLVRKLDLSDTKSIRASAEGFLTEEK 384
           +L   GARV +ACR   +G+ A +EI+A +K++++L+ ++DLS   SIR+ A+  L E  
Sbjct: 68  ELAHRGARVILACRSRERGQQALAEIQATSKSNRLLLGEVDLSSMASIRSFAQRLLQECP 127

Query: 385 QLHILINNAGVMLCPYSKTADGFETHLGVNXXXXXXXXXXXXXXXKASAPARVVNLSSVV 564
           ++H+L+NNA V   P + T +G +     N               + +  ARVVN+SS  
Sbjct: 128 EIHLLVNNAAVCGFPTTLTPEGLDLTFATNYTGPFLLTNLLQGALQRAGSARVVNVSSFR 187

Query: 565 HHAGKIRFHDLQGEKH---YNRGFAYCHSKLANVLFTRELAKRLQGTGVTTYAVHPGIVQ 735
              G I    L G      +N+   Y  SKL    FT +LA+RLQGTGVT  +V PG+V 
Sbjct: 188 QSHGYIDEDHLIGAGRPLTFNQN--YDCSKLLLASFTGKLAQRLQGTGVTVNSVDPGVVY 245

Query: 736 SELVRH-SFLLCLLWRLFSRFLKTAREGAQTQLHCALAEGLEPLSGQYFS 882
           +++++H S+    L+ L S F K +++GA   L+ +LA+ L+ +SG++FS
Sbjct: 246 TKIMKHFSWSYRFLFWLLSFFFKDSKQGAVPVLYLSLAKELDGISGKHFS 295


>ref|XP_591168.2| PREDICTED: similar to dehydrogenase/reductase (SDR family) X-linked
           [Bos taurus]
          Length = 251

 Score =  119 bits (299), Expect = 3e-27
 Identities = 88/235 (37%), Positives = 116/235 (49%), Gaps = 17/235 (7%)
 Frame = +1

Query: 325 DLSDTKSIRASAEGFLTEEKQLHILINNAGVMLCPYSKTADGFETHLGVNXXXXXXXXXX 504
           DL+  +SIR   + F  ++  LH+L+NNAGVM+ P   T DGFE H GVN          
Sbjct: 11  DLASMRSIREFVQTFKMKKLPLHVLVNNAGVMMVPQRTTEDGFEEHFGVNYLGHFLLTNL 70

Query: 505 XXXXXKAS-AP---ARVVNLSSVVHHAGKIRFHDLQGEKHYNRGFAYCHSKLANVLFTRE 672
                + S AP   ARVV +SS  H+ G++   DLQ   +Y+   AY  SKLA VLFT  
Sbjct: 71  LLDTLQESGAPGHSARVVTVSSATHYVGELNLDDLQSSTYYSAHAAYAQSKLALVLFTYH 130

Query: 673 LAKRL--QGTGVTTYAVHPGIVQSELVRHSFLLCLLW--RLFSRFL-----KTAREGAQT 825
           L   L  QG  VT     PG+V ++L R+ F     W  RL  + L     KT  EGA T
Sbjct: 131 LQALLTAQGMPVTASVADPGVVDTDLYRYVF-----WGTRLVKKLLGWWVFKTPDEGAWT 185

Query: 826 QLHCALAEGLEPLSGQYFSDCKRAWVSQGPRNTN-GRALVNVSCELLGI---QWE 978
            ++ A+   LE L G+Y  + K     +   +    R L   SC+L GI    WE
Sbjct: 186 SVYAAVTPALEGLGGRYLYNEKETRSLEATYDPELQRQLWARSCQLTGIADVTWE 240


>ref|XP_584810.2| PREDICTED: similar to retinol dehydrogenase 13 (all-trans and
           9-cis) [Bos taurus]
          Length = 223

 Score =  108 bits (271), Expect = 6e-24
 Identities = 62/131 (47%), Positives = 85/131 (64%), Gaps = 7/131 (5%)
 Frame = +1

Query: 520 KASAPARVVNLSSVVHHAGKIRFHDLQGEKH-YNRGFAYCHSKLANVLFTRELAKRLQGT 696
           KASAP+R++N+SS+ H AG I F DL  EK  Y+   AYC SKLA V+ T+EL++RLQGT
Sbjct: 50  KASAPSRIINVSSLAHVAGHIDFEDLNWEKRKYDTKAAYCQSKLAVVVSTKELSRRLQGT 109

Query: 697 GVTTYAVHPGIVQSELVRH------SFLLCLLWRLFSRFLKTAREGAQTQLHCALAEGLE 858
           GVT  A+HPG+ ++EL RH      +F    L  +F   +K+    AQ  ++ A+AE LE
Sbjct: 110 GVTVNALHPGVARTELGRHTGMHSSAFSSFTLGPIFWLLVKSPELAAQPSVYLAVAEELE 169

Query: 859 PLSGQYFSDCK 891
            +SG+YF   K
Sbjct: 170 GVSGKYFDVLK 180


>ref|XP_876208.1| PREDICTED: similar to WW domain-containing oxidoreductase isoform 1
           [Bos taurus]
          Length = 745

 Score = 90.5 bits (223), Expect = 2e-18
 Identities = 74/212 (34%), Positives = 101/212 (47%), Gaps = 9/212 (4%)
 Frame = +1

Query: 301 SQVLVRKLDLSDTKSIRASAEGFLTEEKQLHILINNAGVMLCPYSKTADGFETHLGVNXX 480
           ++V    LDL+  +S++  A+ F  +   LH+L+ NA V   P++ T DG ET   VN  
Sbjct: 6   AKVEAMTLDLALLRSVQHFAQAFKAKNVSLHVLVCNAAVFGLPWTLTKDGLETTFQVNHL 65

Query: 481 XXXXXXXXXXXXXKASAPARVVNLSSVVHH-------AGKIRFHDLQGEKH-YNRGFAYC 636
                          SAPARVV +SS  H        +GK+ F  L   K+ Y    AY 
Sbjct: 66  GHFYLVQLLQDVLCRSAPARVVVVSSESHRFTDINDSSGKLDFSRLSPSKNDYWAMLAYN 125

Query: 637 HSKLANVLFTRELAKRLQGTGVTTYAVHPG-IVQSELVRHSFLLCLLWRLFSRFLKTARE 813
            SKL N+LF+ EL +RL   GVT+ AVHPG ++ S L R  ++  LL+ L   F K+  E
Sbjct: 126 RSKLCNILFSNELHRRLSPRGVTSNAVHPGNMMYSALHRGWWVYTLLFTLARPFTKSMLE 185

Query: 814 GAQTQLHCALAEGLEPLSGQYFSDCKRAWVSQ 909
                 H  L          YF+  K  WV Q
Sbjct: 186 A-----HFIL----------YFTKGKSFWVLQ 202


>ref|XP_584629.2| PREDICTED: similar to Retinol dehydrogenase 13, partial [Bos
           taurus]
          Length = 148

 Score = 90.1 bits (222), Expect = 3e-18
 Identities = 47/90 (52%), Positives = 58/90 (64%)
 Frame = +1

Query: 205 QLHPSGARVYIACRDVLKGESAASEIRADTKNSQVLVRKLDLSDTKSIRASAEGFLTEEK 384
           +L   G  + +ACRD+ K E+AA EIR +T N +V  R LDL+  KSIR  A     EE+
Sbjct: 57  ELAKRGGNIILACRDMEKCEAAAKEIRGETLNHRVNARHLDLASLKSIREFAAKVTEEEE 116

Query: 385 QLHILINNAGVMLCPYSKTADGFETHLGVN 474
            +HILINNA VM CP+  T DGFE  LGVN
Sbjct: 117 HVHILINNAAVMRCPHWTTEDGFEMQLGVN 146


  Database: RefSeqBP
    Posted date:  Aug 1, 2006  7:14 PM
  Number of letters in database: 16,112,626
  Number of sequences in database:  33,508
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 40,420,608
Number of Sequences: 33508
Number of extensions: 1151875
Number of successful extensions: 4681
Number of sequences better than 1.0e-05: 10
Number of HSP's better than  0.0 without gapping: 3800
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4634
length of database: 16,112,626
effective HSP length: 103
effective length of database: 12,661,302
effective search space used: 3279277218
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqSP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611C-000324
         (1089 letters)

Database: RefSeqSP 
           1040 sequences; 434,620 total letters

Searching...done

 ***** No hits found ******

  Database: RefSeqSP
    Posted date:  Aug 1, 2006  7:14 PM
  Number of letters in database: 434,620
  Number of sequences in database:  1040
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,071,724
Number of Sequences: 1040
Number of extensions: 29271
Number of successful extensions: 102
Number of sequences better than 1.0e-05: 0
Number of HSP's better than  0.0 without gapping: 92
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 102
length of database: 434,620
effective HSP length: 78
effective length of database: 353,500
effective search space used: 100394000
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqHP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611C-000324
         (1089 letters)

Database: RefSeqHP 
           39,411 sequences; 17,774,539 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_689656.1| retinol dehydrogenase 12 (all-trans and 9-cis) ...   411   e-115
Alignment   gi|NP_057110.2| androgen-regulated short-chain dehydrogenase/re...   336   2e-92
Alignment   gi|NP_065956.1| retinol dehydrogenase 14 (all-trans and 9-cis) ...   196   4e-50
Alignment   gi|NP_612421.1| retinol dehydrogenase 13 (all-trans and 9-cis) ...   176   3e-44
Alignment   gi|NP_653284.1| hypothetical protein LOC147015 [Homo sapiens]        166   2e-41
Alignment   gi|NP_057457.1| WW domain-containing oxidoreductase isoform 1 [...   133   3e-31
Alignment   gi|NP_660160.1| dehydrogenase/reductase (SDR family) X-linked [...   132   7e-31
Alignment   gi|NP_078981.1| hypothetical protein FLJ13639 isoform 2 [Homo s...    64   3e-10
Alignment   gi|NP_001026889.1| hypothetical protein FLJ13639 isoform 1 [Hom...    57   4e-08
Alignment   gi|XP_371503.3| PREDICTED: similar to short-chain dehydrogenase...    56   5e-08

>ref|NP_689656.1| retinol dehydrogenase 12 (all-trans and 9-cis) [Homo sapiens]
          Length = 316

 Score =  411 bits (1057), Expect = e-115
 Identities = 209/259 (80%), Positives = 218/259 (84%), Gaps = 1/259 (0%)
 Frame = +1

Query: 205 QLHPSGARVYIACRDVLKGESAASEIRADTKNSQVLVRKLDLSDTKSIRASAEGFLTEEK 384
           +L   GARVYIACRDVLKGESAASEIR DTKNSQVLVRKLDLSDTKSIRA AEGFL EEK
Sbjct: 58  ELASRGARVYIACRDVLKGESAASEIRVDTKNSQVLVRKLDLSDTKSIRAFAEGFLAEEK 117

Query: 385 QLHILINNAGVMLCPYSKTADGFETHLGVNXXXXXXXXXXXXXXXKASAPARVVNLSSVV 564
           QLHILINNAGVM+CPYSKTADGFETHLGVN               K SAPARVVN+SSV 
Sbjct: 118 QLHILINNAGVMMCPYSKTADGFETHLGVNHLGHFLLTYLLLEQLKVSAPARVVNVSSVA 177

Query: 565 HHAGKIRFHDLQGEKHYNRGFAYCHSKLANVLFTRELAKRLQGTGVTTYAVHPGIVQSEL 744
           HH GKI FHDLQ EK Y+RGFAYCHSKLANVLFTRELAKRLQGTGVTTYAVHPG+V+SEL
Sbjct: 178 HHIGKIPFHDLQSEKRYSRGFAYCHSKLANVLFTRELAKRLQGTGVTTYAVHPGVVRSEL 237

Query: 745 VRHSFLLCLLWRLFSRFLKTAREGAQTQLHCALAEGLEPLSGQYFSDCKRAWVSQGPRNT 924
           VRHS LLCLLWRLFS F+KTAREGAQT LHCALAEGLEPLSG+YFSDCKR WVS   RN 
Sbjct: 238 VRHSSLLCLLWRLFSPFVKTAREGAQTSLHCALAEGLEPLSGKYFSDCKRTWVSPRARNN 297

Query: 925 -NGRALVNVSCELLGIQWE 978
                L NVSCELLGI+WE
Sbjct: 298 KTAERLWNVSCELLGIRWE 316


>ref|NP_057110.2| androgen-regulated short-chain dehydrogenase/reductase 1 [Homo
           sapiens]
          Length = 318

 Score =  336 bits (862), Expect = 2e-92
 Identities = 169/256 (66%), Positives = 197/256 (76%), Gaps = 1/256 (0%)
 Frame = +1

Query: 205 QLHPSGARVYIACRDVLKGESAASEIRADTKNSQVLVRKLDLSDTKSIRASAEGFLTEEK 384
           +L   GARVY+ACRDV KGE  A EI+  T N QVLVRKLDLSDTKSIRA A+GFL EEK
Sbjct: 60  ELAQRGARVYLACRDVEKGELVAKEIQTTTGNQQVLVRKLDLSDTKSIRAFAKGFLAEEK 119

Query: 385 QLHILINNAGVMLCPYSKTADGFETHLGVNXXXXXXXXXXXXXXXKASAPARVVNLSSVV 564
            LH+LINNAGVM+CPYSKTADGFE H+GVN               K SAP+R+VN+SS+ 
Sbjct: 120 HLHVLINNAGVMMCPYSKTADGFEMHIGVNHLGHFLLTHLLLEKLKESAPSRIVNVSSLA 179

Query: 565 HHAGKIRFHDLQGEKHYNRGFAYCHSKLANVLFTRELAKRLQGTGVTTYAVHPGIVQSEL 744
           HH G+I FH+LQGEK YN G AYCHSKLAN+LFT+ELA+RL+G+GVTTY+VHPG VQSEL
Sbjct: 180 HHLGRIHFHNLQGEKFYNAGLAYCHSKLANILFTQELARRLKGSGVTTYSVHPGTVQSEL 239

Query: 745 VRHSFLLCLLWRLFSRFLKTAREGAQTQLHCALAEGLEPLSGQYFSDCKRAWVSQGPRN- 921
           VRHS  +  +W LFS F+KT ++GAQT LHCAL EGLE LSG +FSDC  AWVS   RN 
Sbjct: 240 VRHSSFMRWMWWLFSFFIKTPQQGAQTSLHCALTEGLEILSGNHFSDCHVAWVSVQARNE 299

Query: 922 TNGRALVNVSCELLGI 969
           T  R L +VSC+LLG+
Sbjct: 300 TIARRLWDVSCDLLGL 315


>ref|NP_065956.1| retinol dehydrogenase 14 (all-trans and 9-cis) [Homo sapiens]
          Length = 336

 Score =  196 bits (497), Expect = 4e-50
 Identities = 105/241 (43%), Positives = 146/241 (60%), Gaps = 17/241 (7%)
 Frame = +1

Query: 220 GARVYIACRDVLKGESAASEIRADTKNS-------------QVLVRKLDLSDTKSIRASA 360
           GARV + CRD  + E AA ++R + + +             +++VR+LDL+  +S+RA  
Sbjct: 67  GARVIMGCRDRARAEEAAGQLRRELRQAAECGPEPGVSGVGELIVRELDLASLRSVRAFC 126

Query: 361 EGFLTEEKQLHILINNAGVMLCPYSKTADGFETHLGVNXXXXXXXXXXXXXXXKASAPAR 540
           +  L EE +L +LINNAG+  CPY KT DGFE   GVN               K+SAP+R
Sbjct: 127 QEMLQEEPRLDVLINNAGIFQCPYMKTEDGFEMQFGVNHLGHFLLTNLLLGLLKSSAPSR 186

Query: 541 VVNLSSVVHHAGKIRFHDLQGEKHYNRGFAYCHSKLANVLFTRELAKRLQGTGVTTYAVH 720
           +V +SS ++  G I F DL  E+ YN+ F Y  SKLAN+LFTRELA+RL+GT VT   +H
Sbjct: 187 IVVVSSKLYKYGDINFDDLNSEQSYNKSFCYSRSKLANILFTRELARRLEGTNVTVNVLH 246

Query: 721 PGIVQSELVRHSFLLCLLWRLFS----RFLKTAREGAQTQLHCALAEGLEPLSGQYFSDC 888
           PGIV++ L RH  +  L+  LF+     F KT  EGAQT ++ A +  +E +SG+YF DC
Sbjct: 247 PGIVRTNLGRHIHIPLLVKPLFNLVSWAFFKTPVEGAQTSIYLASSPEVEGVSGRYFGDC 306

Query: 889 K 891
           K
Sbjct: 307 K 307


>ref|NP_612421.1| retinol dehydrogenase 13 (all-trans and 9-cis) [Homo sapiens]
          Length = 260

 Score =  176 bits (446), Expect = 3e-44
 Identities = 107/247 (43%), Positives = 143/247 (57%), Gaps = 8/247 (3%)
 Frame = +1

Query: 256 KGESAASEIRADTKNSQVLVRKLDLSDTKSIRASAEGFLTEEKQLHILINNAGVMLCPYS 435
           K E+AA +IR +T N  V  R LDL+  KSIR  A   + EE+++ ILINNAGVM CP+ 
Sbjct: 3   KCEAAAKDIRGETLNHHVNARHLDLASLKSIREFAAKIIEEEERVDILINNAGVMRCPHW 62

Query: 436 KTADGFETHLGVNXXXXXXXXXXXXXXXKASAPARVVNLSSVVHHAGKIRFHDLQGE-KH 612
            T DGFE   GVN               KASAP+R++NLSS+ H AG I F DL  + + 
Sbjct: 63  TTEDGFEMQFGVNHLGHFLLTNLLLDKLKASAPSRIINLSSLAHVAGHIDFDDLNWQTRK 122

Query: 613 YNRGFAYCHSKLANVLFTRELAKRLQGTGVTTYAVHPGIVQSELVRH------SFLLCLL 774
           YN   AYC SKLA VLFT+EL++RLQG+GVT  A+HPG+ ++EL RH      +F    L
Sbjct: 123 YNTKAAYCQSKLAIVLFTKELSRRLQGSGVTVNALHPGVARTELGRHTGIHGSTFSSTTL 182

Query: 775 WRLFSRFLKTAREGAQTQLHCALAEGLEPLSGQYFSDCK-RAWVSQGPRNTNGRALVNVS 951
             +F   +K+    AQ   + A+AE L  +SG+YF   K +A   +       R L   S
Sbjct: 183 GPIFWLLVKSPELAAQPSTYLAVAEELADVSGKYFDGLKQKAPAPEAEDEEVARRLWAES 242

Query: 952 CELLGIQ 972
             L+G++
Sbjct: 243 ARLVGLE 249


>ref|NP_653284.1| hypothetical protein LOC147015 [Homo sapiens]
          Length = 327

 Score =  166 bits (421), Expect = 2e-41
 Identities = 105/235 (44%), Positives = 141/235 (60%), Gaps = 7/235 (2%)
 Frame = +1

Query: 205 QLHPSGARVYIACRDVLKGESAASEIRADTKNSQVLVRKLDLSDTKSIRASAEGFLTEEK 384
           +L   GARV +ACR   +GE+AA ++R ++ N++V+   LDL+   S+RA A  FL+ E 
Sbjct: 5   ELARRGARVVLACRSQERGEAAAFDLRQESGNNEVIFMALDLASLASVRAFATAFLSSEP 64

Query: 385 QLHILINNAGVMLCPYSKTADGFETHLGVNXXXXXXXXXXXXXXXKASAPARVVNLSSVV 564
           +L ILI+NAG+  C   +T + F   L VN               KA AP+RVV ++S  
Sbjct: 65  RLDILIHNAGISSC--GRTREAFNLLLRVNHIGPFLLTHLLLPCLKACAPSRVVVVASAA 122

Query: 565 HHAGKIRFHDLQ----GEKHYNRGFAYCHSKLANVLFTRELAKRLQGTGVTTYAVHPGIV 732
           H  G++ F  L     G +   R  AY  +KLANVLF RELA +L+ TGVT YA HPG V
Sbjct: 123 HCRGRLDFKRLDRPVVGWRQELR--AYADTKLANVLFARELANQLEATGVTCYAAHPGPV 180

Query: 733 QSEL-VRH--SFLLCLLWRLFSRFLKTAREGAQTQLHCALAEGLEPLSGQYFSDC 888
            SEL +RH   +L  LL  L    L+  R GAQT L+CAL EG+EPLSG+YF++C
Sbjct: 181 NSELFLRHVPGWLRPLLRPLAWLVLRAPRGGAQTPLYCALQEGIEPLSGRYFANC 235


>ref|NP_057457.1| WW domain-containing oxidoreductase isoform 1 [Homo sapiens]
          Length = 414

 Score =  133 bits (334), Expect = 3e-31
 Identities = 87/238 (36%), Positives = 123/238 (51%), Gaps = 9/238 (3%)
 Frame = +1

Query: 220 GARVYIACRDVLKGESAASEIRADTKNSQVLVRKLDLSDTKSIRASAEGFLTEEKQLHIL 399
           GA V +ACR++ +   A S I  +   ++V    LDL+  +S++  AE F  +   LH+L
Sbjct: 148 GAHVILACRNMARASEAVSRILEEWHKAKVEAMTLDLALLRSVQHFAEAFKAKNVPLHVL 207

Query: 400 INNAGVMLCPYSKTADGFETHLGVNXXXXXXXXXXXXXXXKASAPARVVNLSSVVHH--- 570
           + NA     P+S T DG ET   VN                 SAPARV+ +SS  H    
Sbjct: 208 VCNAATFALPWSLTKDGLETTFQVNHLGHFYLVQLLQDVLCRSAPARVIVVSSESHRFTD 267

Query: 571 ----AGKIRFHDLQGEKH-YNRGFAYCHSKLANVLFTRELAKRLQGTGVTTYAVHPG-IV 732
                GK+ F  L   K+ Y    AY  SKL N+LF+ EL +RL   GVT+ AVHPG ++
Sbjct: 268 INDSLGKLDFSRLSPTKNDYWAMLAYNRSKLCNILFSNELHRRLSPRGVTSNAVHPGNMM 327

Query: 733 QSELVRHSFLLCLLWRLFSRFLKTAREGAQTQLHCALAEGLEPLSGQYFSDCKRAWVS 906
            S + R  ++  LL+ L   F K+ ++GA T ++CA    LE L G YF++C R   S
Sbjct: 328 YSNIHRSWWVYTLLFTLARPFTKSMQQGAATTVYCAAVPELEGLGGMYFNNCCRCMPS 385


>ref|NP_660160.1| dehydrogenase/reductase (SDR family) X-linked [Homo sapiens]
          Length = 330

 Score =  132 bits (331), Expect = 7e-31
 Identities = 93/263 (35%), Positives = 128/263 (48%), Gaps = 13/263 (4%)
 Frame = +1

Query: 220 GARVYIACRDVLKGESAASEIRADTKNSQVLVRKLDLSDTKSIRASAEGFLTEEKQLHIL 399
           G  V IA  +  K +   S+I+ +T N +V     DL+   SIR   + F  ++  LH+L
Sbjct: 67  GMHVIIAGNNDSKAKQVVSKIKEETLNDKVEFLYCDLASMTSIRQFVQKFKMKKIPLHVL 126

Query: 400 INNAGVMLCPYSKTADGFETHLGVNXXXXXXXXXXXXXXXKASA----PARVVNLSSVVH 567
           INNAGVM+ P  KT DGFE H G+N               K S      ARVV +SS  H
Sbjct: 127 INNAGVMMVPQRKTRDGFEEHFGLNYLGHFLLTNLLLDTLKESGSPGHSARVVTVSSATH 186

Query: 568 HAGKIRFHDLQGEKHYNRGFAYCHSKLANVLFTRELAKRL--QGTGVTTYAVHPGIVQSE 741
           +  ++   DLQ    Y+   AY  SKLA VLFT  L + L  +G+ VT   V PG+V ++
Sbjct: 187 YVAELNMDDLQSSACYSPHAAYAQSKLALVLFTYHLQRLLAAEGSHVTANVVDPGVVNTD 246

Query: 742 LVRHSFLLCLL------WRLFSRFLKTAREGAQTQLHCALAEGLEPLSGQYFSDCKRAWV 903
           L +H F    L      W LF    KT  EGA T ++ A+   LE + G+Y  + K    
Sbjct: 247 LYKHVFWATRLAKKLLGWLLF----KTPDEGAWTSIYAAVTPELEGVGGRYLYNEKETKS 302

Query: 904 SQGPRNTN-GRALVNVSCELLGI 969
                N    + L + SCE+ G+
Sbjct: 303 LHVTYNQKLQQQLWSKSCEMTGV 325


>ref|NP_078981.1| hypothetical protein FLJ13639 isoform 2 [Homo sapiens]
          Length = 242

 Score = 63.5 bits (153), Expect = 3e-10
 Identities = 59/207 (28%), Positives = 91/207 (43%), Gaps = 4/207 (1%)
 Frame = +1

Query: 271 ASEIRADTKNSQVLVRKLDLSDTKSIRASAEGFLTEEKQLHILINNAGVMLCPYSKTADG 450
           A ++   + +  + +  +DLSD K I    E F  E K LH+LINNAG M+     T DG
Sbjct: 32  AKQLPLKSPSENIFLHIVDLSDPKQIWKFVENFKQEHK-LHVLINNAGCMVNKRELTEDG 90

Query: 451 FETHLGVNXXXXXXXXXXXXXXXKASAPARVVNLSSVVHHAGKIRFHDLQGEK-HYNRGF 627
            E +   N               +     RV+ +SS      K+  +DLQ E+  ++   
Sbjct: 91  LEKNFAANTLGVYILTTGLIPVLEKEHDPRVITVSSGGMLVQKLNTNDLQSERTPFDGTM 150

Query: 628 AYCHSKLANVLFTRELAKRLQG-TGVTTYAVHPGIVQSELVRHSFLLCLLWRLFSRFLKT 804
            Y  +K   V+ T   A   QG   +   ++HPG   +  VR +  +      F   L++
Sbjct: 151 VYAQNKRQQVVLTERWA---QGHPAIHFSSMHPGWADTPGVRQA--MPGFHARFGDRLRS 205

Query: 805 AREGAQTQLHCAL--AEGLEPLSGQYF 879
             +GA T L  AL  A   +P SG++F
Sbjct: 206 EAQGADTMLWLALSSAAAAQP-SGRFF 231


>ref|NP_001026889.1| hypothetical protein FLJ13639 isoform 1 [Homo sapiens]
          Length = 271

 Score = 56.6 bits (135), Expect = 4e-08
 Identities = 44/154 (28%), Positives = 67/154 (43%), Gaps = 2/154 (1%)
 Frame = +1

Query: 271 ASEIRADTKNSQVLVRKLDLSDTKSIRASAEGFLTEEKQLHILINNAGVMLCPYSKTADG 450
           A ++   + +  + +  +DLSD K I    E F  E K LH+LINNAG M+     T DG
Sbjct: 32  AKQLPLKSPSENIFLHIVDLSDPKQIWKFVENFKQEHK-LHVLINNAGCMVNKRELTEDG 90

Query: 451 FETHLGVNXXXXXXXXXXXXXXXKASAPARVVNLSSVVHHAGKIRFHDLQGEK-HYNRGF 627
            E +   N               +     RV+ +SS      K+  +DLQ E+  ++   
Sbjct: 91  LEKNFAANTLGVYILTTGLIPVLEKEHDPRVITVSSGGMLVQKLNTNDLQSERTPFDGTM 150

Query: 628 AYCHSKLANVLFTRELAKRLQG-TGVTTYAVHPG 726
            Y  +K   V+ T   A   QG   +   ++HPG
Sbjct: 151 VYAQNKRQQVVLTERWA---QGHPAIHFSSMHPG 181


>ref|XP_371503.3| PREDICTED: similar to short-chain dehydrogenase/reductase 1 [Homo
           sapiens]
          Length = 891

 Score = 56.2 bits (134), Expect = 5e-08
 Identities = 29/80 (36%), Positives = 51/80 (63%), Gaps = 1/80 (1%)
 Frame = +1

Query: 220 GARVYIACRDVLKGESAASEIRADTKNSQVLVRKLDLSDTKSIRASAEGFLTEEKQLHIL 399
           GA+V + C+    G+ A +EI+A + ++++L+ ++DLS   SIR+ A   L E  ++H+L
Sbjct: 626 GAQVILTCQSRECGQQALAEIQAASNSNRLLLGEVDLSSMTSIRSFARRLLQENPEIHLL 685

Query: 400 INNAGVM-LCPYSKTADGFE 456
           +NNAGV  + P + T  G +
Sbjct: 686 VNNAGVSGMIPKTLTPGGLD 705


  Database: RefSeqHP
    Posted date:  Aug 2, 2006 12:57 AM
  Number of letters in database: 17,774,539
  Number of sequences in database:  39,411
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 46,222,247
Number of Sequences: 39411
Number of extensions: 1373538
Number of successful extensions: 5721
Number of sequences better than 1.0e-05: 10
Number of HSP's better than  0.0 without gapping: 4711
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5690
length of database: 17,774,539
effective HSP length: 103
effective length of database: 13,715,206
effective search space used: 3552238354
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqCP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611C-000324
         (1089 letters)

Database: RefSeqCP 
           33,732 sequences; 19,266,565 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|XP_547866.2| PREDICTED: similar to retinol dehydrogenase 12 ...   416   e-116
Alignment   gi|XP_854354.1| PREDICTED: similar to Retinol dehydrogenase 11 ...   330   1e-90
Alignment   gi|XP_540096.2| PREDICTED: similar to retinol dehydrogenase 14 ...   194   2e-49
Alignment   gi|XP_854127.1| PREDICTED: similar to Retinol dehydrogenase 13 ...   192   5e-49
Alignment   gi|XP_548293.2| PREDICTED: similar to retinol dehydrogenase 11 ...   168   1e-41
Alignment   gi|XP_857582.1| PREDICTED: similar to retinol dehydrogenase 14 ...   140   2e-33
Alignment   gi|XP_533000.2| PREDICTED: similar to Retinol dehydrogenase 12 ...   133   3e-31
Alignment   gi|XP_852222.1| PREDICTED: similar to dehydrogenase/reductase (...   130   2e-30
Alignment   gi|XP_852623.1| PREDICTED: similar to WW domain-containing oxid...   107   2e-23

>ref|XP_547866.2| PREDICTED: similar to retinol dehydrogenase 12 (all-trans and
           9-cis) [Canis familiaris]
          Length = 303

 Score =  416 bits (1068), Expect = e-116
 Identities = 210/259 (81%), Positives = 220/259 (84%), Gaps = 1/259 (0%)
 Frame = +1

Query: 205 QLHPSGARVYIACRDVLKGESAASEIRADTKNSQVLVRKLDLSDTKSIRASAEGFLTEEK 384
           +L   GARVYIACRDVLKGESAASEIRADTKNSQVLVRKLDLSDTKSIRA AEGFL EEK
Sbjct: 45  ELARRGARVYIACRDVLKGESAASEIRADTKNSQVLVRKLDLSDTKSIRAFAEGFLAEEK 104

Query: 385 QLHILINNAGVMLCPYSKTADGFETHLGVNXXXXXXXXXXXXXXXKASAPARVVNLSSVV 564
           QLHILINNAGVM+CPYSKTADGFETHLGVN               K S PARVVNLSSV 
Sbjct: 105 QLHILINNAGVMMCPYSKTADGFETHLGVNHLGHFLLTHLLLERLKESTPARVVNLSSVA 164

Query: 565 HHAGKIRFHDLQGEKHYNRGFAYCHSKLANVLFTRELAKRLQGTGVTTYAVHPGIVQSEL 744
           HH GKI FHDLQGEK Y+RGFAYCHSKLAN+LFTRELAKRLQGTGVTTYAVHPG+V SEL
Sbjct: 165 HHIGKIHFHDLQGEKRYSRGFAYCHSKLANMLFTRELAKRLQGTGVTTYAVHPGVVSSEL 224

Query: 745 VRHSFLLCLLWRLFSRFLKTAREGAQTQLHCALAEGLEPLSGQYFSDCKRAWVSQGPR-N 921
           VRHSFLLCLLWR+FS F+K+AREGAQT LHCALAEGLEPLSG+YFSDCKRAWVS   R N
Sbjct: 225 VRHSFLLCLLWRIFSPFVKSAREGAQTSLHCALAEGLEPLSGKYFSDCKRAWVSPRARDN 284

Query: 922 TNGRALVNVSCELLGIQWE 978
                L NVSCELLGIQW+
Sbjct: 285 KTAERLWNVSCELLGIQWD 303


>ref|XP_854354.1| PREDICTED: similar to Retinol dehydrogenase 11 (Retinal reductase
           1) (RalR1) (Prostate short-chain dehydrogenase/reductase
           1) (Androgen-regulated short-chain
           dehydrogenase/reductase 1) (HCV core-binding protein
           HCBP12) [Canis familiaris]
          Length = 337

 Score =  330 bits (847), Expect = 1e-90
 Identities = 165/256 (64%), Positives = 196/256 (76%), Gaps = 1/256 (0%)
 Frame = +1

Query: 205 QLHPSGARVYIACRDVLKGESAASEIRADTKNSQVLVRKLDLSDTKSIRASAEGFLTEEK 384
           +L   GARVY+ACRDVLKGE  A EI+  T N QVLVRKLDL+DTKSIRA A+GFL EEK
Sbjct: 79  ELAQRGARVYLACRDVLKGELVAREIQTMTGNKQVLVRKLDLADTKSIRAFAKGFLAEEK 138

Query: 385 QLHILINNAGVMLCPYSKTADGFETHLGVNXXXXXXXXXXXXXXXKASAPARVVNLSSVV 564
            LHILINNAGVM+CPY+KT DGFE H+GVN               K SAP+R+VN+SS+ 
Sbjct: 139 HLHILINNAGVMMCPYTKTVDGFEMHMGVNHLGHFLLTHLLLEKLKESAPSRIVNVSSLA 198

Query: 565 HHAGKIRFHDLQGEKHYNRGFAYCHSKLANVLFTRELAKRLQGTGVTTYAVHPGIVQSEL 744
           HH G+I FHDLQGEK YN G AYCHSKLAN+LFT+ELA+RL+G+G+T Y+VHPG V+SEL
Sbjct: 199 HHLGRIHFHDLQGEKFYNSGLAYCHSKLANILFTQELARRLKGSGITAYSVHPGTVKSEL 258

Query: 745 VRHSFLLCLLWRLFSRFLKTAREGAQTQLHCALAEGLEPLSGQYFSDCKRAWVSQGPRN- 921
           VRHS  +  +W LFS F+KT ++GAQT L+CA+ EGLE LSG +FSDC  AWVS   RN 
Sbjct: 259 VRHSPFMKWMWWLFSFFIKTPQQGAQTSLYCAITEGLEVLSGHHFSDCSVAWVSAQARNE 318

Query: 922 TNGRALVNVSCELLGI 969
           T  R L +VSC+LLGI
Sbjct: 319 TIARRLWDVSCDLLGI 334


>ref|XP_540096.2| PREDICTED: similar to retinol dehydrogenase 14 (all-trans and
           9-cis) isoform 1 [Canis familiaris]
          Length = 336

 Score =  194 bits (492), Expect = 2e-49
 Identities = 105/241 (43%), Positives = 145/241 (60%), Gaps = 17/241 (7%)
 Frame = +1

Query: 220 GARVYIACRDVLKGESAASEIRADTKNS-------------QVLVRKLDLSDTKSIRASA 360
           GARV + CRD  + E AA ++R + + +             +++VR+LDL+  +S+RA  
Sbjct: 67  GARVIMGCRDRARAEEAAGQLRRELRQAGGREPGSDVGAAGELVVRELDLASLRSVRAFC 126

Query: 361 EGFLTEEKQLHILINNAGVMLCPYSKTADGFETHLGVNXXXXXXXXXXXXXXXKASAPAR 540
           +  L EE +L +LINNAG+  CPY KT DGFE   GVN               K SAP+R
Sbjct: 127 QEVLQEEPRLDVLINNAGIFQCPYMKTEDGFEMQFGVNHLGHFLLTNLLLGLLKNSAPSR 186

Query: 541 VVNLSSVVHHAGKIRFHDLQGEKHYNRGFAYCHSKLANVLFTRELAKRLQGTGVTTYAVH 720
           +V +SS ++  G I F DL  E+ YN+ F Y  SKLAN+LFTRELA+RL+GT VT   +H
Sbjct: 187 IVVVSSKLYKYGDINFEDLNSEQSYNKSFCYSRSKLANILFTRELARRLEGTNVTVNVLH 246

Query: 721 PGIVQSELVRHSFLLCLLWRLFS----RFLKTAREGAQTQLHCALAEGLEPLSGQYFSDC 888
           PGIV++ L RH  +  L+  LF+     F KT  EGAQT ++ A +  +E +SG+YF DC
Sbjct: 247 PGIVRTNLGRHIHIPLLVRPLFNLVSWAFFKTPVEGAQTSVYLASSPEVEGVSGKYFGDC 306

Query: 889 K 891
           K
Sbjct: 307 K 307


>ref|XP_854127.1| PREDICTED: similar to Retinol dehydrogenase 13 [Canis familiaris]
          Length = 334

 Score =  192 bits (488), Expect = 5e-49
 Identities = 109/236 (46%), Positives = 144/236 (61%), Gaps = 7/236 (2%)
 Frame = +1

Query: 205 QLHPSGARVYIACRDVLKGESAASEIRADTKNSQVLVRKLDLSDTKSIRASAEGFLTEEK 384
           +L   G  + +ACRD+ K E+AA EIR +T N +V    LDL+  KSIR  A   + EE+
Sbjct: 57  ELARRGGNIILACRDMEKCEAAAKEIRGETLNHRVSAWHLDLASLKSIREFAAKIIEEEE 116

Query: 385 QLHILINNAGVMLCPYSKTADGFETHLGVNXXXXXXXXXXXXXXXKASAPARVVNLSSVV 564
           Q+HIL+NNA VM CP+  T DGFE   GVN               KASAP+R++NLSS+ 
Sbjct: 117 QVHILVNNAAVMRCPHWTTKDGFEMQFGVNHLGHFLLTNLLLDKLKASAPSRIINLSSLA 176

Query: 565 HHAGKIRFHDLQGEKH-YNRGFAYCHSKLANVLFTRELAKRLQGTGVTTYAVHPGIVQSE 741
           H AG I F DL  EK  Y+   AYC SKLA +LFT+EL++RLQGTGVT  A+HPG+ ++E
Sbjct: 177 HVAGHIDFDDLNWEKRKYDTKAAYCQSKLAVILFTKELSRRLQGTGVTVNALHPGVARTE 236

Query: 742 LVRH------SFLLCLLWRLFSRFLKTAREGAQTQLHCALAEGLEPLSGQYFSDCK 891
           L RH      +F    L  +F   +K+ +  AQ   + A+AE LE +SG+YF   K
Sbjct: 237 LGRHTGMHSSAFSSFTLGPIFWLLVKSPQLAAQPSTYLAVAEELEGVSGKYFDGLK 292


>ref|XP_548293.2| PREDICTED: similar to retinol dehydrogenase 11 (predicted) [Canis
           familiaris]
          Length = 377

 Score =  168 bits (425), Expect = 1e-41
 Identities = 107/235 (45%), Positives = 140/235 (59%), Gaps = 7/235 (2%)
 Frame = +1

Query: 205 QLHPSGARVYIACRDVLKGESAASEIRADTKNSQVLVRKLDLSDTKSIRASAEGFLTEEK 384
           +L   GARV +ACR   +GE+AA ++R ++ N++V+   LDL+   S+RA A  FL+ E 
Sbjct: 55  ELARRGARVVLACRSRERGEAAAFDLRQESGNNEVIFMALDLASLASVRAFATAFLSSEP 114

Query: 385 QLHILINNAGVMLCPYSKTADGFETHLGVNXXXXXXXXXXXXXXXKASAPARVVNLSSVV 564
           +L ILI+NAG+  C   +T   F   L VN               K  AP+RVV +SS  
Sbjct: 115 RLDILIHNAGISSC--GRTHKPFNLLLRVNHIGPFLLTHLLLPRLKTCAPSRVVVVSSAA 172

Query: 565 HHAGKIRFHDLQ----GEKHYNRGFAYCHSKLANVLFTRELAKRLQGTGVTTYAVHPGIV 732
           H  G++ F  L     G +   R  AY  SKLANVLF RELA +L+GTGVT YA HPG V
Sbjct: 173 HRRGRLDFTRLDRPVVGWQQELR--AYADSKLANVLFARELATQLEGTGVTCYAAHPGPV 230

Query: 733 QSEL-VRH--SFLLCLLWRLFSRFLKTAREGAQTQLHCALAEGLEPLSGQYFSDC 888
            SEL +RH   +L  LL  L    L+  R GAQT L+CAL EG+EPLSG+YF++C
Sbjct: 231 NSELFLRHVPGWLCPLLRPLAWLMLRAPRGGAQTPLYCALQEGIEPLSGRYFANC 285


>ref|XP_857582.1| PREDICTED: similar to retinol dehydrogenase 14 (all-trans and
           9-cis) isoform 4 [Canis familiaris]
          Length = 307

 Score =  140 bits (353), Expect = 2e-33
 Identities = 87/241 (36%), Positives = 124/241 (51%), Gaps = 17/241 (7%)
 Frame = +1

Query: 220 GARVYIACRDVLKGESAASEIRADTKNS-------------QVLVRKLDLSDTKSIRASA 360
           GARV + CRD  + E AA ++R + + +             +++VR+LDL+  +S+RA  
Sbjct: 67  GARVIMGCRDRARAEEAAGQLRRELRQAGGREPGSDVGAAGELVVRELDLASLRSVRAFC 126

Query: 361 EGFLTEEKQLHILINNAGVMLCPYSKTADGFETHLGVNXXXXXXXXXXXXXXXKASAPAR 540
           +  L                               GVN               K SAP+R
Sbjct: 127 QEVL-----------------------------QFGVNHLGHFLLTNLLLGLLKNSAPSR 157

Query: 541 VVNLSSVVHHAGKIRFHDLQGEKHYNRGFAYCHSKLANVLFTRELAKRLQGTGVTTYAVH 720
           +V +SS ++  G I F DL  E+ YN+ F Y  SKLAN+LFTRELA+RL+GT VT   +H
Sbjct: 158 IVVVSSKLYKYGDINFEDLNSEQSYNKSFCYSRSKLANILFTRELARRLEGTNVTVNVLH 217

Query: 721 PGIVQSELVRHSFLLCLLWRLFS----RFLKTAREGAQTQLHCALAEGLEPLSGQYFSDC 888
           PGIV++ L RH  +  L+  LF+     F KT  EGAQT ++ A +  +E +SG+YF DC
Sbjct: 218 PGIVRTNLGRHIHIPLLVRPLFNLVSWAFFKTPVEGAQTSVYLASSPEVEGVSGKYFGDC 277

Query: 889 K 891
           K
Sbjct: 278 K 278


>ref|XP_533000.2| PREDICTED: similar to Retinol dehydrogenase 12 [Canis familiaris]
          Length = 596

 Score =  133 bits (335), Expect = 3e-31
 Identities = 85/228 (37%), Positives = 130/228 (57%), Gaps = 2/228 (0%)
 Frame = +1

Query: 205  QLHPSGARVYIACRDVLKGESAASEIRADTKNSQVLVRKLDLSDTKSIRASAEGFLTEEK 384
            +L   GARV +ACR+  +G+ A +EI+  +K + +L+ ++DLS   SIR+ A   L E  
Sbjct: 334  ELARRGARVILACRNWERGQKALAEIQVASKGTCLLLGQVDLSSMASIRSFARWLLQEYP 393

Query: 385  QLHILINNAGVMLCPYSKTADGFETHLGVNXXXXXXXXXXXXXXXKASAPARVVNLSSVV 564
            ++H+L+NNA +   P + T +G +     N               + +  ARVVN+SS  
Sbjct: 394  EIHLLVNNAAISGFPKTLTPEGLDLTFATNYVGPFLLTNLLQGALQRAGSARVVNVSSFR 453

Query: 565  HHAGKIRFHDLQGE-KHYNRGFAYCHSKLANVLFTRELAKRLQGTGVTTYAVHPGIVQSE 741
            H  G +    L G  K  N   +Y  SKL    FT ELA+RLQGTGVT  +V PG+V +E
Sbjct: 454  HAHGYVDEKHLTGAGKPLNLIQSYDCSKLLLTSFTGELARRLQGTGVTVNSVDPGVVYTE 513

Query: 742  LVR-HSFLLCLLWRLFSRFLKTAREGAQTQLHCALAEGLEPLSGQYFS 882
            +++ + +L   L+ LFS F K  ++GA   L+ +LA+ L+ +SG+YFS
Sbjct: 514  IMKPYPWLYRFLFWLFSFFCKDVKQGAIPVLYLSLAKELDGVSGKYFS 561


>ref|XP_852222.1| PREDICTED: similar to dehydrogenase/reductase (SDR family) X-linked
           [Canis familiaris]
          Length = 387

 Score =  130 bits (328), Expect = 2e-30
 Identities = 88/227 (38%), Positives = 119/227 (52%), Gaps = 8/227 (3%)
 Frame = +1

Query: 220 GARVYIACRDVLKGESAASEIRADTKNSQVLVRKLDLSDTKSIRASAEGFLTEEKQLHIL 399
           G  V +A  +         +I+ +T N +V     DL+  +SIR   + F  ++  LH+L
Sbjct: 119 GMHVILAGNNDSSAPDVVRKIQEETLNDKVEFLYCDLASLRSIRQFVQKFKKKKIPLHVL 178

Query: 400 INNAGVMLCPYSKTADGFETHLGVNXXXXXXXXXXXXXXXKAS-AP---ARVVNLSSVVH 567
           +NNAGVM+ P   T DGFE H G+N               K S AP   ARVV +SS  H
Sbjct: 179 VNNAGVMMVPERTTEDGFEEHFGLNYLGHFLLTNLLLDTLKESGAPGRCARVVTVSSATH 238

Query: 568 HAGKIRFHDLQGEKHYNRGFAYCHSKLANVLFTRELAKRL--QGTGVTTYAVHPGIVQSE 741
           + G++   DLQG + Y+   AY  SKLA VLFT  L + L  QG+ VT   V PG+V + 
Sbjct: 239 YIGELDMDDLQGSRCYSPHAAYAQSKLALVLFTYHLQRLLAAQGSPVTANVVDPGVVNTN 298

Query: 742 LVRHSFL-LCLLWRLFS-RFLKTAREGAQTQLHCALAEGLEPLSGQY 876
           L RH F    L+ +LF   F KT  EGA T ++ A+   LE L G+Y
Sbjct: 299 LYRHVFWGTRLIKKLFGWWFFKTPDEGAWTSVYAAVTPDLEGLGGRY 345


>ref|XP_852623.1| PREDICTED: similar to WW domain-containing oxidoreductase isoform 1
           [Canis familiaris]
          Length = 383

 Score =  107 bits (268), Expect = 2e-23
 Identities = 73/204 (35%), Positives = 105/204 (51%), Gaps = 9/204 (4%)
 Frame = +1

Query: 220 GARVYIACRDVLKGESAASEIRADTKNSQVLVRKLDLSDTKSIRASAEGFLTEEKQLHIL 399
           GA V +ACR++ +   A S+I  +   ++V    LDL+  +S++  A+ F  +   LH+L
Sbjct: 148 GAHVILACRNMTRANEAVSQILGEWHKAKVEAMTLDLALLRSVQHFAQAFKAKNVSLHVL 207

Query: 400 INNAGVMLCPYSKTADGFETHLGVNXXXXXXXXXXXXXXXKASAPARVVNLSSVVHH--- 570
           + NA     P+S T DG ET   VN                 SAPARVV +SS  H    
Sbjct: 208 VCNAAAFALPWSLTKDGLETTFQVNHLGHFYLVQLLQDVLCRSAPARVVVVSSESHRFTD 267

Query: 571 ----AGKIRFHDLQGEK-HYNRGFAYCHSKLANVLFTRELAKRLQGTGVTTYAVHPG-IV 732
               +GK+ F  L   K  Y    AY  SKL N+LF+ EL +RL   GVT+ AVHPG ++
Sbjct: 268 INDSSGKLDFSRLSPSKSDYWAMLAYNRSKLCNILFSNELHRRLSPRGVTSNAVHPGNMM 327

Query: 733 QSELVRHSFLLCLLWRLFSRFLKT 804
            S + R+ ++  LL+ L   F K+
Sbjct: 328 YSSIHRNWWVYTLLFTLARPFTKS 351


  Database: RefSeqCP
    Posted date:  Aug 1, 2006  9:25 PM
  Number of letters in database: 19,266,565
  Number of sequences in database:  33,732
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 47,306,757
Number of Sequences: 33732
Number of extensions: 1342297
Number of successful extensions: 5327
Number of sequences better than 1.0e-05: 9
Number of HSP's better than  0.0 without gapping: 4382
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5296
length of database: 19,266,565
effective HSP length: 104
effective length of database: 15,758,437
effective search space used: 4065676746
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqMP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611C-000324
         (1089 letters)

Database: RefSeqMP 
           45,328 sequences; 21,768,885 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_084293.1| retinol dehydrogenase 12 [Mus musculus]              378   e-105
Alignment   gi|NP_067532.2| short-chain dehydrogenase/reductase 1 [Mus musc...   327   1e-89
Alignment   gi|NP_076186.1| alcohol dehydrogenase PAN2 [Mus musculus]            199   6e-51
Alignment   gi|NP_780581.1| retinol dehydrogenase 13 (all-trans and 9-cis) ...   183   2e-46
Alignment   gi|NP_062519.2| WW-domain oxidoreductase [Mus musculus]              135   6e-32
Alignment   gi|NP_899109.1| hypothetical protein LOC70451 [Mus musculus]         128   1e-29
Alignment   gi|NP_001028498.1| dehydrogenase/reductase (SDR family) X chrom...   126   5e-29
Alignment   gi|NP_079798.1| retinal short-chain dehydrogenase/reductase 4 [...    52   1e-06

>ref|NP_084293.1| retinol dehydrogenase 12 [Mus musculus]
          Length = 316

 Score =  378 bits (971), Expect = e-105
 Identities = 194/259 (74%), Positives = 207/259 (79%), Gaps = 1/259 (0%)
 Frame = +1

Query: 205 QLHPSGARVYIACRDVLKGESAASEIRADTKNSQVLVRKLDLSDTKSIRASAEGFLTEEK 384
           +L   GARVYIACRDVLKGESAASEIRADTKNSQVLVRKLDLSDTKSIRA AE FL EEK
Sbjct: 58  ELARRGARVYIACRDVLKGESAASEIRADTKNSQVLVRKLDLSDTKSIRAFAERFLAEEK 117

Query: 385 QLHILINNAGVMLCPYSKTADGFETHLGVNXXXXXXXXXXXXXXXKASAPARVVNLSSVV 564
           +LHILINNAGVM+CPYSKT DGFETH GVN               K SAPARVVNLSS+ 
Sbjct: 118 KLHILINNAGVMMCPYSKTTDGFETHFGVNHLGHFLLTYLLLERLKESAPARVVNLSSIA 177

Query: 565 HHAGKIRFHDLQGEKHYNRGFAYCHSKLANVLFTRELAKRLQGTGVTTYAVHPGIVQSEL 744
           H  GKIRFHDLQG+K Y   FAY HSKLAN+LFTRELAKRLQGTGVT YAVHPG+V SE+
Sbjct: 178 HLIGKIRFHDLQGQKRYCSAFAYGHSKLANLLFTRELAKRLQGTGVTAYAVHPGVVLSEI 237

Query: 745 VRHSFLLCLLWRLFSRFLKTAREGAQTQLHCALAEGLEPLSGQYFSDCKRAWVSQGPRN- 921
            R+S+LLCLLWRLFS F K+  +GAQT LHCALAE LEPLSG+YFSDCKR WVS   RN 
Sbjct: 238 TRNSYLLCLLWRLFSPFFKSTSQGAQTSLHCALAEDLEPLSGKYFSDCKRMWVSSRARNK 297

Query: 922 TNGRALVNVSCELLGIQWE 978
                L NVSCELLGIQWE
Sbjct: 298 KTAERLWNVSCELLGIQWE 316


>ref|NP_067532.2| short-chain dehydrogenase/reductase 1 [Mus musculus]
          Length = 316

 Score =  327 bits (838), Expect = 1e-89
 Identities = 165/251 (65%), Positives = 195/251 (77%), Gaps = 1/251 (0%)
 Frame = +1

Query: 220 GARVYIACRDVLKGESAASEIRADTKNSQVLVRKLDLSDTKSIRASAEGFLTEEKQLHIL 399
           GARVY+ACRDV KGE AA EI+A T NSQV VRKLDL+DTKSIRA A+ FL EEK LH+L
Sbjct: 62  GARVYLACRDVDKGELAAREIQAVTGNSQVFVRKLDLADTKSIRAFAKDFLAEEKHLHLL 121

Query: 400 INNAGVMLCPYSKTADGFETHLGVNXXXXXXXXXXXXXXXKASAPARVVNLSSVVHHAGK 579
           INNAGVM+CPYSKTADGFE H+GVN               K SAP+R+VNLSS+ HH G+
Sbjct: 122 INNAGVMMCPYSKTADGFEMHIGVNHLGHFLLTHLLLEKLKESAPSRIVNLSSLGHHLGR 181

Query: 580 IRFHDLQGEKHYNRGFAYCHSKLANVLFTRELAKRLQGTGVTTYAVHPGIVQSELVRHSF 759
           I FH+LQGEK Y+ G AYCHSKLAN+LFT+ELAKRL+G+GVTTY+VHPG V SEL R+S 
Sbjct: 182 IHFHNLQGEKFYSAGLAYCHSKLANILFTKELAKRLKGSGVTTYSVHPGTVHSELTRYSS 241

Query: 760 LLCLLWRLFSRFLKTAREGAQTQLHCALAEGLEPLSGQYFSDCKRAWVS-QGPRNTNGRA 936
           ++  LW+LF  F+KT +EGAQT L+CAL EGLE LSG +FSDC+ AWVS QG      R 
Sbjct: 242 IMRWLWQLFFVFIKTPQEGAQTSLYCALTEGLESLSGSHFSDCQLAWVSYQGRNEIIARR 301

Query: 937 LVNVSCELLGI 969
           L +VSC+LLG+
Sbjct: 302 LWDVSCDLLGL 312


>ref|NP_076186.1| alcohol dehydrogenase PAN2 [Mus musculus]
          Length = 334

 Score =  199 bits (505), Expect = 6e-51
 Identities = 107/238 (44%), Positives = 146/238 (61%), Gaps = 14/238 (5%)
 Frame = +1

Query: 220 GARVYIACRDVLKGESAASEIRA----------DTKNSQVLVRKLDLSDTKSIRASAEGF 369
           GARV + CRD  + E AA ++R           D  + Q++V++LDL+  +S+RA  +  
Sbjct: 68  GARVIMGCRDRARAEEAAGQLRQELCQAGGAGPDGTDGQLVVKELDLASLRSVRAFCQEL 127

Query: 370 LTEEKQLHILINNAGVMLCPYSKTADGFETHLGVNXXXXXXXXXXXXXXXKASAPARVVN 549
           L EE +L +LINNAGV  CPY+KT DGFE   GVN               K+SAP+R+V 
Sbjct: 128 LQEEPRLDVLINNAGVFHCPYTKTEDGFEMQFGVNHLGHFLLTNLLLGLLKSSAPSRIVV 187

Query: 550 LSSVVHHAGKIRFHDLQGEKHYNRGFAYCHSKLANVLFTRELAKRLQGTGVTTYAVHPGI 729
           +SS ++  G+I F DL  E+ YN+ F Y  SKLAN+LFTRELA+RL+GT VT   +HPGI
Sbjct: 188 VSSKLYKYGEINFEDLNSEQSYNKSFCYSRSKLANILFTRELARRLEGTNVTVNVLHPGI 247

Query: 730 VQSELVRHSFLLCLLWRLFS----RFLKTAREGAQTQLHCALAEGLEPLSGQYFSDCK 891
           V++ L RH  +  L   LF+     F KT  EGAQT ++ A +  +E +SG+YF DCK
Sbjct: 248 VRTNLGRHIHIPLLARPLFNLVSWAFFKTPLEGAQTSIYLACSPDVEGVSGRYFGDCK 305


>ref|NP_780581.1| retinol dehydrogenase 13 (all-trans and 9-cis) [Mus musculus]
          Length = 334

 Score =  183 bits (465), Expect = 2e-46
 Identities = 111/263 (42%), Positives = 151/263 (57%), Gaps = 8/263 (3%)
 Frame = +1

Query: 205 QLHPSGARVYIACRDVLKGESAASEIRADTKNSQVLVRKLDLSDTKSIRASAEGFLTEEK 384
           +L   G  V +ACRD+ K E AA +IR +T N +V   +LDL+  KSIR  A   + EE+
Sbjct: 57  ELAKRGGNVILACRDMEKCEVAAKDIRGETLNPRVRAERLDLASLKSIREFARKVIKEEE 116

Query: 385 QLHILINNAGVMLCPYSKTADGFETHLGVNXXXXXXXXXXXXXXXKASAPARVVNLSSVV 564
           ++ IL+NNA VM CP+  T DGFE   GVN               KASAP+R++NLSS+ 
Sbjct: 117 RVDILVNNAAVMRCPHWTTEDGFEMQFGVNYLGHFLLTNLLLDKLKASAPSRIINLSSLA 176

Query: 565 HHAGKIRFHDLQGE-KHYNRGFAYCHSKLANVLFTRELAKRLQGTGVTTYAVHPGIVQSE 741
           H AG I F DL  + K Y+   AYC SKLA VLFT+EL+ RLQG+GVT  A+HPG+ ++E
Sbjct: 177 HVAGHIDFEDLNWQMKKYDTKAAYCQSKLAVVLFTKELSHRLQGSGVTVNALHPGVARTE 236

Query: 742 LVRH------SFLLCLLWRLFSRFLKTAREGAQTQLHCALAEGLEPLSGQYFSDCK-RAW 900
           L RH      +F   +L   F    K+ +  AQ   + A+AE LE +SG+YF   + +A 
Sbjct: 237 LGRHTGMHNSAFSGFMLGPFFWLLFKSPQLAAQPSTYLAVAEELENVSGKYFDGLREKAP 296

Query: 901 VSQGPRNTNGRALVNVSCELLGI 969
             +       R L   S  L+G+
Sbjct: 297 SPEAEDEEVARRLWTESARLVGL 319


>ref|NP_062519.2| WW-domain oxidoreductase [Mus musculus]
          Length = 414

 Score =  135 bits (341), Expect = 6e-32
 Identities = 91/258 (35%), Positives = 136/258 (52%), Gaps = 10/258 (3%)
 Frame = +1

Query: 220 GARVYIACRDVLKGESAASEIRADTKNSQVLVRKLDLSDTKSIRASAEGFLTEEKQLHIL 399
           GA V +ACR++ +   A S I  +   ++V    LDL+  +S++  AE F  +   LH+L
Sbjct: 148 GAHVILACRNLSRASEAVSRILEEWHKAKVEAMTLDLAVLRSVQHFAEAFKAKNVSLHVL 207

Query: 400 INNAGVMLCPYSKTADGFETHLGVNXXXXXXXXXXXXXXXKASAPARVVNLSSVVHH--- 570
           + NAG    P+  T DG ET   VN                 S+PARV+ +SS  H    
Sbjct: 208 VCNAGTFALPWGLTKDGLETTFQVNHLGHFYLVQLLQDVLCRSSPARVIVVSSESHRFTD 267

Query: 571 ----AGKIRFHDLQGEK-HYNRGFAYCHSKLANVLFTRELAKRLQGTGVTTYAVHPG-IV 732
               +GK+    L   +  Y    AY  SKL N+LF+ EL +RL   GVT+ AVHPG ++
Sbjct: 268 INDSSGKLDLSRLSPPRSDYWAMLAYNRSKLCNILFSNELHRRLSPRGVTSNAVHPGNMM 327

Query: 733 QSELVRHSFLLCLLWRLFSRFLKTAREGAQTQLHCALAEGLEPLSGQYFSDCKRAWVSQG 912
            S + R+S++  LL+ L   F K+ ++GA T ++CA+A  LE L G YF++C R   S+ 
Sbjct: 328 YSAIHRNSWVYKLLFTLARPFTKSMQQGAATTVYCAVAPELEGLGGMYFNNCCRCLPSEE 387

Query: 913 PRN-TNGRALVNVSCELL 963
            ++    RAL  +S  L+
Sbjct: 388 AQSEETARALWELSERLI 405


>ref|NP_899109.1| hypothetical protein LOC70451 [Mus musculus]
          Length = 260

 Score =  128 bits (321), Expect = 1e-29
 Identities = 80/188 (42%), Positives = 111/188 (59%), Gaps = 5/188 (2%)
 Frame = +1

Query: 205 QLHPSGARVYIACRDVLKGESAASEIRADTKNSQVLVRKLDLSDTKSIRASAEGFLTEEK 384
           +L   GARV +ACR   +GE+AA ++R ++ N++V+   LDL+   S++A A  FL+ E 
Sbjct: 55  ELARRGARVVLACRSRERGEAAAFDLRQESGNNEVIFMALDLASLASVQAFATAFLSSEP 114

Query: 385 QLHILINNAGVMLCPYSKTADGFETHLGVNXXXXXXXXXXXXXXXKASAPARVVNLSSVV 564
           +L +LI+NAG+  C   +T + F   L VN               ++ AP+RVV +SS  
Sbjct: 115 RLDVLIHNAGISSC--GRTRETFNLLLRVNHVGPFLLTHLLLPRLRSCAPSRVVIVSSAA 172

Query: 565 HHAGKIRFHDLQ----GEKHYNRGFAYCHSKLANVLFTRELAKRLQGTGVTTYAVHPGIV 732
           H  G++ F  L     G +   R  AY  SKLANVLF RELA +L+GTGVT YA HPG V
Sbjct: 173 HRRGRLDFTRLDCPVVGWQQELR--AYADSKLANVLFARELATQLEGTGVTCYAAHPGPV 230

Query: 733 QSEL-VRH 753
            SEL +RH
Sbjct: 231 NSELFLRH 238


>ref|NP_001028498.1| dehydrogenase/reductase (SDR family) X chromosome [Mus musculus]
          Length = 335

 Score =  126 bits (316), Expect = 5e-29
 Identities = 85/235 (36%), Positives = 117/235 (49%), Gaps = 8/235 (3%)
 Frame = +1

Query: 205 QLHPSGARVYIACRDVLKGESAASEIRADTKNSQVLVRKLDLSDTKSIRASAEGFLTEEK 384
           QL   G  V +A  D  +G+   S IRA+  + +     LDL+   S+R  A  F     
Sbjct: 62  QLARLGMCVVVAGNDEHRGQEVVSSIRAEMGSDRAHFLPLDLASLASVRGFARDFQALGL 121

Query: 385 QLHILINNAGVMLCPYSKTADGFETHLGVNXXXXXXXXXXXXXXXKASAP----ARVVNL 552
            LH+L+NNAGVML P ++T DGFE HLGVN               +AS      +RVV +
Sbjct: 122 PLHLLVNNAGVMLEPRAETEDGFERHLGVNFLGHFLLTLLLLPALRASGAEGRGSRVVTV 181

Query: 553 SSVVHHAGKIRFHDLQGEKHYNRGFAYCHSKLANVLFTRELAKRLQGTG--VTTYAVHPG 726
            S  H+ G +   DL G   Y+   AY  SKLA  LF  +L + L   G  VT+    PG
Sbjct: 182 GSATHYVGTVDMADLHGRHAYSPYAAYAQSKLALALFALQLQRILDARGDPVTSNMADPG 241

Query: 727 IVQSELVRHSFLLCLLWRLFSRFL--KTAREGAQTQLHCALAEGLEPLSGQYFSD 885
           +V +EL RH+  +    + F  +L  K+  EGA T ++ A A  LE + G+Y  D
Sbjct: 242 VVDTELYRHAGWVLRTAKRFLGWLVFKSPEEGAWTLVYAAAAPELEGVGGRYLRD 296


>ref|NP_079798.1| retinal short-chain dehydrogenase/reductase 4 [Mus musculus]
          Length = 288

 Score = 52.0 bits (123), Expect = 1e-06
 Identities = 51/208 (24%), Positives = 80/208 (38%), Gaps = 1/208 (0%)
 Frame = +1

Query: 295 KNSQVLVRKLDLSDTKSIRASAEGFLTEEKQLHILINNAGVMLCPYSKTADGFETHLGVN 474
           K   +LV  LDL+DT S  A+ +  L E  ++ IL+NN G      S+ +   ET+L V 
Sbjct: 51  KEKDILVLPLDLTDTSSHEAATKAVLQEFGKIDILVNNGG-----RSQRSLVLETNLDVF 105

Query: 475 XXXXXXXXXXXXXXXKASAPARVVNLSSVVHHAGKIRFHDLQGEKHYNRGFAYCHSKLAN 654
                          K   P  +      +     +  + + G    +    YC SK A 
Sbjct: 106 KELINLNYIGTVSLTKCVLPHMIERKQGKI-----VTVNSIAGIASVSLSSGYCASKHAL 160

Query: 655 VLFTRELAKRL-QGTGVTTYAVHPGIVQSELVRHSFLLCLLWRLFSRFLKTAREGAQTQL 831
             F   L   L Q  G+T   V+PG VQS++V+++F             K+ R       
Sbjct: 161 RGFFNALHSELGQYPGITFCNVYPGPVQSDIVKNAFT--------EEVTKSMRNNIDQSY 212

Query: 832 HCALAEGLEPLSGQYFSDCKRAWVSQGP 915
               +  +  +     +D K  W+S  P
Sbjct: 213 KMPTSRCVRLMLISMANDLKEVWISDHP 240


  Database: RefSeqMP
    Posted date:  Aug 2, 2006 12:58 AM
  Number of letters in database: 21,768,885
  Number of sequences in database:  45,328
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 54,061,394
Number of Sequences: 45328
Number of extensions: 1520911
Number of successful extensions: 5984
Number of sequences better than 1.0e-05: 8
Number of HSP's better than  0.0 without gapping: 4913
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5958
length of database: 21,768,885
effective HSP length: 105
effective length of database: 17,009,445
effective search space used: 4371427365
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)