Animal-Genome cDNA 20060611C-000325


Search to RefSeqBP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611C-000325
         (1737 letters)

Database: RefSeqBP 
           33,508 sequences; 16,112,626 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_899207.1| double substrate-specificity short chain dehydr...   550   e-156
Alignment   gi|XP_870721.1| PREDICTED: similar to Retinol dehydrogenase 11 ...   338   8e-93
Alignment   gi|XP_582373.2| PREDICTED: similar to Retinol dehydrogenase 11 ...   332   7e-91
Alignment   gi|XP_582319.2| PREDICTED: similar to retinol dehydrogenase 14 ...   248   1e-65
Alignment   gi|XP_592820.2| PREDICTED: similar to retinol dehydrogenase 11 ...   235   7e-62
Alignment   gi|XP_584642.2| PREDICTED: similar to retinol dehydrogenase 11 ...   175   1e-43
Alignment   gi|XP_584629.2| PREDICTED: similar to Retinol dehydrogenase 13,...   144   2e-34
Alignment   gi|XP_591168.2| PREDICTED: similar to dehydrogenase/reductase (...   132   9e-31
Alignment   gi|XP_584810.2| PREDICTED: similar to retinol dehydrogenase 13 ...   129   6e-30
Alignment   gi|XP_583859.2| PREDICTED: similar to short chain dehydrogenase...   112   1e-24

>ref|NP_899207.1| double substrate-specificity short chain dehydrogenase/reductase 2
            [Bos taurus]
          Length = 316

 Score =  550 bits (1416), Expect = e-156
 Identities = 277/316 (87%), Positives = 287/316 (90%)
 Frame = +1

Query: 154  MLAVLGLLTSFLFFLYVTAPSIRKFFAGGVCRTNMQLPGKVVVITGANTGIGKETARELA 333
            ML VLGLLTSFL FLYV APSIRKFFAGGVCRT++QL GKVVVITGANTGIGKETARELA
Sbjct: 1    MLVVLGLLTSFLSFLYVIAPSIRKFFAGGVCRTDVQLFGKVVVITGANTGIGKETARELA 60

Query: 334  RRGARVYIACRDVLKGESAASEIRADTKNSQVLVRKLDLSDTKSIRAFAEGFLTEEKQLH 513
            RRGARVYIACRDVLKGESAASEI+ADTKNSQVLVRKLDLSDTKSIRAFAEGFL EEKQLH
Sbjct: 61   RRGARVYIACRDVLKGESAASEIQADTKNSQVLVRKLDLSDTKSIRAFAEGFLAEEKQLH 120

Query: 514  ILINNAGVMLCPYSKTADGFETHLGVNXXXXXXXXXXXXXXXKASAPARVVNLSSVVHHA 693
            ILINNAGVMLCPYSKTADGFETHL VN               K SAPARVVNLSSV HH 
Sbjct: 121  ILINNAGVMLCPYSKTADGFETHLAVNHLGHFLLTHLLLGRLKESAPARVVNLSSVAHHL 180

Query: 694  GKIRFHDLQGEKHYNRGFAYCHSKLANVLFTRELAKRLQGTGVTTYAVHPGIVQSELVRH 873
            GKIRFHDLQG+K+YN GFAYCHSKLANVLFTRELAKRL+GTGVTTYAVHPGIV+S+LVRH
Sbjct: 181  GKIRFHDLQGDKYYNLGFAYCHSKLANVLFTRELAKRLKGTGVTTYAVHPGIVRSKLVRH 240

Query: 874  SFLLCLLWRLFSRFLKTAREGAQTSLHCALAEGLEPLSGKYFSDCKRAWVSPRARNNKTA 1053
            SFLLCLLWRLFS FLKT  EGAQTSLHCALAEGLEPLSGKYFSDCK+ WVSPRARNNKTA
Sbjct: 241  SFLLCLLWRLFSPFLKTTWEGAQTSLHCALAEGLEPLSGKYFSDCKKTWVSPRARNNKTA 300

Query: 1054 ERLWNVSCELLGIQWE 1101
            ERLWNVSCELLGI+WE
Sbjct: 301  ERLWNVSCELLGIRWE 316


>ref|XP_870721.1| PREDICTED: similar to Retinol dehydrogenase 11 (Retinal reductase 1)
            (RalR1) (Prostate short-chain dehydrogenase/reductase 1)
            (Androgen-regulated short-chain dehydrogenase/reductase
            1) (HCV core-binding protein HCBP12) isoform 2 [Bos
            taurus]
          Length = 314

 Score =  338 bits (867), Expect = 8e-93
 Identities = 167/287 (58%), Positives = 212/287 (73%)
 Frame = +1

Query: 232  AGGVCRTNMQLPGKVVVITGANTGIGKETARELARRGARVYIACRDVLKGESAASEIRAD 411
            + GVC + +QLPGKV V+TGAN GIGKETA+ELARRGARVY+ACRDV  GE  A EI+  
Sbjct: 3    SSGVCTSTIQLPGKVAVVTGANAGIGKETAKELARRGARVYLACRDVQNGELVAREIQMM 62

Query: 412  TKNSQVLVRKLDLSDTKSIRAFAEGFLTEEKQLHILINNAGVMLCPYSKTADGFETHLGV 591
            T N QVLVRKLDL+DTKSIRAFA+ FL + K +H++ ++   ++C +  ++ G ++    
Sbjct: 63   TGNQQVLVRKLDLADTKSIRAFAKRFLEDHKYIHLINSSPHFLICGFPGSSAGKDSACNT 122

Query: 592  NXXXXXXXXXXXXXXXKASAPARVVNLSSVVHHAGKIRFHDLQGEKHYNRGFAYCHSKLA 771
                            + SAP+RVVN+SS+ H  G+I FH+LQGEK Y  G AYCHSKLA
Sbjct: 123  GYLGHFLLTHLLLEKLEESAPSRVVNVSSLAHLLGRIHFHNLQGEKFYQSGLAYCHSKLA 182

Query: 772  NVLFTRELAKRLQGTGVTTYAVHPGIVQSELVRHSFLLCLLWRLFSRFLKTAREGAQTSL 951
            N+LFT+ELA+RL+G+GVT Y+VHPG V SELVRHS L+  +W +FS F+KT ++GAQTSL
Sbjct: 183  NILFTQELARRLKGSGVTVYSVHPGTVNSELVRHSALMRWIWWIFSFFIKTPQQGAQTSL 242

Query: 952  HCALAEGLEPLSGKYFSDCKRAWVSPRARNNKTAERLWNVSCELLGI 1092
            +CAL EGLE LSG +FSDC  AWVS +ARN   A RLW+VSC+LLGI
Sbjct: 243  YCALTEGLEVLSGNHFSDCHVAWVSAQARNETVARRLWDVSCDLLGI 289


>ref|XP_582373.2| PREDICTED: similar to Retinol dehydrogenase 11 (Retinal reductase 1)
            (RalR1) (Prostate short-chain dehydrogenase/reductase 1)
            (Androgen-regulated short-chain dehydrogenase/reductase
            1) (HCV core-binding protein HCBP12) isoform 1 [Bos
            taurus]
          Length = 308

 Score =  332 bits (850), Expect = 7e-91
 Identities = 170/287 (59%), Positives = 210/287 (73%)
 Frame = +1

Query: 232  AGGVCRTNMQLPGKVVVITGANTGIGKETARELARRGARVYIACRDVLKGESAASEIRAD 411
            + GVC + +QLPGKV V+TGAN GIGKETA+ELARRGARVY+ACRDV  GE  A EI+  
Sbjct: 3    SSGVCTSTIQLPGKVAVVTGANAGIGKETAKELARRGARVYLACRDVQNGELVAREIQMM 62

Query: 412  TKNSQVLVRKLDLSDTKSIRAFAEGFLTEEKQLHILINNAGVMLCPYSKTADGFETHLGV 591
            T N QVLVRKLDL+DTKSIRAFA+ FL + K +H LIN+ G     +  ++ G ++    
Sbjct: 63   TGNQQVLVRKLDLADTKSIRAFAKRFLEDHKYIH-LINSVG-----FPGSSAGKDSACNT 116

Query: 592  NXXXXXXXXXXXXXXXKASAPARVVNLSSVVHHAGKIRFHDLQGEKHYNRGFAYCHSKLA 771
                            + SAP+RVVN+SS+ H  G+I FH+LQGEK Y  G AYCHSKLA
Sbjct: 117  GYLGHFLLTHLLLEKLEESAPSRVVNVSSLAHLLGRIHFHNLQGEKFYQSGLAYCHSKLA 176

Query: 772  NVLFTRELAKRLQGTGVTTYAVHPGIVQSELVRHSFLLCLLWRLFSRFLKTAREGAQTSL 951
            N+LFT+ELA+RL+G+GVT Y+VHPG V SELVRHS L+  +W +FS F+KT ++GAQTSL
Sbjct: 177  NILFTQELARRLKGSGVTVYSVHPGTVNSELVRHSALMRWIWWIFSFFIKTPQQGAQTSL 236

Query: 952  HCALAEGLEPLSGKYFSDCKRAWVSPRARNNKTAERLWNVSCELLGI 1092
            +CAL EGLE LSG +FSDC  AWVS +ARN   A RLW+VSC+LLGI
Sbjct: 237  YCALTEGLEVLSGNHFSDCHVAWVSAQARNETVARRLWDVSCDLLGI 283


>ref|XP_582319.2| PREDICTED: similar to retinol dehydrogenase 14 (all-trans and 9-cis)
            [Bos taurus]
          Length = 420

 Score =  248 bits (632), Expect = 1e-65
 Identities = 147/357 (41%), Positives = 207/357 (57%), Gaps = 22/357 (6%)
 Frame = +1

Query: 88   RRSPSGVEVPFAEAAASKAVETMLAVLGLLTSFLFFLYVTAPSIRKFFAGGVCRTNMQ-- 261
            R+S +G   P A  A   AV T  A+L  L   L+       + R+F    V R +    
Sbjct: 70   RKSRAGAGGPSAPVAM--AVGTAAALLAALGGILWL------AARRFVGSSVQRLHQGRD 121

Query: 262  ---LPGKVVVITGANTGIGKETARELARRGARVYIACRDVLKGESAASEIRADT------ 414
               + GK V+ITGAN+G+G+ TA EL R GARV + CRD  + E AA ++R +       
Sbjct: 122  SGLMRGKTVLITGANSGLGRATAAELLRLGARVIMGCRDRERAEEAAGQLRREVCPAGGP 181

Query: 415  ---KNS----QVLVRKLDLSDTKSIRAFAEGFLTEEKQLHILINNAGVMLCPYSKTADGF 573
                NS    +++V++LDL+   S+R+F +  L EE +L +LINNAGV  CPY KT DGF
Sbjct: 182  DSGPNSGGAGELVVKELDLASLSSVRSFCQEMLQEEPRLDVLINNAGVFQCPYMKTEDGF 241

Query: 574  ETHLGVNXXXXXXXXXXXXXXXKASAPARVVNLSSVVHHAGKIRFHDLQGEKHYNRGFAY 753
            E   GVN               K+SAP+R+V +SS ++  G I F DL  E+ YN+ F Y
Sbjct: 242  EMQFGVNHLGHFLLTNLLLGLLKSSAPSRIVVVSSKLYKYGDINFEDLNSEQSYNKSFCY 301

Query: 754  CHSKLANVLFTRELAKRLQGTGVTTYAVHPGIVQSELVRHSFLLCLLWRLFS----RFLK 921
              SKLAN+LFTRELA+RL+GT VT   +HPGIV++ L RH  +  L+  LF+     F K
Sbjct: 302  SRSKLANILFTRELARRLEGTSVTVNVLHPGIVRTNLGRHIHIPLLVRPLFNLVSWAFFK 361

Query: 922  TAREGAQTSLHCALAEGLEPLSGKYFSDCKRAWVSPRARNNKTAERLWNVSCELLGI 1092
            T  EGAQT+++ A +  +E +SG+YF DCK   + P+A +   A +LW++S  ++GI
Sbjct: 362  TPEEGAQTAVYLASSPEVEGVSGRYFGDCKEEELLPKAMDESVARKLWDISEVMVGI 418


>ref|XP_592820.2| PREDICTED: similar to retinol dehydrogenase 11 (predicted) [Bos
            taurus]
          Length = 377

 Score =  235 bits (600), Expect = 7e-62
 Identities = 148/326 (45%), Positives = 195/326 (59%), Gaps = 10/326 (3%)
 Frame = +1

Query: 145  VETMLAVLGLLTSFLFFLY---VTAPSIRKFFAGGVCRTNMQLPGKVVVITGANTGIGKE 315
            +E +L  +GLL      +Y   V AP          CR    L G+  V+TGAN+GIGK 
Sbjct: 1    MEALLLGVGLLLGAYVLVYYNLVKAPP---------CRGLASLRGRTAVVTGANSGIGKM 51

Query: 316  TARELARRGARVYIACRDVLKGESAASEIRADTKNSQVLVRKLDLSDTKSIRAFAEGFLT 495
            TA ELARRGARV +ACR   +GE+AA ++R ++ N++V+   LDL+   S+RAFA  FL+
Sbjct: 52   TALELARRGARVVLACRSRERGEAAAFDLRQESGNNEVIFMALDLASLASVRAFATAFLS 111

Query: 496  EEKQLHILINNAGVMLCPYSKTADGFETHLGVNXXXXXXXXXXXXXXXKASAPARVVNLS 675
             E +L ILI+NAG+  C   +T + F   L VN               K SAP+RVV +S
Sbjct: 112  SEPRLDILIHNAGISSC--GRTREPFNLLLRVNHIGPFLLTHLLLPRLKTSAPSRVVVVS 169

Query: 676  SVVHHAGKIRF----HDLQGEKHYNRGFAYCHSKLANVLFTRELAKRLQGTGVTTYAVHP 843
            S  H  G++ F    H + G +   R  AY +SKLANVLF RELA +L+GTGVT YA HP
Sbjct: 170  SAAHRRGRLDFTRLDHPVVGWQQELR--AYANSKLANVLFARELATQLEGTGVTCYAAHP 227

Query: 844  GIVQSEL-VRH--SFLLCLLWRLFSRFLKTAREGAQTSLHCALAEGLEPLSGKYFSDCKR 1014
            G V SEL +RH   +L  LL  L    L+  R GAQT L+CAL EG+EPLSG+YF++C  
Sbjct: 228  GPVNSELFLRHVPGWLRPLLRPLAWLVLRAPRGGAQTPLYCALQEGIEPLSGRYFANCHV 287

Query: 1015 AWVSPRARNNKTAERLWNVSCELLGI 1092
              V P AR+++ A RLW  S +L G+
Sbjct: 288  EEVPPAARDDRAAHRLWEASRKLAGL 313


>ref|XP_584642.2| PREDICTED: similar to retinol dehydrogenase 11 (predicted) [Bos
            taurus]
          Length = 330

 Score =  175 bits (443), Expect = 1e-43
 Identities = 110/295 (37%), Positives = 168/295 (56%), Gaps = 5/295 (1%)
 Frame = +1

Query: 223  KFFAGGVCRTNMQLPGKVVVITGANTGIGKETARELARRGARVYIACRDVLKGESAASEI 402
            KF+   +   +  L GK  V+TGAN+GIGK  ++ELA RGARV +ACR   +G+ A +EI
Sbjct: 34   KFYLWDLQHCSTDLTGKTAVVTGANSGIGKAVSQELAHRGARVILACRSRERGQQALAEI 93

Query: 403  RADTKNSQVLVRKLDLSDTKSIRAFAEGFLTEEKQLHILINNAGVMLCPYSKTADGFETH 582
            +A +K++++L+ ++DLS   SIR+FA+  L E  ++H+L+NNA V   P + T +G +  
Sbjct: 94   QATSKSNRLLLGEVDLSSMASIRSFAQRLLQECPEIHLLVNNAAVCGFPTTLTPEGLDLT 153

Query: 583  LGVNXXXXXXXXXXXXXXXKASAPARVVNLSSVVHHAGKIRFHDLQGEKH---YNRGFAY 753
               N               + +  ARVVN+SS     G I    L G      +N+   Y
Sbjct: 154  FATNYTGPFLLTNLLQGALQRAGSARVVNVSSFRQSHGYIDEDHLIGAGRPLTFNQN--Y 211

Query: 754  CHSKLANVLFTRELAKRLQGTGVTTYAVHPGIVQSELVRH-SFLLCLLWRLFSRFLKTAR 930
              SKL    FT +LA+RLQGTGVT  +V PG+V +++++H S+    L+ L S F K ++
Sbjct: 212  DCSKLLLASFTGKLAQRLQGTGVTVNSVDPGVVYTKIMKHFSWSYRFLFWLLSFFFKDSK 271

Query: 931  EGAQTSLHCALAEGLEPLSGKYF-SDCKRAWVSPRARNNKTAERLWNVSCELLGI 1092
            +GA   L+ +LA+ L+ +SGK+F S C        A++   A+ LWN S  L  +
Sbjct: 272  QGAVPVLYLSLAKELDGISGKHFSSSCVITLPPEAAQDPHVAQSLWNTSVRLTNL 326


>ref|XP_584629.2| PREDICTED: similar to Retinol dehydrogenase 13, partial [Bos
           taurus]
          Length = 148

 Score =  144 bits (364), Expect = 2e-34
 Identities = 71/126 (56%), Positives = 89/126 (70%)
 Frame = +1

Query: 217 IRKFFAGGVCRTNMQLPGKVVVITGANTGIGKETARELARRGARVYIACRDVLKGESAAS 396
           ++ F AGG C +   +PGK V++TGANTGIGK+TA ELA+RG  + +ACRD+ K E+AA 
Sbjct: 21  LKDFVAGGACPSKATIPGKTVIVTGANTGIGKQTALELAKRGGNIILACRDMEKCEAAAK 80

Query: 397 EIRADTKNSQVLVRKLDLSDTKSIRAFAEGFLTEEKQLHILINNAGVMLCPYSKTADGFE 576
           EIR +T N +V  R LDL+  KSIR FA     EE+ +HILINNA VM CP+  T DGFE
Sbjct: 81  EIRGETLNHRVNARHLDLASLKSIREFAAKVTEEEEHVHILINNAAVMRCPHWTTEDGFE 140

Query: 577 THLGVN 594
             LGVN
Sbjct: 141 MQLGVN 146


>ref|XP_591168.2| PREDICTED: similar to dehydrogenase/reductase (SDR family) X-linked
            [Bos taurus]
          Length = 251

 Score =  132 bits (332), Expect = 9e-31
 Identities = 90/235 (38%), Positives = 119/235 (50%), Gaps = 16/235 (6%)
 Frame = +1

Query: 445  DLSDTKSIRAFAEGFLTEEKQLHILINNAGVMLCPYSKTADGFETHLGVNXXXXXXXXXX 624
            DL+  +SIR F + F  ++  LH+L+NNAGVM+ P   T DGFE H GVN          
Sbjct: 11   DLASMRSIREFVQTFKMKKLPLHVLVNNAGVMMVPQRTTEDGFEEHFGVNYLGHFLLTNL 70

Query: 625  XXXXXKAS-AP---ARVVNLSSVVHHAGKIRFHDLQGEKHYNRGFAYCHSKLANVLFTRE 792
                 + S AP   ARVV +SS  H+ G++   DLQ   +Y+   AY  SKLA VLFT  
Sbjct: 71   LLDTLQESGAPGHSARVVTVSSATHYVGELNLDDLQSSTYYSAHAAYAQSKLALVLFTYH 130

Query: 793  LAKRL--QGTGVTTYAVHPGIVQSELVRHSFLLCLLW--RLFSRFL-----KTAREGAQT 945
            L   L  QG  VT     PG+V ++L R+ F     W  RL  + L     KT  EGA T
Sbjct: 131  LQALLTAQGMPVTASVADPGVVDTDLYRYVF-----WGTRLVKKLLGWWVFKTPDEGAWT 185

Query: 946  SLHCALAEGLEPLSGKYFSDCKRAWVSPRARNNKTAERLWNVSCELLGI---QWE 1101
            S++ A+   LE L G+Y  + K         + +   +LW  SC+L GI    WE
Sbjct: 186  SVYAAVTPALEGLGGRYLYNEKETRSLEATYDPELQRQLWARSCQLTGIADVTWE 240


>ref|XP_584810.2| PREDICTED: similar to retinol dehydrogenase 13 (all-trans and 9-cis)
            [Bos taurus]
          Length = 223

 Score =  129 bits (325), Expect = 6e-30
 Identities = 73/159 (45%), Positives = 102/159 (64%), Gaps = 7/159 (4%)
 Frame = +1

Query: 640  KASAPARVVNLSSVVHHAGKIRFHDLQGEKH-YNRGFAYCHSKLANVLFTRELAKRLQGT 816
            KASAP+R++N+SS+ H AG I F DL  EK  Y+   AYC SKLA V+ T+EL++RLQGT
Sbjct: 50   KASAPSRIINVSSLAHVAGHIDFEDLNWEKRKYDTKAAYCQSKLAVVVSTKELSRRLQGT 109

Query: 817  GVTTYAVHPGIVQSELVRH------SFLLCLLWRLFSRFLKTAREGAQTSLHCALAEGLE 978
            GVT  A+HPG+ ++EL RH      +F    L  +F   +K+    AQ S++ A+AE LE
Sbjct: 110  GVTVNALHPGVARTELGRHTGMHSSAFSSFTLGPIFWLLVKSPELAAQPSVYLAVAEELE 169

Query: 979  PLSGKYFSDCKRAWVSPRARNNKTAERLWNVSCELLGIQ 1095
             +SGKYF   K    +P A + + A+RLW  S  L+G++
Sbjct: 170  GVSGKYFDVLKEKPPAPEAEDEEVAKRLWAESVRLVGLE 208


>ref|XP_583859.2| PREDICTED: similar to short chain dehydrogenase/reductase [Bos
            taurus]
          Length = 317

 Score =  112 bits (279), Expect = 1e-24
 Identities = 85/257 (33%), Positives = 128/257 (49%), Gaps = 3/257 (1%)
 Frame = +1

Query: 256  MQLPGKVVVITGANTGIGKETARELARRGARVYIACRDVLKGESAASEIRADTKNSQVLV 435
            +Q+PG+  ++TG N+GIGK TA E+A+RG  V++ CRD  + E A +EI  ++ N  + +
Sbjct: 36   VQVPGRAFMVTGGNSGIGKATAMEIAKRGGTVHLVCRDHSRAEGAKAEIIRESGNQNIFL 95

Query: 436  RKLDLSDTKSIRAFAEGFLTEEKQLHILINNAGVMLCPYSKTADGFETHLGVNXXXXXXX 615
              +DLS  KS+  F E F  +E  L++LINNAG M+     T DG E +   N       
Sbjct: 96   HIVDLSLPKSVWKFVENF-KQEHTLNVLINNAGCMVNKRELTEDGLEKNFATNTLGVYVL 154

Query: 616  XXXXXXXXKASAPARVVNLSSVVHHAGKIRFHDLQGEK-HYNRGFAYCHSKLANVLFTRE 792
                    +     RV+ +SS      K+   D Q E+  ++    Y  +K   V+ T  
Sbjct: 155  TTALIPVLEKEHDPRVITVSSGGMLVQKLNTDDPQSERTAFDGTMVYAQNKRQQVVLTER 214

Query: 793  LAKRLQGTGVTTYAVHPGIVQSELVRHSFLLCLLWRLFSRFLKTAREGAQTSLHCALAEG 972
             A+      +    +HPG V +  VR S +     RL +R L++  +GA T L  ALA  
Sbjct: 215  WAR--AHPAIHFSCMHPGWVDTPGVRLS-MPGFHARLGAR-LRSEAQGADTVLWLALAPA 270

Query: 973  --LEPLSGKYFSDCKRA 1017
               +P SG +F D K A
Sbjct: 271  ATAQP-SGCFFQDRKPA 286


  Database: RefSeqBP
    Posted date:  Aug 1, 2006  7:14 PM
  Number of letters in database: 16,112,626
  Number of sequences in database:  33,508
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 64,710,554
Number of Sequences: 33508
Number of extensions: 1857951
Number of successful extensions: 7329
Number of sequences better than 1.0e-05: 10
Number of HSP's better than  0.0 without gapping: 5748
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7283
length of database: 16,112,626
effective HSP length: 107
effective length of database: 12,527,270
effective search space used: 5900344170
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqSP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611C-000325
         (1737 letters)

Database: RefSeqSP 
           1040 sequences; 434,620 total letters

Searching...done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_999238.1| 20-beta-hydroxysteroid dehydrogenase [Sus scrofa]     57   1e-09

>ref|NP_999238.1| 20-beta-hydroxysteroid dehydrogenase [Sus scrofa]
          Length = 289

 Score = 57.4 bits (137), Expect = 1e-09
 Identities = 40/137 (29%), Positives = 66/137 (48%), Gaps = 1/137 (0%)
 Frame = +1

Query: 271 KVVVITGANTGIGKETARELARRGAR-VYIACRDVLKGESAASEIRADTKNSQVLVRKLD 447
           +V ++TGAN GIG    R+L R+ A  V +  RDV +G++A  +++A+  + +    +LD
Sbjct: 6   RVALVTGANKGIGFAIVRDLCRQFAGDVVLTARDVARGQAAVKQLQAEGLSPRF--HQLD 63

Query: 448 LSDTKSIRAFAEGFLTEEKQLHILINNAGVMLCPYSKTADGFETHLGVNXXXXXXXXXXX 627
           + D +SIRA  +    E   L +L+NNA +     + T    +  L +            
Sbjct: 64  IIDLQSIRALCDFLRKEYGGLDVLVNNAAIAFQLDNPTPFHIQAELTMKTNFMGTRNVCT 123

Query: 628 XXXXKASAPARVVNLSS 678
                     RVVN+SS
Sbjct: 124 ELLPLIKPQGRVVNVSS 140


  Database: RefSeqSP
    Posted date:  Aug 1, 2006  7:14 PM
  Number of letters in database: 434,620
  Number of sequences in database:  1040
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,719,245
Number of Sequences: 1040
Number of extensions: 48188
Number of successful extensions: 172
Number of sequences better than 1.0e-05: 1
Number of HSP's better than  0.0 without gapping: 148
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 171
length of database: 434,620
effective HSP length: 82
effective length of database: 349,340
effective search space used: 173272640
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqHP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611C-000325
         (1737 letters)

Database: RefSeqHP 
           39,411 sequences; 17,774,539 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_689656.1| retinol dehydrogenase 12 (all-trans and 9-cis) ...   551   e-157
Alignment   gi|NP_057110.2| androgen-regulated short-chain dehydrogenase/re...   430   e-120
Alignment   gi|NP_065956.1| retinol dehydrogenase 14 (all-trans and 9-cis) ...   249   7e-66
Alignment   gi|NP_653284.1| hypothetical protein LOC147015 [Homo sapiens]        202   7e-52
Alignment   gi|NP_612421.1| retinol dehydrogenase 13 (all-trans and 9-cis) ...   199   6e-51
Alignment   gi|NP_057457.1| WW domain-containing oxidoreductase isoform 1 [...   184   2e-46
Alignment   gi|NP_660160.1| dehydrogenase/reductase (SDR family) X-linked [...   174   2e-43
Alignment   gi|XP_371503.3| PREDICTED: similar to short-chain dehydrogenase...    89   9e-18
Alignment   gi|XP_947127.1| PREDICTED: similar to short-chain dehydrogenase...    89   9e-18
Alignment   gi|NP_078981.1| hypothetical protein FLJ13639 isoform 2 [Homo s...    67   6e-11

>ref|NP_689656.1| retinol dehydrogenase 12 (all-trans and 9-cis) [Homo sapiens]
          Length = 316

 Score =  551 bits (1419), Expect = e-157
 Identities = 275/316 (87%), Positives = 284/316 (89%)
 Frame = +1

Query: 154  MLAVLGLLTSFLFFLYVTAPSIRKFFAGGVCRTNMQLPGKVVVITGANTGIGKETARELA 333
            ML  LGLLTSF  FLY+ APSIRKFFAGGVCRTN+QLPGKVVVITGANTGIGKETARELA
Sbjct: 1    MLVTLGLLTSFFSFLYMVAPSIRKFFAGGVCRTNVQLPGKVVVITGANTGIGKETARELA 60

Query: 334  RRGARVYIACRDVLKGESAASEIRADTKNSQVLVRKLDLSDTKSIRAFAEGFLTEEKQLH 513
             RGARVYIACRDVLKGESAASEIR DTKNSQVLVRKLDLSDTKSIRAFAEGFL EEKQLH
Sbjct: 61   SRGARVYIACRDVLKGESAASEIRVDTKNSQVLVRKLDLSDTKSIRAFAEGFLAEEKQLH 120

Query: 514  ILINNAGVMLCPYSKTADGFETHLGVNXXXXXXXXXXXXXXXKASAPARVVNLSSVVHHA 693
            ILINNAGVM+CPYSKTADGFETHLGVN               K SAPARVVN+SSV HH 
Sbjct: 121  ILINNAGVMMCPYSKTADGFETHLGVNHLGHFLLTYLLLEQLKVSAPARVVNVSSVAHHI 180

Query: 694  GKIRFHDLQGEKHYNRGFAYCHSKLANVLFTRELAKRLQGTGVTTYAVHPGIVQSELVRH 873
            GKI FHDLQ EK Y+RGFAYCHSKLANVLFTRELAKRLQGTGVTTYAVHPG+V+SELVRH
Sbjct: 181  GKIPFHDLQSEKRYSRGFAYCHSKLANVLFTRELAKRLQGTGVTTYAVHPGVVRSELVRH 240

Query: 874  SFLLCLLWRLFSRFLKTAREGAQTSLHCALAEGLEPLSGKYFSDCKRAWVSPRARNNKTA 1053
            S LLCLLWRLFS F+KTAREGAQTSLHCALAEGLEPLSGKYFSDCKR WVSPRARNNKTA
Sbjct: 241  SSLLCLLWRLFSPFVKTAREGAQTSLHCALAEGLEPLSGKYFSDCKRTWVSPRARNNKTA 300

Query: 1054 ERLWNVSCELLGIQWE 1101
            ERLWNVSCELLGI+WE
Sbjct: 301  ERLWNVSCELLGIRWE 316


>ref|NP_057110.2| androgen-regulated short-chain dehydrogenase/reductase 1 [Homo
            sapiens]
          Length = 318

 Score =  430 bits (1105), Expect = e-120
 Identities = 214/316 (67%), Positives = 250/316 (79%)
 Frame = +1

Query: 145  VETMLAVLGLLTSFLFFLYVTAPSIRKFFAGGVCRTNMQLPGKVVVITGANTGIGKETAR 324
            VE M  +L LL  FL  LY+ AP IRK  + GVC + +QLPGKVVV+TGANTGIGKETA+
Sbjct: 2    VELMFPLLLLLLPFL--LYMAAPQIRKMLSSGVCTSTVQLPGKVVVVTGANTGIGKETAK 59

Query: 325  ELARRGARVYIACRDVLKGESAASEIRADTKNSQVLVRKLDLSDTKSIRAFAEGFLTEEK 504
            ELA+RGARVY+ACRDV KGE  A EI+  T N QVLVRKLDLSDTKSIRAFA+GFL EEK
Sbjct: 60   ELAQRGARVYLACRDVEKGELVAKEIQTTTGNQQVLVRKLDLSDTKSIRAFAKGFLAEEK 119

Query: 505  QLHILINNAGVMLCPYSKTADGFETHLGVNXXXXXXXXXXXXXXXKASAPARVVNLSSVV 684
             LH+LINNAGVM+CPYSKTADGFE H+GVN               K SAP+R+VN+SS+ 
Sbjct: 120  HLHVLINNAGVMMCPYSKTADGFEMHIGVNHLGHFLLTHLLLEKLKESAPSRIVNVSSLA 179

Query: 685  HHAGKIRFHDLQGEKHYNRGFAYCHSKLANVLFTRELAKRLQGTGVTTYAVHPGIVQSEL 864
            HH G+I FH+LQGEK YN G AYCHSKLAN+LFT+ELA+RL+G+GVTTY+VHPG VQSEL
Sbjct: 180  HHLGRIHFHNLQGEKFYNAGLAYCHSKLANILFTQELARRLKGSGVTTYSVHPGTVQSEL 239

Query: 865  VRHSFLLCLLWRLFSRFLKTAREGAQTSLHCALAEGLEPLSGKYFSDCKRAWVSPRARNN 1044
            VRHS  +  +W LFS F+KT ++GAQTSLHCAL EGLE LSG +FSDC  AWVS +ARN 
Sbjct: 240  VRHSSFMRWMWWLFSFFIKTPQQGAQTSLHCALTEGLEILSGNHFSDCHVAWVSVQARNE 299

Query: 1045 KTAERLWNVSCELLGI 1092
              A RLW+VSC+LLG+
Sbjct: 300  TIARRLWDVSCDLLGL 315


>ref|NP_065956.1| retinol dehydrogenase 14 (all-trans and 9-cis) [Homo sapiens]
          Length = 336

 Score =  249 bits (635), Expect = 7e-66
 Identities = 140/336 (41%), Positives = 199/336 (59%), Gaps = 19/336 (5%)
 Frame = +1

Query: 142  AVETMLAVLGLLTSFLFFLY--VTAPSIRKFFAGGVCRTNMQLPGKVVVITGANTGIGKE 315
            AV T  AVL  L   L+        P +++   GG       + GK V+ITGAN+G+G+ 
Sbjct: 2    AVATAAAVLAALGGALWLAARRFVGPRVQRLRRGG---DPGLMHGKTVLITGANSGLGRA 58

Query: 316  TARELARRGARVYIACRDVLKGESAASEIRADTKNS-------------QVLVRKLDLSD 456
            TA EL R GARV + CRD  + E AA ++R + + +             +++VR+LDL+ 
Sbjct: 59   TAAELLRLGARVIMGCRDRARAEEAAGQLRRELRQAAECGPEPGVSGVGELIVRELDLAS 118

Query: 457  TKSIRAFAEGFLTEEKQLHILINNAGVMLCPYSKTADGFETHLGVNXXXXXXXXXXXXXX 636
             +S+RAF +  L EE +L +LINNAG+  CPY KT DGFE   GVN              
Sbjct: 119  LRSVRAFCQEMLQEEPRLDVLINNAGIFQCPYMKTEDGFEMQFGVNHLGHFLLTNLLLGL 178

Query: 637  XKASAPARVVNLSSVVHHAGKIRFHDLQGEKHYNRGFAYCHSKLANVLFTRELAKRLQGT 816
             K+SAP+R+V +SS ++  G I F DL  E+ YN+ F Y  SKLAN+LFTRELA+RL+GT
Sbjct: 179  LKSSAPSRIVVVSSKLYKYGDINFDDLNSEQSYNKSFCYSRSKLANILFTRELARRLEGT 238

Query: 817  GVTTYAVHPGIVQSELVRHSFLLCLLWRLFS----RFLKTAREGAQTSLHCALAEGLEPL 984
             VT   +HPGIV++ L RH  +  L+  LF+     F KT  EGAQTS++ A +  +E +
Sbjct: 239  NVTVNVLHPGIVRTNLGRHIHIPLLVKPLFNLVSWAFFKTPVEGAQTSIYLASSPEVEGV 298

Query: 985  SGKYFSDCKRAWVSPRARNNKTAERLWNVSCELLGI 1092
            SG+YF DCK   + P+A +   A +LW++S  ++G+
Sbjct: 299  SGRYFGDCKEEELLPKAMDESVARKLWDISEVMVGL 334


>ref|NP_653284.1| hypothetical protein LOC147015 [Homo sapiens]
          Length = 327

 Score =  202 bits (514), Expect = 7e-52
 Identities = 128/293 (43%), Positives = 170/293 (58%), Gaps = 7/293 (2%)
 Frame = +1

Query: 316  TARELARRGARVYIACRDVLKGESAASEIRADTKNSQVLVRKLDLSDTKSIRAFAEGFLT 495
            TA ELARRGARV +ACR   +GE+AA ++R ++ N++V+   LDL+   S+RAFA  FL+
Sbjct: 2    TALELARRGARVVLACRSQERGEAAAFDLRQESGNNEVIFMALDLASLASVRAFATAFLS 61

Query: 496  EEKQLHILINNAGVMLCPYSKTADGFETHLGVNXXXXXXXXXXXXXXXKASAPARVVNLS 675
             E +L ILI+NAG+  C   +T + F   L VN               KA AP+RVV ++
Sbjct: 62   SEPRLDILIHNAGISSC--GRTREAFNLLLRVNHIGPFLLTHLLLPCLKACAPSRVVVVA 119

Query: 676  SVVHHAGKIRFHDLQ----GEKHYNRGFAYCHSKLANVLFTRELAKRLQGTGVTTYAVHP 843
            S  H  G++ F  L     G +   R  AY  +KLANVLF RELA +L+ TGVT YA HP
Sbjct: 120  SAAHCRGRLDFKRLDRPVVGWRQELR--AYADTKLANVLFARELANQLEATGVTCYAAHP 177

Query: 844  GIVQSEL-VRH--SFLLCLLWRLFSRFLKTAREGAQTSLHCALAEGLEPLSGKYFSDCKR 1014
            G V SEL +RH   +L  LL  L    L+  R GAQT L+CAL EG+EPLSG+YF++C  
Sbjct: 178  GPVNSELFLRHVPGWLRPLLRPLAWLVLRAPRGGAQTPLYCALQEGIEPLSGRYFANCHV 237

Query: 1015 AWVSPRARNNKTAERLWNVSCELLGIQWE*SCWKMRGCIKPGPGHNADRGDGP 1173
              V P AR+++ A RLW  S  L G+               GPG +A+  + P
Sbjct: 238  EEVPPAARDDRAAHRLWEASKRLAGL---------------GPGEDAEPDEDP 275


>ref|NP_612421.1| retinol dehydrogenase 13 (all-trans and 9-cis) [Homo sapiens]
          Length = 260

 Score =  199 bits (506), Expect = 6e-51
 Identities = 113/247 (45%), Positives = 150/247 (60%), Gaps = 7/247 (2%)
 Frame = +1

Query: 376  KGESAASEIRADTKNSQVLVRKLDLSDTKSIRAFAEGFLTEEKQLHILINNAGVMLCPYS 555
            K E+AA +IR +T N  V  R LDL+  KSIR FA   + EE+++ ILINNAGVM CP+ 
Sbjct: 3    KCEAAAKDIRGETLNHHVNARHLDLASLKSIREFAAKIIEEEERVDILINNAGVMRCPHW 62

Query: 556  KTADGFETHLGVNXXXXXXXXXXXXXXXKASAPARVVNLSSVVHHAGKIRFHDLQGE-KH 732
             T DGFE   GVN               KASAP+R++NLSS+ H AG I F DL  + + 
Sbjct: 63   TTEDGFEMQFGVNHLGHFLLTNLLLDKLKASAPSRIINLSSLAHVAGHIDFDDLNWQTRK 122

Query: 733  YNRGFAYCHSKLANVLFTRELAKRLQGTGVTTYAVHPGIVQSELVRH------SFLLCLL 894
            YN   AYC SKLA VLFT+EL++RLQG+GVT  A+HPG+ ++EL RH      +F    L
Sbjct: 123  YNTKAAYCQSKLAIVLFTKELSRRLQGSGVTVNALHPGVARTELGRHTGIHGSTFSSTTL 182

Query: 895  WRLFSRFLKTAREGAQTSLHCALAEGLEPLSGKYFSDCKRAWVSPRARNNKTAERLWNVS 1074
              +F   +K+    AQ S + A+AE L  +SGKYF   K+   +P A + + A RLW  S
Sbjct: 183  GPIFWLLVKSPELAAQPSTYLAVAEELADVSGKYFDGLKQKAPAPEAEDEEVARRLWAES 242

Query: 1075 CELLGIQ 1095
              L+G++
Sbjct: 243  ARLVGLE 249


>ref|NP_057457.1| WW domain-containing oxidoreductase isoform 1 [Homo sapiens]
          Length = 414

 Score =  184 bits (467), Expect = 2e-46
 Identities = 116/307 (37%), Positives = 165/307 (53%), Gaps = 13/307 (4%)
 Frame = +1

Query: 205  TAPSIRKFFAGGVCRTNM----QLPGKVVVITGANTGIGKETARELARRGARVYIACRDV 372
            T P+ R+ + G      +       GKVVV+TGAN+GIG ETA+  A  GA V +ACR++
Sbjct: 99   TKPTTRQRYDGSTTAMEILQGRDFTGKVVVVTGANSGIGFETAKSFALHGAHVILACRNM 158

Query: 373  LKGESAASEIRADTKNSQVLVRKLDLSDTKSIRAFAEGFLTEEKQLHILINNAGVMLCPY 552
             +   A S I  +   ++V    LDL+  +S++ FAE F  +   LH+L+ NA     P+
Sbjct: 159  ARASEAVSRILEEWHKAKVEAMTLDLALLRSVQHFAEAFKAKNVPLHVLVCNAATFALPW 218

Query: 553  SKTADGFETHLGVNXXXXXXXXXXXXXXXKASAPARVVNLSSVVHH-------AGKIRFH 711
            S T DG ET   VN                 SAPARV+ +SS  H         GK+ F 
Sbjct: 219  SLTKDGLETTFQVNHLGHFYLVQLLQDVLCRSAPARVIVVSSESHRFTDINDSLGKLDFS 278

Query: 712  DLQGEKH-YNRGFAYCHSKLANVLFTRELAKRLQGTGVTTYAVHPG-IVQSELVRHSFLL 885
             L   K+ Y    AY  SKL N+LF+ EL +RL   GVT+ AVHPG ++ S + R  ++ 
Sbjct: 279  RLSPTKNDYWAMLAYNRSKLCNILFSNELHRRLSPRGVTSNAVHPGNMMYSNIHRSWWVY 338

Query: 886  CLLWRLFSRFLKTAREGAQTSLHCALAEGLEPLSGKYFSDCKRAWVSPRARNNKTAERLW 1065
             LL+ L   F K+ ++GA T+++CA    LE L G YF++C R   SP A++ +TA  LW
Sbjct: 339  TLLFTLARPFTKSMQQGAATTVYCAAVPELEGLGGMYFNNCCRCMPSPEAQSEETARTLW 398

Query: 1066 NVSCELL 1086
             +S  L+
Sbjct: 399  ALSERLI 405


>ref|NP_660160.1| dehydrogenase/reductase (SDR family) X-linked [Homo sapiens]
          Length = 330

 Score =  174 bits (442), Expect = 2e-43
 Identities = 109/288 (37%), Positives = 149/288 (51%), Gaps = 12/288 (4%)
 Frame = +1

Query: 265  PGKVVVITGANTGIGKETARELARRGARVYIACRDVLKGESAASEIRADTKNSQVLVRKL 444
            P +V ++TG   GIG  TA+ LAR G  V IA  +  K +   S+I+ +T N +V     
Sbjct: 42   PDRVAIVTGGTDGIGYSTAKHLARLGMHVIIAGNNDSKAKQVVSKIKEETLNDKVEFLYC 101

Query: 445  DLSDTKSIRAFAEGFLTEEKQLHILINNAGVMLCPYSKTADGFETHLGVNXXXXXXXXXX 624
            DL+   SIR F + F  ++  LH+LINNAGVM+ P  KT DGFE H G+N          
Sbjct: 102  DLASMTSIRQFVQKFKMKKIPLHVLINNAGVMMVPQRKTRDGFEEHFGLNYLGHFLLTNL 161

Query: 625  XXXXXKASA----PARVVNLSSVVHHAGKIRFHDLQGEKHYNRGFAYCHSKLANVLFTRE 792
                 K S      ARVV +SS  H+  ++   DLQ    Y+   AY  SKLA VLFT  
Sbjct: 162  LLDTLKESGSPGHSARVVTVSSATHYVAELNMDDLQSSACYSPHAAYAQSKLALVLFTYH 221

Query: 793  LAKRL--QGTGVTTYAVHPGIVQSELVRHSFLLCLL------WRLFSRFLKTAREGAQTS 948
            L + L  +G+ VT   V PG+V ++L +H F    L      W LF    KT  EGA TS
Sbjct: 222  LQRLLAAEGSHVTANVVDPGVVNTDLYKHVFWATRLAKKLLGWLLF----KTPDEGAWTS 277

Query: 949  LHCALAEGLEPLSGKYFSDCKRAWVSPRARNNKTAERLWNVSCELLGI 1092
            ++ A+   LE + G+Y  + K         N K  ++LW+ SCE+ G+
Sbjct: 278  IYAAVTPELEGVGGRYLYNEKETKSLHVTYNQKLQQQLWSKSCEMTGV 325


>ref|XP_371503.3| PREDICTED: similar to short-chain dehydrogenase/reductase 1 [Homo
           sapiens]
          Length = 891

 Score = 89.4 bits (220), Expect = 9e-18
 Identities = 44/106 (41%), Positives = 73/106 (68%), Gaps = 1/106 (0%)
 Frame = +1

Query: 262 LPGKVVVITGANTGIGKETARELARRGARVYIACRDVLKGESAASEIRADTKNSQVLVRK 441
           L GK+ ++TGAN+GIGK  +++LAR GA+V + C+    G+ A +EI+A + ++++L+ +
Sbjct: 600 LTGKIAIVTGANSGIGKVVSQDLARCGAQVILTCQSRECGQQALAEIQAASNSNRLLLGE 659

Query: 442 LDLSDTKSIRAFAEGFLTEEKQLHILINNAGVM-LCPYSKTADGFE 576
           +DLS   SIR+FA   L E  ++H+L+NNAGV  + P + T  G +
Sbjct: 660 VDLSSMTSIRSFARRLLQENPEIHLLVNNAGVSGMIPKTLTPGGLD 705


>ref|XP_947127.1| PREDICTED: similar to short-chain dehydrogenase/reductase 1 [Homo
           sapiens]
          Length = 916

 Score = 89.4 bits (220), Expect = 9e-18
 Identities = 44/106 (41%), Positives = 73/106 (68%), Gaps = 1/106 (0%)
 Frame = +1

Query: 262 LPGKVVVITGANTGIGKETARELARRGARVYIACRDVLKGESAASEIRADTKNSQVLVRK 441
           L GK+ ++TGAN+GIGK  +++LAR GA+V + C+    G+ A +EI+A + ++++L+ +
Sbjct: 625 LTGKIAIVTGANSGIGKVVSQDLARCGAQVILTCQSRECGQQALAEIQAASNSNRLLLGE 684

Query: 442 LDLSDTKSIRAFAEGFLTEEKQLHILINNAGVM-LCPYSKTADGFE 576
           +DLS   SIR+FA   L E  ++H+L+NNAGV  + P + T  G +
Sbjct: 685 VDLSSMTSIRSFARRLLQENPEIHLLVNNAGVSGMIPKTLTPGGLD 730


>ref|NP_078981.1| hypothetical protein FLJ13639 isoform 2 [Homo sapiens]
          Length = 242

 Score = 66.6 bits (161), Expect = 6e-11
 Identities = 60/207 (28%), Positives = 92/207 (44%), Gaps = 4/207 (1%)
 Frame = +1

Query: 391 ASEIRADTKNSQVLVRKLDLSDTKSIRAFAEGFLTEEKQLHILINNAGVMLCPYSKTADG 570
           A ++   + +  + +  +DLSD K I  F E F  E K LH+LINNAG M+     T DG
Sbjct: 32  AKQLPLKSPSENIFLHIVDLSDPKQIWKFVENFKQEHK-LHVLINNAGCMVNKRELTEDG 90

Query: 571 FETHLGVNXXXXXXXXXXXXXXXKASAPARVVNLSSVVHHAGKIRFHDLQGEK-HYNRGF 747
            E +   N               +     RV+ +SS      K+  +DLQ E+  ++   
Sbjct: 91  LEKNFAANTLGVYILTTGLIPVLEKEHDPRVITVSSGGMLVQKLNTNDLQSERTPFDGTM 150

Query: 748 AYCHSKLANVLFTRELAKRLQG-TGVTTYAVHPGIVQSELVRHSFLLCLLWRLFSRFLKT 924
            Y  +K   V+ T   A   QG   +   ++HPG   +  VR +  +      F   L++
Sbjct: 151 VYAQNKRQQVVLTERWA---QGHPAIHFSSMHPGWADTPGVRQA--MPGFHARFGDRLRS 205

Query: 925 AREGAQTSLHCAL--AEGLEPLSGKYF 999
             +GA T L  AL  A   +P SG++F
Sbjct: 206 EAQGADTMLWLALSSAAAAQP-SGRFF 231


  Database: RefSeqHP
    Posted date:  Aug 2, 2006 12:57 AM
  Number of letters in database: 17,774,539
  Number of sequences in database:  39,411
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 73,789,605
Number of Sequences: 39411
Number of extensions: 2198701
Number of successful extensions: 8797
Number of sequences better than 1.0e-05: 10
Number of HSP's better than  0.0 without gapping: 6770
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 8746
length of database: 17,774,539
effective HSP length: 107
effective length of database: 13,557,562
effective search space used: 6385611702
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqCP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611C-000325
         (1737 letters)

Database: RefSeqCP 
           33,732 sequences; 19,266,565 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|XP_547866.2| PREDICTED: similar to retinol dehydrogenase 12 ...   525   e-149
Alignment   gi|XP_854354.1| PREDICTED: similar to Retinol dehydrogenase 11 ...   403   e-112
Alignment   gi|XP_854127.1| PREDICTED: similar to Retinol dehydrogenase 13 ...   271   2e-72
Alignment   gi|XP_540096.2| PREDICTED: similar to retinol dehydrogenase 14 ...   248   1e-65
Alignment   gi|XP_548293.2| PREDICTED: similar to retinol dehydrogenase 11 ...   226   7e-59
Alignment   gi|XP_857582.1| PREDICTED: similar to retinol dehydrogenase 14 ...   194   2e-49
Alignment   gi|XP_533000.2| PREDICTED: similar to Retinol dehydrogenase 12 ...   182   7e-46
Alignment   gi|XP_852222.1| PREDICTED: similar to dehydrogenase/reductase (...   166   5e-41
Alignment   gi|XP_852623.1| PREDICTED: similar to WW domain-containing oxid...   144   3e-34
Alignment   gi|XP_857503.1| PREDICTED: similar to retinol dehydrogenase 14 ...    72   1e-12

>ref|XP_547866.2| PREDICTED: similar to retinol dehydrogenase 12 (all-trans and 9-cis)
            [Canis familiaris]
          Length = 303

 Score =  525 bits (1352), Expect = e-149
 Identities = 259/294 (88%), Positives = 270/294 (91%)
 Frame = +1

Query: 220  RKFFAGGVCRTNMQLPGKVVVITGANTGIGKETARELARRGARVYIACRDVLKGESAASE 399
            RKFFAGGVCR+N+QLPGKVVVITGANTGIGKETARELARRGARVYIACRDVLKGESAASE
Sbjct: 10   RKFFAGGVCRSNVQLPGKVVVITGANTGIGKETARELARRGARVYIACRDVLKGESAASE 69

Query: 400  IRADTKNSQVLVRKLDLSDTKSIRAFAEGFLTEEKQLHILINNAGVMLCPYSKTADGFET 579
            IRADTKNSQVLVRKLDLSDTKSIRAFAEGFL EEKQLHILINNAGVM+CPYSKTADGFET
Sbjct: 70   IRADTKNSQVLVRKLDLSDTKSIRAFAEGFLAEEKQLHILINNAGVMMCPYSKTADGFET 129

Query: 580  HLGVNXXXXXXXXXXXXXXXKASAPARVVNLSSVVHHAGKIRFHDLQGEKHYNRGFAYCH 759
            HLGVN               K S PARVVNLSSV HH GKI FHDLQGEK Y+RGFAYCH
Sbjct: 130  HLGVNHLGHFLLTHLLLERLKESTPARVVNLSSVAHHIGKIHFHDLQGEKRYSRGFAYCH 189

Query: 760  SKLANVLFTRELAKRLQGTGVTTYAVHPGIVQSELVRHSFLLCLLWRLFSRFLKTAREGA 939
            SKLAN+LFTRELAKRLQGTGVTTYAVHPG+V SELVRHSFLLCLLWR+FS F+K+AREGA
Sbjct: 190  SKLANMLFTRELAKRLQGTGVTTYAVHPGVVSSELVRHSFLLCLLWRIFSPFVKSAREGA 249

Query: 940  QTSLHCALAEGLEPLSGKYFSDCKRAWVSPRARNNKTAERLWNVSCELLGIQWE 1101
            QTSLHCALAEGLEPLSGKYFSDCKRAWVSPRAR+NKTAERLWNVSCELLGIQW+
Sbjct: 250  QTSLHCALAEGLEPLSGKYFSDCKRAWVSPRARDNKTAERLWNVSCELLGIQWD 303


>ref|XP_854354.1| PREDICTED: similar to Retinol dehydrogenase 11 (Retinal reductase 1)
            (RalR1) (Prostate short-chain dehydrogenase/reductase 1)
            (Androgen-regulated short-chain dehydrogenase/reductase
            1) (HCV core-binding protein HCBP12) [Canis familiaris]
          Length = 337

 Score =  403 bits (1036), Expect = e-112
 Identities = 195/292 (66%), Positives = 233/292 (79%)
 Frame = +1

Query: 217  IRKFFAGGVCRTNMQLPGKVVVITGANTGIGKETARELARRGARVYIACRDVLKGESAAS 396
            + K  + GVC + +QLPGKV V+TGANTGIGKETA+ELA+RGARVY+ACRDVLKGE  A 
Sbjct: 43   LMKILSRGVCTSTVQLPGKVAVVTGANTGIGKETAKELAQRGARVYLACRDVLKGELVAR 102

Query: 397  EIRADTKNSQVLVRKLDLSDTKSIRAFAEGFLTEEKQLHILINNAGVMLCPYSKTADGFE 576
            EI+  T N QVLVRKLDL+DTKSIRAFA+GFL EEK LHILINNAGVM+CPY+KT DGFE
Sbjct: 103  EIQTMTGNKQVLVRKLDLADTKSIRAFAKGFLAEEKHLHILINNAGVMMCPYTKTVDGFE 162

Query: 577  THLGVNXXXXXXXXXXXXXXXKASAPARVVNLSSVVHHAGKIRFHDLQGEKHYNRGFAYC 756
             H+GVN               K SAP+R+VN+SS+ HH G+I FHDLQGEK YN G AYC
Sbjct: 163  MHMGVNHLGHFLLTHLLLEKLKESAPSRIVNVSSLAHHLGRIHFHDLQGEKFYNSGLAYC 222

Query: 757  HSKLANVLFTRELAKRLQGTGVTTYAVHPGIVQSELVRHSFLLCLLWRLFSRFLKTAREG 936
            HSKLAN+LFT+ELA+RL+G+G+T Y+VHPG V+SELVRHS  +  +W LFS F+KT ++G
Sbjct: 223  HSKLANILFTQELARRLKGSGITAYSVHPGTVKSELVRHSPFMKWMWWLFSFFIKTPQQG 282

Query: 937  AQTSLHCALAEGLEPLSGKYFSDCKRAWVSPRARNNKTAERLWNVSCELLGI 1092
            AQTSL+CA+ EGLE LSG +FSDC  AWVS +ARN   A RLW+VSC+LLGI
Sbjct: 283  AQTSLYCAITEGLEVLSGHHFSDCSVAWVSAQARNETIARRLWDVSCDLLGI 334


>ref|XP_854127.1| PREDICTED: similar to Retinol dehydrogenase 13 [Canis familiaris]
          Length = 334

 Score =  271 bits (692), Expect = 2e-72
 Identities = 145/300 (48%), Positives = 192/300 (64%), Gaps = 7/300 (2%)
 Frame = +1

Query: 217  IRKFFAGGVCRTNMQLPGKVVVITGANTGIGKETARELARRGARVYIACRDVLKGESAAS 396
            +R + AGG C +   +PGK V++TGANTGIGK+TA ELARRG  + +ACRD+ K E+AA 
Sbjct: 21   LRDYIAGGACPSKATIPGKTVIVTGANTGIGKQTALELARRGGNIILACRDMEKCEAAAK 80

Query: 397  EIRADTKNSQVLVRKLDLSDTKSIRAFAEGFLTEEKQLHILINNAGVMLCPYSKTADGFE 576
            EIR +T N +V    LDL+  KSIR FA   + EE+Q+HIL+NNA VM CP+  T DGFE
Sbjct: 81   EIRGETLNHRVSAWHLDLASLKSIREFAAKIIEEEEQVHILVNNAAVMRCPHWTTKDGFE 140

Query: 577  THLGVNXXXXXXXXXXXXXXXKASAPARVVNLSSVVHHAGKIRFHDLQGEKH-YNRGFAY 753
               GVN               KASAP+R++NLSS+ H AG I F DL  EK  Y+   AY
Sbjct: 141  MQFGVNHLGHFLLTNLLLDKLKASAPSRIINLSSLAHVAGHIDFDDLNWEKRKYDTKAAY 200

Query: 754  CHSKLANVLFTRELAKRLQGTGVTTYAVHPGIVQSELVRH------SFLLCLLWRLFSRF 915
            C SKLA +LFT+EL++RLQGTGVT  A+HPG+ ++EL RH      +F    L  +F   
Sbjct: 201  CQSKLAVILFTKELSRRLQGTGVTVNALHPGVARTELGRHTGMHSSAFSSFTLGPIFWLL 260

Query: 916  LKTAREGAQTSLHCALAEGLEPLSGKYFSDCKRAWVSPRARNNKTAERLWNVSCELLGIQ 1095
            +K+ +  AQ S + A+AE LE +SGKYF   K    +P A + + A+RLW  S  L+G++
Sbjct: 261  VKSPQLAAQPSTYLAVAEELEGVSGKYFDGLKEKAPAPEAEDEEVAQRLWAESARLVGLE 320


>ref|XP_540096.2| PREDICTED: similar to retinol dehydrogenase 14 (all-trans and 9-cis)
            isoform 1 [Canis familiaris]
          Length = 336

 Score =  248 bits (633), Expect = 1e-65
 Identities = 139/336 (41%), Positives = 199/336 (59%), Gaps = 19/336 (5%)
 Frame = +1

Query: 142  AVETMLAVLGLLTSFLFFLY--VTAPSIRKFFAGGVCRTNMQLPGKVVVITGANTGIGKE 315
            AV  + A+L  L+  L+        P +++   GG    +  + GK V+ITGAN+G+G+ 
Sbjct: 2    AVAAVAALLAALSGVLWLAARRFVGPGVQQLHGGG---DSGLMHGKTVLITGANSGLGRA 58

Query: 316  TARELARRGARVYIACRDVLKGESAASEIRADTKNS-------------QVLVRKLDLSD 456
            TA  L R GARV + CRD  + E AA ++R + + +             +++VR+LDL+ 
Sbjct: 59   TAAALLRLGARVIMGCRDRARAEEAAGQLRRELRQAGGREPGSDVGAAGELVVRELDLAS 118

Query: 457  TKSIRAFAEGFLTEEKQLHILINNAGVMLCPYSKTADGFETHLGVNXXXXXXXXXXXXXX 636
             +S+RAF +  L EE +L +LINNAG+  CPY KT DGFE   GVN              
Sbjct: 119  LRSVRAFCQEVLQEEPRLDVLINNAGIFQCPYMKTEDGFEMQFGVNHLGHFLLTNLLLGL 178

Query: 637  XKASAPARVVNLSSVVHHAGKIRFHDLQGEKHYNRGFAYCHSKLANVLFTRELAKRLQGT 816
             K SAP+R+V +SS ++  G I F DL  E+ YN+ F Y  SKLAN+LFTRELA+RL+GT
Sbjct: 179  LKNSAPSRIVVVSSKLYKYGDINFEDLNSEQSYNKSFCYSRSKLANILFTRELARRLEGT 238

Query: 817  GVTTYAVHPGIVQSELVRHSFLLCLLWRLFS----RFLKTAREGAQTSLHCALAEGLEPL 984
             VT   +HPGIV++ L RH  +  L+  LF+     F KT  EGAQTS++ A +  +E +
Sbjct: 239  NVTVNVLHPGIVRTNLGRHIHIPLLVRPLFNLVSWAFFKTPVEGAQTSVYLASSPEVEGV 298

Query: 985  SGKYFSDCKRAWVSPRARNNKTAERLWNVSCELLGI 1092
            SGKYF DCK   + P+A +   A +LW++S  ++GI
Sbjct: 299  SGKYFGDCKEEELLPKAMDESVARKLWDISEVMVGI 334


>ref|XP_548293.2| PREDICTED: similar to retinol dehydrogenase 11 (predicted) [Canis
            familiaris]
          Length = 377

 Score =  226 bits (575), Expect = 7e-59
 Identities = 146/326 (44%), Positives = 190/326 (58%), Gaps = 10/326 (3%)
 Frame = +1

Query: 145  VETMLAVLGLLTSFLFFLY---VTAPSIRKFFAGGVCRTNMQLPGKVVVITGANTGIGKE 315
            +E +L   GLL      +Y   V AP       GG+      L G+  V+TGAN+GIGK 
Sbjct: 1    MEALLLGAGLLLGAYVLIYYNLVKAPP-----CGGIA----SLRGRTAVVTGANSGIGKM 51

Query: 316  TARELARRGARVYIACRDVLKGESAASEIRADTKNSQVLVRKLDLSDTKSIRAFAEGFLT 495
            TA ELARRGARV +ACR   +GE+AA ++R ++ N++V+   LDL+   S+RAFA  FL+
Sbjct: 52   TALELARRGARVVLACRSRERGEAAAFDLRQESGNNEVIFMALDLASLASVRAFATAFLS 111

Query: 496  EEKQLHILINNAGVMLCPYSKTADGFETHLGVNXXXXXXXXXXXXXXXKASAPARVVNLS 675
             E +L ILI+NAG+  C   +T   F   L VN               K  AP+RVV +S
Sbjct: 112  SEPRLDILIHNAGISSC--GRTHKPFNLLLRVNHIGPFLLTHLLLPRLKTCAPSRVVVVS 169

Query: 676  SVVHHAGKIRFHDLQ----GEKHYNRGFAYCHSKLANVLFTRELAKRLQGTGVTTYAVHP 843
            S  H  G++ F  L     G +   R  AY  SKLANVLF RELA +L+GTGVT YA HP
Sbjct: 170  SAAHRRGRLDFTRLDRPVVGWQQELR--AYADSKLANVLFARELATQLEGTGVTCYAAHP 227

Query: 844  GIVQSEL-VRH--SFLLCLLWRLFSRFLKTAREGAQTSLHCALAEGLEPLSGKYFSDCKR 1014
            G V SEL +RH   +L  LL  L    L+  R GAQT L+CAL EG+EPLSG+YF++C  
Sbjct: 228  GPVNSELFLRHVPGWLCPLLRPLAWLMLRAPRGGAQTPLYCALQEGIEPLSGRYFANCHV 287

Query: 1015 AWVSPRARNNKTAERLWNVSCELLGI 1092
              V P AR+++ A +LW  S  L G+
Sbjct: 288  EEVPPAARDDRAAHQLWEASKRLAGL 313


>ref|XP_857582.1| PREDICTED: similar to retinol dehydrogenase 14 (all-trans and 9-cis)
            isoform 4 [Canis familiaris]
          Length = 307

 Score =  194 bits (494), Expect = 2e-49
 Identities = 121/336 (36%), Positives = 178/336 (52%), Gaps = 19/336 (5%)
 Frame = +1

Query: 142  AVETMLAVLGLLTSFLFFLY--VTAPSIRKFFAGGVCRTNMQLPGKVVVITGANTGIGKE 315
            AV  + A+L  L+  L+        P +++   GG    +  + GK V+ITGAN+G+G+ 
Sbjct: 2    AVAAVAALLAALSGVLWLAARRFVGPGVQQLHGGG---DSGLMHGKTVLITGANSGLGRA 58

Query: 316  TARELARRGARVYIACRDVLKGESAASEIRADTKNS-------------QVLVRKLDLSD 456
            TA  L R GARV + CRD  + E AA ++R + + +             +++VR+LDL+ 
Sbjct: 59   TAAALLRLGARVIMGCRDRARAEEAAGQLRRELRQAGGREPGSDVGAAGELVVRELDLAS 118

Query: 457  TKSIRAFAEGFLTEEKQLHILINNAGVMLCPYSKTADGFETHLGVNXXXXXXXXXXXXXX 636
             +S+RAF +  L                               GVN              
Sbjct: 119  LRSVRAFCQEVL-----------------------------QFGVNHLGHFLLTNLLLGL 149

Query: 637  XKASAPARVVNLSSVVHHAGKIRFHDLQGEKHYNRGFAYCHSKLANVLFTRELAKRLQGT 816
             K SAP+R+V +SS ++  G I F DL  E+ YN+ F Y  SKLAN+LFTRELA+RL+GT
Sbjct: 150  LKNSAPSRIVVVSSKLYKYGDINFEDLNSEQSYNKSFCYSRSKLANILFTRELARRLEGT 209

Query: 817  GVTTYAVHPGIVQSELVRHSFLLCLLWRLFS----RFLKTAREGAQTSLHCALAEGLEPL 984
             VT   +HPGIV++ L RH  +  L+  LF+     F KT  EGAQTS++ A +  +E +
Sbjct: 210  NVTVNVLHPGIVRTNLGRHIHIPLLVRPLFNLVSWAFFKTPVEGAQTSVYLASSPEVEGV 269

Query: 985  SGKYFSDCKRAWVSPRARNNKTAERLWNVSCELLGI 1092
            SGKYF DCK   + P+A +   A +LW++S  ++GI
Sbjct: 270  SGKYFGDCKEEELLPKAMDESVARKLWDISEVMVGI 305


>ref|XP_533000.2| PREDICTED: similar to Retinol dehydrogenase 12 [Canis familiaris]
          Length = 596

 Score =  182 bits (463), Expect = 7e-46
 Identities = 113/286 (39%), Positives = 167/286 (58%), Gaps = 3/286 (1%)
 Frame = +1

Query: 244  CRTNMQLPGKVVVITGANTGIGKETARELARRGARVYIACRDVLKGESAASEIRADTKNS 423
            C T+  L GK  V+TGAN+GIGK   +ELARRGARV +ACR+  +G+ A +EI+  +K +
Sbjct: 309  CSTD--LTGKTAVVTGANSGIGKAVCQELARRGARVILACRNWERGQKALAEIQVASKGT 366

Query: 424  QVLVRKLDLSDTKSIRAFAEGFLTEEKQLHILINNAGVMLCPYSKTADGFETHLGVNXXX 603
             +L+ ++DLS   SIR+FA   L E  ++H+L+NNA +   P + T +G +     N   
Sbjct: 367  CLLLGQVDLSSMASIRSFARWLLQEYPEIHLLVNNAAISGFPKTLTPEGLDLTFATNYVG 426

Query: 604  XXXXXXXXXXXXKASAPARVVNLSSVVHHAGKIRFHDLQGE-KHYNRGFAYCHSKLANVL 780
                        + +  ARVVN+SS  H  G +    L G  K  N   +Y  SKL    
Sbjct: 427  PFLLTNLLQGALQRAGSARVVNVSSFRHAHGYVDEKHLTGAGKPLNLIQSYDCSKLLLTS 486

Query: 781  FTRELAKRLQGTGVTTYAVHPGIVQSELVR-HSFLLCLLWRLFSRFLKTAREGAQTSLHC 957
            FT ELA+RLQGTGVT  +V PG+V +E+++ + +L   L+ LFS F K  ++GA   L+ 
Sbjct: 487  FTGELARRLQGTGVTVNSVDPGVVYTEIMKPYPWLYRFLFWLFSFFCKDVKQGAIPVLYL 546

Query: 958  ALAEGLEPLSGKYF-SDCKRAWVSPRARNNKTAERLWNVSCELLGI 1092
            +LA+ L+ +SGKYF S C     +  A++ + A+ LWN S +L  +
Sbjct: 547  SLAKELDGVSGKYFSSSCMITLPTEAAQDPQVAQSLWNASVQLTNL 592


>ref|XP_852222.1| PREDICTED: similar to dehydrogenase/reductase (SDR family) X-linked
            [Canis familiaris]
          Length = 387

 Score =  166 bits (421), Expect = 5e-41
 Identities = 109/284 (38%), Positives = 148/284 (52%), Gaps = 8/284 (2%)
 Frame = +1

Query: 265  PGKVVVITGANTGIGKETARELARRGARVYIACRDVLKGESAASEIRADTKNSQVLVRKL 444
            P +V ++TG   GIG  TA+ LAR G  V +A  +         +I+ +T N +V     
Sbjct: 94   PERVAIVTGGTDGIGYSTAKHLARLGMHVILAGNNDSSAPDVVRKIQEETLNDKVEFLYC 153

Query: 445  DLSDTKSIRAFAEGFLTEEKQLHILINNAGVMLCPYSKTADGFETHLGVNXXXXXXXXXX 624
            DL+  +SIR F + F  ++  LH+L+NNAGVM+ P   T DGFE H G+N          
Sbjct: 154  DLASLRSIRQFVQKFKKKKIPLHVLVNNAGVMMVPERTTEDGFEEHFGLNYLGHFLLTNL 213

Query: 625  XXXXXKAS-AP---ARVVNLSSVVHHAGKIRFHDLQGEKHYNRGFAYCHSKLANVLFTRE 792
                 K S AP   ARVV +SS  H+ G++   DLQG + Y+   AY  SKLA VLFT  
Sbjct: 214  LLDTLKESGAPGRCARVVTVSSATHYIGELDMDDLQGSRCYSPHAAYAQSKLALVLFTYH 273

Query: 793  LAKRL--QGTGVTTYAVHPGIVQSELVRHSFL-LCLLWRLFS-RFLKTAREGAQTSLHCA 960
            L + L  QG+ VT   V PG+V + L RH F    L+ +LF   F KT  EGA TS++ A
Sbjct: 274  LQRLLAAQGSPVTANVVDPGVVNTNLYRHVFWGTRLIKKLFGWWFFKTPDEGAWTSVYAA 333

Query: 961  LAEGLEPLSGKYFSDCKRAWVSPRARNNKTAERLWNVSCELLGI 1092
            +   LE L G+Y  + K         +      LW  SC++ GI
Sbjct: 334  VTPDLEGLGGRYLYNEKETKSLAVTYDLDLQTELWARSCQMTGI 377


>ref|XP_852623.1| PREDICTED: similar to WW domain-containing oxidoreductase isoform 1
           [Canis familiaris]
          Length = 383

 Score =  144 bits (363), Expect = 3e-34
 Identities = 95/253 (37%), Positives = 134/253 (52%), Gaps = 13/253 (5%)
 Frame = +1

Query: 205 TAPSIRKFFAGGVCRTNM----QLPGKVVVITGANTGIGKETARELARRGARVYIACRDV 372
           T P+ R+ + GG     +       GKVVV+TGAN+GIG ETA+  A  GA V +ACR++
Sbjct: 99  TKPTSRQRYDGGTTAMEILQGRDFTGKVVVVTGANSGIGFETAKSFALHGAHVILACRNM 158

Query: 373 LKGESAASEIRADTKNSQVLVRKLDLSDTKSIRAFAEGFLTEEKQLHILINNAGVMLCPY 552
            +   A S+I  +   ++V    LDL+  +S++ FA+ F  +   LH+L+ NA     P+
Sbjct: 159 TRANEAVSQILGEWHKAKVEAMTLDLALLRSVQHFAQAFKAKNVSLHVLVCNAAAFALPW 218

Query: 553 SKTADGFETHLGVNXXXXXXXXXXXXXXXKASAPARVVNLSSVVHH-------AGKIRFH 711
           S T DG ET   VN                 SAPARVV +SS  H        +GK+ F 
Sbjct: 219 SLTKDGLETTFQVNHLGHFYLVQLLQDVLCRSAPARVVVVSSESHRFTDINDSSGKLDFS 278

Query: 712 DLQGEK-HYNRGFAYCHSKLANVLFTRELAKRLQGTGVTTYAVHPG-IVQSELVRHSFLL 885
            L   K  Y    AY  SKL N+LF+ EL +RL   GVT+ AVHPG ++ S + R+ ++ 
Sbjct: 279 RLSPSKSDYWAMLAYNRSKLCNILFSNELHRRLSPRGVTSNAVHPGNMMYSSIHRNWWVY 338

Query: 886 CLLWRLFSRFLKT 924
            LL+ L   F K+
Sbjct: 339 TLLFTLARPFTKS 351


>ref|XP_857503.1| PREDICTED: similar to retinol dehydrogenase 14 (all-trans and
           9-cis) isoform 3 [Canis familiaris]
          Length = 153

 Score = 72.4 bits (176), Expect = 1e-12
 Identities = 45/136 (33%), Positives = 73/136 (53%), Gaps = 15/136 (11%)
 Frame = +1

Query: 142 AVETMLAVLGLLTSFLFFLY--VTAPSIRKFFAGGVCRTNMQLPGKVVVITGANTGIGKE 315
           AV  + A+L  L+  L+        P +++   GG    +  + GK V+ITGAN+G+G+ 
Sbjct: 2   AVAAVAALLAALSGVLWLAARRFVGPGVQQLHGGG---DSGLMHGKTVLITGANSGLGRA 58

Query: 316 TARELARRGARVYIACRDVLKGESAASEIRADTKNS-------------QVLVRKLDLSD 456
           TA  L R GARV + CRD  + E AA ++R + + +             +++VR+LDL+ 
Sbjct: 59  TAAALLRLGARVIMGCRDRARAEEAAGQLRRELRQAGGREPGSDVGAAGELVVRELDLAS 118

Query: 457 TKSIRAFAEGFLTEEK 504
            +S+RAF +  L   K
Sbjct: 119 LRSVRAFCQEVLQGRK 134


  Database: RefSeqCP
    Posted date:  Aug 1, 2006  9:25 PM
  Number of letters in database: 19,266,565
  Number of sequences in database:  33,732
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 75,829,168
Number of Sequences: 33732
Number of extensions: 2174450
Number of successful extensions: 8501
Number of sequences better than 1.0e-05: 10
Number of HSP's better than  0.0 without gapping: 6541
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 8443
length of database: 19,266,565
effective HSP length: 108
effective length of database: 15,623,509
effective search space used: 7343049230
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqMP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611C-000325
         (1737 letters)

Database: RefSeqMP 
           45,328 sequences; 21,768,885 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_084293.1| retinol dehydrogenase 12 [Mus musculus]              510   e-144
Alignment   gi|NP_067532.2| short-chain dehydrogenase/reductase 1 [Mus musc...   417   e-116
Alignment   gi|NP_780581.1| retinol dehydrogenase 13 (all-trans and 9-cis) ...   258   1e-68
Alignment   gi|NP_076186.1| alcohol dehydrogenase PAN2 [Mus musculus]            250   4e-66
Alignment   gi|NP_062519.2| WW-domain oxidoreductase [Mus musculus]              181   2e-45
Alignment   gi|NP_001028498.1| dehydrogenase/reductase (SDR family) X chrom...   169   6e-42
Alignment   gi|NP_899109.1| hypothetical protein LOC70451 [Mus musculus]         169   8e-42
Alignment   gi|NP_079798.1| retinal short-chain dehydrogenase/reductase 4 [...    69   2e-11
Alignment   gi|NP_766635.1| carbonyl reductase 3 [Mus musculus]                   64   4e-10
Alignment   gi|NP_780721.1| NADP-dependent retinol dehydrogenase/reductase ...    64   7e-10

>ref|NP_084293.1| retinol dehydrogenase 12 [Mus musculus]
          Length = 316

 Score =  510 bits (1313), Expect = e-144
 Identities = 257/316 (81%), Positives = 272/316 (86%)
 Frame = +1

Query: 154  MLAVLGLLTSFLFFLYVTAPSIRKFFAGGVCRTNMQLPGKVVVITGANTGIGKETARELA 333
            ML +L LLTSFL  LY+TAPSIRKFFAGGVC TN+Q+PGKVVVITGANTGIGKETARELA
Sbjct: 1    MLFILVLLTSFLSILYLTAPSIRKFFAGGVCTTNVQIPGKVVVITGANTGIGKETARELA 60

Query: 334  RRGARVYIACRDVLKGESAASEIRADTKNSQVLVRKLDLSDTKSIRAFAEGFLTEEKQLH 513
            RRGARVYIACRDVLKGESAASEIRADTKNSQVLVRKLDLSDTKSIRAFAE FL EEK+LH
Sbjct: 61   RRGARVYIACRDVLKGESAASEIRADTKNSQVLVRKLDLSDTKSIRAFAERFLAEEKKLH 120

Query: 514  ILINNAGVMLCPYSKTADGFETHLGVNXXXXXXXXXXXXXXXKASAPARVVNLSSVVHHA 693
            ILINNAGVM+CPYSKT DGFETH GVN               K SAPARVVNLSS+ H  
Sbjct: 121  ILINNAGVMMCPYSKTTDGFETHFGVNHLGHFLLTYLLLERLKESAPARVVNLSSIAHLI 180

Query: 694  GKIRFHDLQGEKHYNRGFAYCHSKLANVLFTRELAKRLQGTGVTTYAVHPGIVQSELVRH 873
            GKIRFHDLQG+K Y   FAY HSKLAN+LFTRELAKRLQGTGVT YAVHPG+V SE+ R+
Sbjct: 181  GKIRFHDLQGQKRYCSAFAYGHSKLANLLFTRELAKRLQGTGVTAYAVHPGVVLSEITRN 240

Query: 874  SFLLCLLWRLFSRFLKTAREGAQTSLHCALAEGLEPLSGKYFSDCKRAWVSPRARNNKTA 1053
            S+LLCLLWRLFS F K+  +GAQTSLHCALAE LEPLSGKYFSDCKR WVS RARN KTA
Sbjct: 241  SYLLCLLWRLFSPFFKSTSQGAQTSLHCALAEDLEPLSGKYFSDCKRMWVSSRARNKKTA 300

Query: 1054 ERLWNVSCELLGIQWE 1101
            ERLWNVSCELLGIQWE
Sbjct: 301  ERLWNVSCELLGIQWE 316


>ref|NP_067532.2| short-chain dehydrogenase/reductase 1 [Mus musculus]
          Length = 316

 Score =  417 bits (1071), Expect = e-116
 Identities = 204/307 (66%), Positives = 244/307 (79%)
 Frame = +1

Query: 172  LLTSFLFFLYVTAPSIRKFFAGGVCRTNMQLPGKVVVITGANTGIGKETARELARRGARV 351
            LL S  F LY+  P IRK  + GVC +N+QLPGKV ++TGANTGIGKETA++LA+RGARV
Sbjct: 6    LLLSLPFILYLVTPKIRKMLSSGVCTSNVQLPGKVAIVTGANTGIGKETAKDLAQRGARV 65

Query: 352  YIACRDVLKGESAASEIRADTKNSQVLVRKLDLSDTKSIRAFAEGFLTEEKQLHILINNA 531
            Y+ACRDV KGE AA EI+A T NSQV VRKLDL+DTKSIRAFA+ FL EEK LH+LINNA
Sbjct: 66   YLACRDVDKGELAAREIQAVTGNSQVFVRKLDLADTKSIRAFAKDFLAEEKHLHLLINNA 125

Query: 532  GVMLCPYSKTADGFETHLGVNXXXXXXXXXXXXXXXKASAPARVVNLSSVVHHAGKIRFH 711
            GVM+CPYSKTADGFE H+GVN               K SAP+R+VNLSS+ HH G+I FH
Sbjct: 126  GVMMCPYSKTADGFEMHIGVNHLGHFLLTHLLLEKLKESAPSRIVNLSSLGHHLGRIHFH 185

Query: 712  DLQGEKHYNRGFAYCHSKLANVLFTRELAKRLQGTGVTTYAVHPGIVQSELVRHSFLLCL 891
            +LQGEK Y+ G AYCHSKLAN+LFT+ELAKRL+G+GVTTY+VHPG V SEL R+S ++  
Sbjct: 186  NLQGEKFYSAGLAYCHSKLANILFTKELAKRLKGSGVTTYSVHPGTVHSELTRYSSIMRW 245

Query: 892  LWRLFSRFLKTAREGAQTSLHCALAEGLEPLSGKYFSDCKRAWVSPRARNNKTAERLWNV 1071
            LW+LF  F+KT +EGAQTSL+CAL EGLE LSG +FSDC+ AWVS + RN   A RLW+V
Sbjct: 246  LWQLFFVFIKTPQEGAQTSLYCALTEGLESLSGSHFSDCQLAWVSYQGRNEIIARRLWDV 305

Query: 1072 SCELLGI 1092
            SC+LLG+
Sbjct: 306  SCDLLGL 312


>ref|NP_780581.1| retinol dehydrogenase 13 (all-trans and 9-cis) [Mus musculus]
          Length = 334

 Score =  258 bits (660), Expect = 1e-68
 Identities = 140/299 (46%), Positives = 187/299 (62%), Gaps = 7/299 (2%)
 Frame = +1

Query: 217  IRKFFAGGVCRTNMQLPGKVVVITGANTGIGKETARELARRGARVYIACRDVLKGESAAS 396
            ++ + AGG C +   +PGK V++TGANTGIGK+TA ELA+RG  V +ACRD+ K E AA 
Sbjct: 21   LKDYVAGGACPSKATIPGKTVIVTGANTGIGKQTALELAKRGGNVILACRDMEKCEVAAK 80

Query: 397  EIRADTKNSQVLVRKLDLSDTKSIRAFAEGFLTEEKQLHILINNAGVMLCPYSKTADGFE 576
            +IR +T N +V   +LDL+  KSIR FA   + EE+++ IL+NNA VM CP+  T DGFE
Sbjct: 81   DIRGETLNPRVRAERLDLASLKSIREFARKVIKEEERVDILVNNAAVMRCPHWTTEDGFE 140

Query: 577  THLGVNXXXXXXXXXXXXXXXKASAPARVVNLSSVVHHAGKIRFHDLQGE-KHYNRGFAY 753
               GVN               KASAP+R++NLSS+ H AG I F DL  + K Y+   AY
Sbjct: 141  MQFGVNYLGHFLLTNLLLDKLKASAPSRIINLSSLAHVAGHIDFEDLNWQMKKYDTKAAY 200

Query: 754  CHSKLANVLFTRELAKRLQGTGVTTYAVHPGIVQSELVRH------SFLLCLLWRLFSRF 915
            C SKLA VLFT+EL+ RLQG+GVT  A+HPG+ ++EL RH      +F   +L   F   
Sbjct: 201  CQSKLAVVLFTKELSHRLQGSGVTVNALHPGVARTELGRHTGMHNSAFSGFMLGPFFWLL 260

Query: 916  LKTAREGAQTSLHCALAEGLEPLSGKYFSDCKRAWVSPRARNNKTAERLWNVSCELLGI 1092
             K+ +  AQ S + A+AE LE +SGKYF   +    SP A + + A RLW  S  L+G+
Sbjct: 261  FKSPQLAAQPSTYLAVAEELENVSGKYFDGLREKAPSPEAEDEEVARRLWTESARLVGL 319


>ref|NP_076186.1| alcohol dehydrogenase PAN2 [Mus musculus]
          Length = 334

 Score =  250 bits (638), Expect = 4e-66
 Identities = 132/289 (45%), Positives = 183/289 (63%), Gaps = 14/289 (4%)
 Frame = +1

Query: 268  GKVVVITGANTGIGKETARELARRGARVYIACRDVLKGESAASEIRA----------DTK 417
            GK V+ITGAN+G+G+ TA EL R GARV + CRD  + E AA ++R           D  
Sbjct: 44   GKTVLITGANSGLGRATAAELLRLGARVIMGCRDRARAEEAAGQLRQELCQAGGAGPDGT 103

Query: 418  NSQVLVRKLDLSDTKSIRAFAEGFLTEEKQLHILINNAGVMLCPYSKTADGFETHLGVNX 597
            + Q++V++LDL+  +S+RAF +  L EE +L +LINNAGV  CPY+KT DGFE   GVN 
Sbjct: 104  DGQLVVKELDLASLRSVRAFCQELLQEEPRLDVLINNAGVFHCPYTKTEDGFEMQFGVNH 163

Query: 598  XXXXXXXXXXXXXXKASAPARVVNLSSVVHHAGKIRFHDLQGEKHYNRGFAYCHSKLANV 777
                          K+SAP+R+V +SS ++  G+I F DL  E+ YN+ F Y  SKLAN+
Sbjct: 164  LGHFLLTNLLLGLLKSSAPSRIVVVSSKLYKYGEINFEDLNSEQSYNKSFCYSRSKLANI 223

Query: 778  LFTRELAKRLQGTGVTTYAVHPGIVQSELVRHSFLLCLLWRLFS----RFLKTAREGAQT 945
            LFTRELA+RL+GT VT   +HPGIV++ L RH  +  L   LF+     F KT  EGAQT
Sbjct: 224  LFTRELARRLEGTNVTVNVLHPGIVRTNLGRHIHIPLLARPLFNLVSWAFFKTPLEGAQT 283

Query: 946  SLHCALAEGLEPLSGKYFSDCKRAWVSPRARNNKTAERLWNVSCELLGI 1092
            S++ A +  +E +SG+YF DCK   + P+A +   A +LW++S  ++GI
Sbjct: 284  SIYLACSPDVEGVSGRYFGDCKEEELLPKAMDESVARKLWDISEVMVGI 332


>ref|NP_062519.2| WW-domain oxidoreductase [Mus musculus]
          Length = 414

 Score =  181 bits (460), Expect = 2e-45
 Identities = 113/307 (36%), Positives = 167/307 (54%), Gaps = 13/307 (4%)
 Frame = +1

Query: 205  TAPSIRKFFAGGVCRTNM----QLPGKVVVITGANTGIGKETARELARRGARVYIACRDV 372
            T P+ R+ + G      +       GKVV++TGAN+GIG ETA+  A  GA V +ACR++
Sbjct: 99   TKPTTRQRYDGSTTAMEILQGRDFTGKVVLVTGANSGIGFETAKSFALHGAHVILACRNL 158

Query: 373  LKGESAASEIRADTKNSQVLVRKLDLSDTKSIRAFAEGFLTEEKQLHILINNAGVMLCPY 552
             +   A S I  +   ++V    LDL+  +S++ FAE F  +   LH+L+ NAG    P+
Sbjct: 159  SRASEAVSRILEEWHKAKVEAMTLDLAVLRSVQHFAEAFKAKNVSLHVLVCNAGTFALPW 218

Query: 553  SKTADGFETHLGVNXXXXXXXXXXXXXXXKASAPARVVNLSSVVHH-------AGKIRFH 711
              T DG ET   VN                 S+PARV+ +SS  H        +GK+   
Sbjct: 219  GLTKDGLETTFQVNHLGHFYLVQLLQDVLCRSSPARVIVVSSESHRFTDINDSSGKLDLS 278

Query: 712  DLQGEK-HYNRGFAYCHSKLANVLFTRELAKRLQGTGVTTYAVHPG-IVQSELVRHSFLL 885
             L   +  Y    AY  SKL N+LF+ EL +RL   GVT+ AVHPG ++ S + R+S++ 
Sbjct: 279  RLSPPRSDYWAMLAYNRSKLCNILFSNELHRRLSPRGVTSNAVHPGNMMYSAIHRNSWVY 338

Query: 886  CLLWRLFSRFLKTAREGAQTSLHCALAEGLEPLSGKYFSDCKRAWVSPRARNNKTAERLW 1065
             LL+ L   F K+ ++GA T+++CA+A  LE L G YF++C R   S  A++ +TA  LW
Sbjct: 339  KLLFTLARPFTKSMQQGAATTVYCAVAPELEGLGGMYFNNCCRCLPSEEAQSEETARALW 398

Query: 1066 NVSCELL 1086
             +S  L+
Sbjct: 399  ELSERLI 405


>ref|NP_001028498.1| dehydrogenase/reductase (SDR family) X chromosome [Mus musculus]
          Length = 335

 Score =  169 bits (429), Expect = 6e-42
 Identities = 107/283 (37%), Positives = 146/283 (51%), Gaps = 8/283 (2%)
 Frame = +1

Query: 265  PGKVVVITGANTGIGKETARELARRGARVYIACRDVLKGESAASEIRADTKNSQVLVRKL 444
            PG+V ++TGA  GIG+ TAR+LAR G  V +A  D  +G+   S IRA+  + +     L
Sbjct: 42   PGRVAIVTGATAGIGRSTARQLARLGMCVVVAGNDEHRGQEVVSSIRAEMGSDRAHFLPL 101

Query: 445  DLSDTKSIRAFAEGFLTEEKQLHILINNAGVMLCPYSKTADGFETHLGVNXXXXXXXXXX 624
            DL+   S+R FA  F      LH+L+NNAGVML P ++T DGFE HLGVN          
Sbjct: 102  DLASLASVRGFARDFQALGLPLHLLVNNAGVMLEPRAETEDGFERHLGVNFLGHFLLTLL 161

Query: 625  XXXXXKASAP----ARVVNLSSVVHHAGKIRFHDLQGEKHYNRGFAYCHSKLANVLFTRE 792
                 +AS      +RVV + S  H+ G +   DL G   Y+   AY  SKLA  LF  +
Sbjct: 162  LLPALRASGAEGRGSRVVTVGSATHYVGTVDMADLHGRHAYSPYAAYAQSKLALALFALQ 221

Query: 793  LAKRLQGTG--VTTYAVHPGIVQSELVRHSFLLCLLWRLFSRFL--KTAREGAQTSLHCA 960
            L + L   G  VT+    PG+V +EL RH+  +    + F  +L  K+  EGA T ++ A
Sbjct: 222  LQRILDARGDPVTSNMADPGVVDTELYRHAGWVLRTAKRFLGWLVFKSPEEGAWTLVYAA 281

Query: 961  LAEGLEPLSGKYFSDCKRAWVSPRARNNKTAERLWNVSCELLG 1089
             A  LE + G+Y  D   A     AR+ +   RLW     L G
Sbjct: 282  AAPELEGVGGRYLRDEAEAEPLGTARDQELQRRLWAEGLRLTG 324


>ref|NP_899109.1| hypothetical protein LOC70451 [Mus musculus]
          Length = 260

 Score =  169 bits (428), Expect = 8e-42
 Identities = 111/251 (44%), Positives = 148/251 (58%), Gaps = 8/251 (3%)
 Frame = +1

Query: 145 VETMLAVLGLLTSFLFFLY---VTAPSIRKFFAGGVCRTNMQLPGKVVVITGANTGIGKE 315
           +E +L   GLL      +Y   V APS      GG+      L G+ VV+TGAN+GIGK 
Sbjct: 1   MEMLLLGAGLLLGAYVLVYYNLVKAPS-----CGGIG----SLRGRTVVVTGANSGIGKM 51

Query: 316 TARELARRGARVYIACRDVLKGESAASEIRADTKNSQVLVRKLDLSDTKSIRAFAEGFLT 495
           TA ELARRGARV +ACR   +GE+AA ++R ++ N++V+   LDL+   S++AFA  FL+
Sbjct: 52  TALELARRGARVVLACRSRERGEAAAFDLRQESGNNEVIFMALDLASLASVQAFATAFLS 111

Query: 496 EEKQLHILINNAGVMLCPYSKTADGFETHLGVNXXXXXXXXXXXXXXXKASAPARVVNLS 675
            E +L +LI+NAG+  C   +T + F   L VN               ++ AP+RVV +S
Sbjct: 112 SEPRLDVLIHNAGISSC--GRTRETFNLLLRVNHVGPFLLTHLLLPRLRSCAPSRVVIVS 169

Query: 676 SVVHHAGKIRFHDLQ----GEKHYNRGFAYCHSKLANVLFTRELAKRLQGTGVTTYAVHP 843
           S  H  G++ F  L     G +   R  AY  SKLANVLF RELA +L+GTGVT YA HP
Sbjct: 170 SAAHRRGRLDFTRLDCPVVGWQQELR--AYADSKLANVLFARELATQLEGTGVTCYAAHP 227

Query: 844 GIVQSEL-VRH 873
           G V SEL +RH
Sbjct: 228 GPVNSELFLRH 238


>ref|NP_079798.1| retinal short-chain dehydrogenase/reductase 4 [Mus musculus]
          Length = 288

 Score = 68.9 bits (167), Expect = 2e-11
 Identities = 65/254 (25%), Positives = 105/254 (41%), Gaps = 3/254 (1%)
 Frame = +1

Query: 274  VVVITGANTGIGKETARELARRGARVYIACRDVLKGESAASEI--RADTKNSQVLVRKLD 447
            VV +TGA++GIG+E A +L++ G  + ++ R   + E          + K   +LV  LD
Sbjct: 2    VVWVTGASSGIGEELAFQLSKLGVSLVLSARRAQELERVKRRCLENGNLKEKDILVLPLD 61

Query: 448  LSDTKSIRAFAEGFLTEEKQLHILINNAGVMLCPYSKTADGFETHLGVNXXXXXXXXXXX 627
            L+DT S  A  +  L E  ++ IL+NN G      S+ +   ET+L V            
Sbjct: 62   LTDTSSHEAATKAVLQEFGKIDILVNNGG-----RSQRSLVLETNLDVFKELINLNYIGT 116

Query: 628  XXXXKASAPARVVNLSSVVHHAGKIRFHDLQGEKHYNRGFAYCHSKLANVLFTRELAKRL 807
                K   P  +      +     +  + + G    +    YC SK A   F   L   L
Sbjct: 117  VSLTKCVLPHMIERKQGKI-----VTVNSIAGIASVSLSSGYCASKHALRGFFNALHSEL 171

Query: 808  -QGTGVTTYAVHPGIVQSELVRHSFLLCLLWRLFSRFLKTAREGAQTSLHCALAEGLEPL 984
             Q  G+T   V+PG VQS++V+++F             K+ R     S     +  +  +
Sbjct: 172  GQYPGITFCNVYPGPVQSDIVKNAFT--------EEVTKSMRNNIDQSYKMPTSRCVRLM 223

Query: 985  SGKYFSDCKRAWVS 1026
                 +D K  W+S
Sbjct: 224  LISMANDLKEVWIS 237


>ref|NP_766635.1| carbonyl reductase 3 [Mus musculus]
          Length = 277

 Score = 64.3 bits (155), Expect = 4e-10
 Identities = 65/265 (24%), Positives = 109/265 (41%), Gaps = 34/265 (12%)
 Frame = +1

Query: 271 KVVVITGANTGIGKETARELARR-GARVYIACRDVLKGESAASEIRADTKNSQVLVRKLD 447
           +V ++TGAN GIG    R+L R+    V +  RD  +G +A  +++A+  + +    +LD
Sbjct: 6   RVALVTGANKGIGFAITRDLCRKFSGDVVLTARDEARGRAAVQQLQAEGLSPRF--HQLD 63

Query: 448 LSDTKSIRAFAEGFLTEEKQLHILINNAGVMLCPYSKTADGFETHLGVNXXXXXXXXXXX 627
           + D +SIRA  +    E   L++L+NNAG+       T    +  + +            
Sbjct: 64  IDDPQSIRALRDFLRKEYGGLNVLVNNAGIAFRMDDPTPFDIQAEVTLKTNFFATRNVCT 123

Query: 628 XXXXKASAPARVVNLSSV--------------------------VHHAGKIRFHDLQGEK 729
                     RVVN+SS+                          +    K    D + E 
Sbjct: 124 ELLPIMKPHGRVVNISSLQGLKALENCREDLQEKFRCDTLTEVDLVDLMKKFVEDTKNEV 183

Query: 730 HYNRGF---AYCHSKLANVLFTRELAKRL----QGTGVTTYAVHPGIVQSELVRHSFLLC 888
           H   G+   AY  SKL   + TR LA++L    +   +   A  PG V++++ R      
Sbjct: 184 HEREGWPDSAYGVSKLGVTVLTRILARQLDEKRKADRILLNACCPGWVKTDMAR------ 237

Query: 889 LLWRLFSRFLKTAREGAQTSLHCAL 963
                  +  +T  EGA+T ++ AL
Sbjct: 238 ------DQGSRTVEEGAETPVYLAL 256


>ref|NP_780721.1| NADP-dependent retinol dehydrogenase/reductase [Mus musculus]
          Length = 319

 Score = 63.5 bits (153), Expect = 7e-10
 Identities = 62/203 (30%), Positives = 93/203 (45%), Gaps = 5/203 (2%)
 Frame = +1

Query: 271 KVVVITGANTGIGKETARELARRGARVYIACRDVLKGESAASEIRADTKNSQVLVRKLDL 450
           K V ITG +TG G   AR   ++G RV  AC  + +  SAA + +   +   VL   LD+
Sbjct: 30  KYVFITGCDTGFGNLAARTFDKKGFRVIAAC--LTESGSAALKAKTSERLHTVL---LDV 84

Query: 451 SDTKSIRAFAEGFLTE--EKQLHILINNAGVM--LCPYS-KTADGFETHLGVNXXXXXXX 615
           +D ++++  A+   +   EK L  LINNAGV+  L P    T D +   + VN       
Sbjct: 85  TDPENVKKTAQWVKSHVGEKGLWGLINNAGVLGVLAPTDWLTVDDYREPIEVNLFGLINV 144

Query: 616 XXXXXXXXKASAPARVVNLSSVVHHAGKIRFHDLQGEKHYNRGFAYCHSKLANVLFTREL 795
                   K  A  RV+N+SS+    G++ F           G  Y  SK A   F   L
Sbjct: 145 TLNMLPLVK-KARGRVINVSSI---GGRLAF----------GGGGYTPSKYAVEGFNDSL 190

Query: 796 AKRLQGTGVTTYAVHPGIVQSEL 864
            + ++  GV    + PG+ ++EL
Sbjct: 191 RRDMKAFGVHVSCIEPGLFKTEL 213


  Database: RefSeqMP
    Posted date:  Aug 2, 2006 12:58 AM
  Number of letters in database: 21,768,885
  Number of sequences in database:  45,328
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 86,628,072
Number of Sequences: 45328
Number of extensions: 2466290
Number of successful extensions: 9368
Number of sequences better than 1.0e-05: 10
Number of HSP's better than  0.0 without gapping: 7274
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 9310
length of database: 21,768,885
effective HSP length: 109
effective length of database: 16,828,133
effective search space used: 7892394377
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)