Animal-Genome cDNA 20060611C-000543


Search to RefSeqBP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611C-000543
         (991 letters)

Database: RefSeqBP 
           33,508 sequences; 16,112,626 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_776702.1| clathrin, light polypeptide B (light chain B) [...   354   5e-98
Alignment   gi|NP_776447.1| clathrin, light polypeptide (Lca) [Bos taurus]       218   8e-57

>ref|NP_776702.1| clathrin, light polypeptide B (light chain B) [Bos taurus]
          Length = 210

 Score =  354 bits (909), Expect = 5e-98
 Identities = 180/210 (85%), Positives = 181/210 (86%)
 Frame = +2

Query: 218 MADDXXXXXXXXXXXXXXXXXXXXXXFLAQQESEIAGIENDEGFGAPAGSQAALAQPGLA 397
           MADD                      FLAQQESEIAGIENDEGFGAPAGSQ  LAQPG A
Sbjct: 1   MADDFGFFSSSESGAPEAAEEDPAAAFLAQQESEIAGIENDEGFGAPAGSQGGLAQPGPA 60

Query: 398 SGGPEDMGTTVNGDVFQDANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAAS 577
           SG  EDMG TVNGDVFQ+ANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAAS
Sbjct: 61  SGASEDMGATVNGDVFQEANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAAS 120

Query: 578 KVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNRASEEAFVKESKEETPGTEWEKVAQLC 757
           KV EQEWREKAKKDLEEWNQRQSEQVEKNKINNRASEEAFVKESKEETPGTEWEKVAQLC
Sbjct: 121 KVMEQEWREKAKKDLEEWNQRQSEQVEKNKINNRASEEAFVKESKEETPGTEWEKVAQLC 180

Query: 758 DFNPKSSKQCKDVSRLRSVLMSLKQTPLSR 847
           DFNPKSSKQCKDVSRLRSVLMSLKQTPLSR
Sbjct: 181 DFNPKSSKQCKDVSRLRSVLMSLKQTPLSR 210


>ref|NP_776447.1| clathrin, light polypeptide (Lca) [Bos taurus]
          Length = 243

 Score =  218 bits (554), Expect = 8e-57
 Identities = 115/212 (54%), Positives = 137/212 (64%), Gaps = 30/212 (14%)
 Frame = +2

Query: 296 FLAQQESEIAGIENDEGFGAPAGSQAALAQPGLASGGPEDMGTTVNGDVFQDANGPADGY 475
           FLAQQESEIAGIENDE F    G        G   G P+ +    NGD +Q++NGP D Y
Sbjct: 30  FLAQQESEIAGIENDEAFAILDGGAPGSQPHGEPPGIPDAVDGVTNGDYYQESNGPTDSY 89

Query: 476 AAIAQADRLTQEPESIRKWREEQRKRLQELDAASKVTEQEWREKAKKDLEEWNQRQSEQV 655
           AAI+Q DRL  EPESIRKWREEQ +RL+ LDA S+  E EW+EKA K+L+EW  RQ EQ+
Sbjct: 90  AAISQVDRLQSEPESIRKWREEQTERLEALDANSRKQEAEWKEKAIKELDEWYARQDEQL 149

Query: 656 EKNKINNR------------------------------ASEEAFVKESKEETPGTEWEKV 745
           +K K NNR                              A+EEAFV + +E +PGTEWE+V
Sbjct: 150 QKTKANNRVADEAFYKQPFADVIGYVTNINHPCYSLEQAAEEAFVNDIEESSPGTEWERV 209

Query: 746 AQLCDFNPKSSKQCKDVSRLRSVLMSLKQTPL 841
           A+LCDFNPKSSKQ KDVSR+RSVL+SLKQ PL
Sbjct: 210 ARLCDFNPKSSKQAKDVSRMRSVLISLKQAPL 241


  Database: RefSeqBP
    Posted date:  Aug 1, 2006  7:14 PM
  Number of letters in database: 16,112,626
  Number of sequences in database:  33,508
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 33,742,460
Number of Sequences: 33508
Number of extensions: 905987
Number of successful extensions: 6159
Number of sequences better than 1.0e-05: 2
Number of HSP's better than  0.0 without gapping: 4600
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6056
length of database: 16,112,626
effective HSP length: 102
effective length of database: 12,694,810
effective search space used: 2881721870
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqSP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611C-000543
         (991 letters)

Database: RefSeqSP 
           1040 sequences; 434,620 total letters

Searching...done

 ***** No hits found ******

  Database: RefSeqSP
    Posted date:  Aug 1, 2006  7:14 PM
  Number of letters in database: 434,620
  Number of sequences in database:  1040
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 866,512
Number of Sequences: 1040
Number of extensions: 21652
Number of successful extensions: 125
Number of sequences better than 1.0e-05: 0
Number of HSP's better than  0.0 without gapping: 91
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 116
length of database: 434,620
effective HSP length: 77
effective length of database: 354,540
effective search space used: 89344080
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqHP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611C-000543
         (991 letters)

Database: RefSeqHP 
           39,411 sequences; 17,774,539 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_001825.1| clathrin, light polypeptide isoform a [Homo sap...   353   1e-97
Alignment   gi|NP_009028.1| clathrin, light polypeptide isoform b [Homo sap...   342   3e-94
Alignment   gi|NP_001824.1| clathrin, light polypeptide A isoform a [Homo s...   236   2e-62
Alignment   gi|NP_009027.1| clathrin, light polypeptide A isoform b [Homo s...   220   1e-57

>ref|NP_001825.1| clathrin, light polypeptide isoform a [Homo sapiens]
          Length = 211

 Score =  353 bits (906), Expect = 1e-97
 Identities = 182/211 (86%), Positives = 183/211 (86%), Gaps = 1/211 (0%)
 Frame = +2

Query: 218 MADDXXXXXXXXXXXXXXXXXXXXXXFLAQQESEIAGIENDEGFGAPAGSQAALAQPGLA 397
           MADD                      FLAQQESEIAGIENDEGFGAPAGS AA AQPG  
Sbjct: 1   MADDFGFFSSSESGAPEAAEEDPAAAFLAQQESEIAGIENDEGFGAPAGSHAAPAQPGPT 60

Query: 398 SG-GPEDMGTTVNGDVFQDANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAA 574
           SG G EDMGTTVNGDVFQ+ANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAA
Sbjct: 61  SGAGSEDMGTTVNGDVFQEANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAA 120

Query: 575 SKVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNRASEEAFVKESKEETPGTEWEKVAQL 754
           SKVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNRASEEAFVKESKEETPGTEWEKVAQL
Sbjct: 121 SKVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNRASEEAFVKESKEETPGTEWEKVAQL 180

Query: 755 CDFNPKSSKQCKDVSRLRSVLMSLKQTPLSR 847
           CDFNPKSSKQCKDVSRLRSVLMSLKQTPLSR
Sbjct: 181 CDFNPKSSKQCKDVSRLRSVLMSLKQTPLSR 211


>ref|NP_009028.1| clathrin, light polypeptide isoform b [Homo sapiens]
          Length = 229

 Score =  342 bits (877), Expect = 3e-94
 Identities = 182/229 (79%), Positives = 183/229 (79%), Gaps = 19/229 (8%)
 Frame = +2

Query: 218 MADDXXXXXXXXXXXXXXXXXXXXXXFLAQQESEIAGIENDEGFGAPAGSQAALAQPGLA 397
           MADD                      FLAQQESEIAGIENDEGFGAPAGS AA AQPG  
Sbjct: 1   MADDFGFFSSSESGAPEAAEEDPAAAFLAQQESEIAGIENDEGFGAPAGSHAAPAQPGPT 60

Query: 398 SG-GPEDMGTTVNGDVFQDANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAA 574
           SG G EDMGTTVNGDVFQ+ANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAA
Sbjct: 61  SGAGSEDMGTTVNGDVFQEANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAA 120

Query: 575 SKVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNR------------------ASEEAFV 700
           SKVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNR                  ASEEAFV
Sbjct: 121 SKVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNRIADKAFYQQPDADIIGYVASEEAFV 180

Query: 701 KESKEETPGTEWEKVAQLCDFNPKSSKQCKDVSRLRSVLMSLKQTPLSR 847
           KESKEETPGTEWEKVAQLCDFNPKSSKQCKDVSRLRSVLMSLKQTPLSR
Sbjct: 181 KESKEETPGTEWEKVAQLCDFNPKSSKQCKDVSRLRSVLMSLKQTPLSR 229


>ref|NP_001824.1| clathrin, light polypeptide A isoform a [Homo sapiens]
          Length = 218

 Score =  236 bits (602), Expect = 2e-62
 Identities = 116/182 (63%), Positives = 138/182 (75%)
 Frame = +2

Query: 296 FLAQQESEIAGIENDEGFGAPAGSQAALAQPGLASGGPEDMGTTVNGDVFQDANGPADGY 475
           FLAQQESEIAGIENDE F    G        G   GGP+ +   +NG+ +Q++NGP D Y
Sbjct: 35  FLAQQESEIAGIENDEAFAILDGGAPGPQPHGEPPGGPDAVDGVMNGEYYQESNGPTDSY 94

Query: 476 AAIAQADRLTQEPESIRKWREEQRKRLQELDAASKVTEQEWREKAKKDLEEWNQRQSEQV 655
           AAI+Q DRL  EPESIRKWREEQ +RL+ LDA S+  E EW+EKA K+LEEW  RQ EQ+
Sbjct: 95  AAISQVDRLQSEPESIRKWREEQMERLEALDANSRKQEAEWKEKAIKELEEWYARQDEQL 154

Query: 656 EKNKINNRASEEAFVKESKEETPGTEWEKVAQLCDFNPKSSKQCKDVSRLRSVLMSLKQT 835
           +K K NNRA+EEAFV +  E +PGTEWE+VA+LCDFNPKSSKQ KDVSR+RSVL+SLKQ 
Sbjct: 155 QKTKANNRAAEEAFVNDIDESSPGTEWERVARLCDFNPKSSKQAKDVSRMRSVLISLKQA 214

Query: 836 PL 841
           PL
Sbjct: 215 PL 216


>ref|NP_009027.1| clathrin, light polypeptide A isoform b [Homo sapiens]
          Length = 248

 Score =  220 bits (561), Expect = 1e-57
 Identities = 116/212 (54%), Positives = 138/212 (65%), Gaps = 30/212 (14%)
 Frame = +2

Query: 296 FLAQQESEIAGIENDEGFGAPAGSQAALAQPGLASGGPEDMGTTVNGDVFQDANGPADGY 475
           FLAQQESEIAGIENDE F    G        G   GGP+ +   +NG+ +Q++NGP D Y
Sbjct: 35  FLAQQESEIAGIENDEAFAILDGGAPGPQPHGEPPGGPDAVDGVMNGEYYQESNGPTDSY 94

Query: 476 AAIAQADRLTQEPESIRKWREEQRKRLQELDAASKVTEQEWREKAKKDLEEWNQRQSEQV 655
           AAI+Q DRL  EPESIRKWREEQ +RL+ LDA S+  E EW+EKA K+LEEW  RQ EQ+
Sbjct: 95  AAISQVDRLQSEPESIRKWREEQMERLEALDANSRKQEAEWKEKAIKELEEWYARQDEQL 154

Query: 656 EKNKINNR------------------------------ASEEAFVKESKEETPGTEWEKV 745
           +K K NNR                              A+EEAFV +  E +PGTEWE+V
Sbjct: 155 QKTKANNRVADEAFYKQPFADVIGYVTNINHPCYSLEQAAEEAFVNDIDESSPGTEWERV 214

Query: 746 AQLCDFNPKSSKQCKDVSRLRSVLMSLKQTPL 841
           A+LCDFNPKSSKQ KDVSR+RSVL+SLKQ PL
Sbjct: 215 ARLCDFNPKSSKQAKDVSRMRSVLISLKQAPL 246


  Database: RefSeqHP
    Posted date:  Aug 2, 2006 12:57 AM
  Number of letters in database: 17,774,539
  Number of sequences in database:  39,411
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 38,800,204
Number of Sequences: 39411
Number of extensions: 1090573
Number of successful extensions: 7904
Number of sequences better than 1.0e-05: 4
Number of HSP's better than  0.0 without gapping: 5165
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7706
length of database: 17,774,539
effective HSP length: 102
effective length of database: 13,754,617
effective search space used: 3122298059
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqCP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611C-000543
         (991 letters)

Database: RefSeqCP 
           33,732 sequences; 19,266,565 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|XP_866115.1| PREDICTED: similar to clathrin, light polypepti...   355   3e-98
Alignment   gi|XP_866083.1| PREDICTED: similar to clathrin, light polypepti...   345   4e-95
Alignment   gi|XP_546220.2| PREDICTED: similar to Clathrin light chain B (L...   344   7e-95
Alignment   gi|XP_866050.1| PREDICTED: similar to clathrin, light polypepti...   334   9e-92
Alignment   gi|XP_866066.1| PREDICTED: similar to clathrin, light polypepti...   328   4e-90
Alignment   gi|XP_866787.1| PREDICTED: similar to clathrin, light polypepti...   233   3e-61
Alignment   gi|XP_866825.1| PREDICTED: similar to Clathrin light chain A (L...   222   4e-58
Alignment   gi|XP_866761.1| PREDICTED: similar to Clathrin light chain A (L...   221   6e-58
Alignment   gi|XP_531996.2| PREDICTED: similar to Clathrin light chain A (L...   217   2e-56
Alignment   gi|XP_866835.1| PREDICTED: similar to clathrin, light polypepti...   192   4e-49

>ref|XP_866115.1| PREDICTED: similar to clathrin, light polypeptide isoform a isoform
           5 [Canis familiaris]
          Length = 211

 Score =  355 bits (912), Expect = 3e-98
 Identities = 182/211 (86%), Positives = 184/211 (87%), Gaps = 1/211 (0%)
 Frame = +2

Query: 218 MADDXXXXXXXXXXXXXXXXXXXXXXFLAQQESEIAGIENDEGFGAPAGSQAALAQPGLA 397
           MADD                      FLAQQESEIAGIENDEGFGAPAGS AALAQPG A
Sbjct: 1   MADDFGFFSSSESGAPEAAEEDPAAAFLAQQESEIAGIENDEGFGAPAGSHAALAQPGPA 60

Query: 398 SG-GPEDMGTTVNGDVFQDANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAA 574
            G G EDMGTT+NGDVFQ+ANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAA
Sbjct: 61  GGAGSEDMGTTINGDVFQEANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAA 120

Query: 575 SKVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNRASEEAFVKESKEETPGTEWEKVAQL 754
           SKVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNRASEEAFVKESKEETPGTEWEKVAQL
Sbjct: 121 SKVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNRASEEAFVKESKEETPGTEWEKVAQL 180

Query: 755 CDFNPKSSKQCKDVSRLRSVLMSLKQTPLSR 847
           CDFNPKSSKQCKDVSRLRSVLMSLKQTPLSR
Sbjct: 181 CDFNPKSSKQCKDVSRLRSVLMSLKQTPLSR 211


>ref|XP_866083.1| PREDICTED: similar to clathrin, light polypeptide isoform a isoform
           4 [Canis familiaris]
          Length = 213

 Score =  345 bits (885), Expect = 4e-95
 Identities = 177/213 (83%), Positives = 181/213 (84%), Gaps = 3/213 (1%)
 Frame = +2

Query: 218 MADDXXXXXXXXXXXXXXXXXXXXXXFLAQQESEIAGIENDEGFGAPAGSQAALAQPGL- 394
           MADD                      FLAQQESEIAGIENDEGFGAPAGS AALA     
Sbjct: 1   MADDFGFFSSSESGAPEAAEEDPAAAFLAQQESEIAGIENDEGFGAPAGSHAALAHASAC 60

Query: 395 --ASGGPEDMGTTVNGDVFQDANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELD 568
             ++ G EDMGTT+NGDVFQ+ANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELD
Sbjct: 61  PPSTAGSEDMGTTINGDVFQEANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELD 120

Query: 569 AASKVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNRASEEAFVKESKEETPGTEWEKVA 748
           AASKVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNRASEEAFVKESKEETPGTEWEKVA
Sbjct: 121 AASKVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNRASEEAFVKESKEETPGTEWEKVA 180

Query: 749 QLCDFNPKSSKQCKDVSRLRSVLMSLKQTPLSR 847
           QLCDFNPKSSKQCKDVSRLRSVLMSLKQTPLSR
Sbjct: 181 QLCDFNPKSSKQCKDVSRLRSVLMSLKQTPLSR 213


>ref|XP_546220.2| PREDICTED: similar to Clathrin light chain B (Lcb) isoform 1 [Canis
           familiaris]
          Length = 229

 Score =  344 bits (883), Expect = 7e-95
 Identities = 182/229 (79%), Positives = 184/229 (80%), Gaps = 19/229 (8%)
 Frame = +2

Query: 218 MADDXXXXXXXXXXXXXXXXXXXXXXFLAQQESEIAGIENDEGFGAPAGSQAALAQPGLA 397
           MADD                      FLAQQESEIAGIENDEGFGAPAGS AALAQPG A
Sbjct: 1   MADDFGFFSSSESGAPEAAEEDPAAAFLAQQESEIAGIENDEGFGAPAGSHAALAQPGPA 60

Query: 398 SG-GPEDMGTTVNGDVFQDANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAA 574
            G G EDMGTT+NGDVFQ+ANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAA
Sbjct: 61  GGAGSEDMGTTINGDVFQEANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAA 120

Query: 575 SKVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNR------------------ASEEAFV 700
           SKVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNR                  ASEEAFV
Sbjct: 121 SKVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNRIADKAFYQQPDADIIGYVASEEAFV 180

Query: 701 KESKEETPGTEWEKVAQLCDFNPKSSKQCKDVSRLRSVLMSLKQTPLSR 847
           KESKEETPGTEWEKVAQLCDFNPKSSKQCKDVSRLRSVLMSLKQTPLSR
Sbjct: 181 KESKEETPGTEWEKVAQLCDFNPKSSKQCKDVSRLRSVLMSLKQTPLSR 229


>ref|XP_866050.1| PREDICTED: similar to clathrin, light polypeptide isoform a isoform
           2 [Canis familiaris]
          Length = 208

 Score =  334 bits (856), Expect = 9e-92
 Identities = 172/210 (81%), Positives = 176/210 (83%)
 Frame = +2

Query: 218 MADDXXXXXXXXXXXXXXXXXXXXXXFLAQQESEIAGIENDEGFGAPAGSQAALAQPGLA 397
           MADD                      FLAQQESEIAGIENDEGFGAPAG+     + G  
Sbjct: 1   MADDFGFFSSSESGAPEAAEEDPAAAFLAQQESEIAGIENDEGFGAPAGNSGE--EEGPR 58

Query: 398 SGGPEDMGTTVNGDVFQDANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAAS 577
            G   DMGTT+NGDVFQ+ANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAAS
Sbjct: 59  YGPLGDMGTTINGDVFQEANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAAS 118

Query: 578 KVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNRASEEAFVKESKEETPGTEWEKVAQLC 757
           KVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNRASEEAFVKESKEETPGTEWEKVAQLC
Sbjct: 119 KVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNRASEEAFVKESKEETPGTEWEKVAQLC 178

Query: 758 DFNPKSSKQCKDVSRLRSVLMSLKQTPLSR 847
           DFNPKSSKQCKDVSRLRSVLMSLKQTPLSR
Sbjct: 179 DFNPKSSKQCKDVSRLRSVLMSLKQTPLSR 208


>ref|XP_866066.1| PREDICTED: similar to clathrin, light polypeptide isoform a isoform
           3 [Canis familiaris]
          Length = 207

 Score =  328 bits (842), Expect = 4e-90
 Identities = 170/210 (80%), Positives = 173/210 (82%)
 Frame = +2

Query: 218 MADDXXXXXXXXXXXXXXXXXXXXXXFLAQQESEIAGIENDEGFGAPAGSQAALAQPGLA 397
           MADD                      FLAQQESEIAGIENDEGFG   G         L+
Sbjct: 1   MADDFGFFSSSESGAPEAAEEDPAAAFLAQQESEIAGIENDEGFGLSNGYCHVFV---LS 57

Query: 398 SGGPEDMGTTVNGDVFQDANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAAS 577
             G EDMGTT+NGDVFQ+ANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAAS
Sbjct: 58  LAGSEDMGTTINGDVFQEANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAAS 117

Query: 578 KVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNRASEEAFVKESKEETPGTEWEKVAQLC 757
           KVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNRASEEAFVKESKEETPGTEWEKVAQLC
Sbjct: 118 KVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNRASEEAFVKESKEETPGTEWEKVAQLC 177

Query: 758 DFNPKSSKQCKDVSRLRSVLMSLKQTPLSR 847
           DFNPKSSKQCKDVSRLRSVLMSLKQTPLSR
Sbjct: 178 DFNPKSSKQCKDVSRLRSVLMSLKQTPLSR 207


>ref|XP_866787.1| PREDICTED: similar to clathrin, light polypeptide A isoform a
           isoform 3 [Canis familiaris]
          Length = 218

 Score =  233 bits (593), Expect = 3e-61
 Identities = 115/182 (63%), Positives = 137/182 (75%)
 Frame = +2

Query: 296 FLAQQESEIAGIENDEGFGAPAGSQAALAQPGLASGGPEDMGTTVNGDVFQDANGPADGY 475
           FLAQQESEIAGIENDE F    G        G   G P+ +   +NG+ +Q++NGP D Y
Sbjct: 35  FLAQQESEIAGIENDEAFAILDGGAPGPQPHGEPPGVPDAVDGVMNGEYYQESNGPTDSY 94

Query: 476 AAIAQADRLTQEPESIRKWREEQRKRLQELDAASKVTEQEWREKAKKDLEEWNQRQSEQV 655
           AAI+Q DRL  EPESIRKWREEQ +RL+ LDA S+  E EW+EKA K+LEEW  RQ EQ+
Sbjct: 95  AAISQVDRLQSEPESIRKWREEQTERLEALDANSRKQEAEWKEKAIKELEEWYARQDEQL 154

Query: 656 EKNKINNRASEEAFVKESKEETPGTEWEKVAQLCDFNPKSSKQCKDVSRLRSVLMSLKQT 835
           +K K NNRA+EEAFV +  E +PGTEWE+VA+LCDFNPKSSKQ KDVSR+RSVL+SLKQ 
Sbjct: 155 QKTKANNRAAEEAFVNDIDESSPGTEWERVARLCDFNPKSSKQAKDVSRMRSVLISLKQA 214

Query: 836 PL 841
           PL
Sbjct: 215 PL 216


>ref|XP_866825.1| PREDICTED: similar to Clathrin light chain A (Lca) isoform 6 [Canis
           familiaris]
          Length = 230

 Score =  222 bits (566), Expect = 4e-58
 Identities = 114/194 (58%), Positives = 137/194 (70%), Gaps = 12/194 (6%)
 Frame = +2

Query: 296 FLAQQESEIAGIENDEGFGAPAGSQAALAQPGLASGGPEDMGTTVNGDVFQDANGPADGY 475
           FLAQQESEIAGIENDE F    G        G   G P+ +   +NG+ +Q++NGP D Y
Sbjct: 35  FLAQQESEIAGIENDEAFAILDGGAPGPQPHGEPPGVPDAVDGVMNGEYYQESNGPTDSY 94

Query: 476 AAIAQADRLTQEPESIRKWREEQRKRLQELDAASKVTEQEWREKAKKDLEEWNQRQSEQV 655
           AAI+Q DRL  EPESIRKWREEQ +RL+ LDA S+  E EW+EKA K+LEEW  RQ EQ+
Sbjct: 95  AAISQVDRLQSEPESIRKWREEQTERLEALDANSRKQEAEWKEKAIKELEEWYARQDEQL 154

Query: 656 EKNKINN------------RASEEAFVKESKEETPGTEWEKVAQLCDFNPKSSKQCKDVS 799
           +K K NN            +A+EEAFV +  E +PGTEWE+VA+LCDFNPKSSKQ KDVS
Sbjct: 155 QKTKANNSTNINHPCYSLEQAAEEAFVNDIDESSPGTEWERVARLCDFNPKSSKQAKDVS 214

Query: 800 RLRSVLMSLKQTPL 841
           R+RSVL+SLKQ PL
Sbjct: 215 RMRSVLISLKQAPL 228


>ref|XP_866761.1| PREDICTED: similar to Clathrin light chain A (Lca) isoform 2 [Canis
           familiaris]
          Length = 236

 Score =  221 bits (564), Expect = 6e-58
 Identities = 115/200 (57%), Positives = 137/200 (68%), Gaps = 18/200 (9%)
 Frame = +2

Query: 296 FLAQQESEIAGIENDEGFGAPAGSQAALAQPGLASGGPEDMGTTVNGDVFQDANGPADGY 475
           FLAQQESEIAGIENDE F    G        G   G P+ +   +NG+ +Q++NGP D Y
Sbjct: 35  FLAQQESEIAGIENDEAFAILDGGAPGPQPHGEPPGVPDAVDGVMNGEYYQESNGPTDSY 94

Query: 476 AAIAQADRLTQEPESIRKWREEQRKRLQELDAASKVTEQEWREKAKKDLEEWNQRQSEQV 655
           AAI+Q DRL  EPESIRKWREEQ +RL+ LDA S+  E EW+EKA K+LEEW  RQ EQ+
Sbjct: 95  AAISQVDRLQSEPESIRKWREEQTERLEALDANSRKQEAEWKEKAIKELEEWYARQDEQL 154

Query: 656 EKNKINNR------------------ASEEAFVKESKEETPGTEWEKVAQLCDFNPKSSK 781
           +K K NNR                  A+EEAFV +  E +PGTEWE+VA+LCDFNPKSSK
Sbjct: 155 QKTKANNRVADEAFYKQPFADVIGYVAAEEAFVNDIDESSPGTEWERVARLCDFNPKSSK 214

Query: 782 QCKDVSRLRSVLMSLKQTPL 841
           Q KDVSR+RSVL+SLKQ PL
Sbjct: 215 QAKDVSRMRSVLISLKQAPL 234


>ref|XP_531996.2| PREDICTED: similar to Clathrin light chain A (Lca) isoform 1 [Canis
           familiaris]
          Length = 248

 Score =  217 bits (552), Expect = 2e-56
 Identities = 115/212 (54%), Positives = 137/212 (64%), Gaps = 30/212 (14%)
 Frame = +2

Query: 296 FLAQQESEIAGIENDEGFGAPAGSQAALAQPGLASGGPEDMGTTVNGDVFQDANGPADGY 475
           FLAQQESEIAGIENDE F    G        G   G P+ +   +NG+ +Q++NGP D Y
Sbjct: 35  FLAQQESEIAGIENDEAFAILDGGAPGPQPHGEPPGVPDAVDGVMNGEYYQESNGPTDSY 94

Query: 476 AAIAQADRLTQEPESIRKWREEQRKRLQELDAASKVTEQEWREKAKKDLEEWNQRQSEQV 655
           AAI+Q DRL  EPESIRKWREEQ +RL+ LDA S+  E EW+EKA K+LEEW  RQ EQ+
Sbjct: 95  AAISQVDRLQSEPESIRKWREEQTERLEALDANSRKQEAEWKEKAIKELEEWYARQDEQL 154

Query: 656 EKNKINNR------------------------------ASEEAFVKESKEETPGTEWEKV 745
           +K K NNR                              A+EEAFV +  E +PGTEWE+V
Sbjct: 155 QKTKANNRVADEAFYKQPFADVIGYVTNINHPCYSLEQAAEEAFVNDIDESSPGTEWERV 214

Query: 746 AQLCDFNPKSSKQCKDVSRLRSVLMSLKQTPL 841
           A+LCDFNPKSSKQ KDVSR+RSVL+SLKQ PL
Sbjct: 215 ARLCDFNPKSSKQAKDVSRMRSVLISLKQAPL 246


>ref|XP_866835.1| PREDICTED: similar to clathrin, light polypeptide A isoform a
           isoform 7 [Canis familiaris]
          Length = 139

 Score =  192 bits (488), Expect = 4e-49
 Identities = 91/132 (68%), Positives = 109/132 (82%)
 Frame = +2

Query: 446 QDANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAASKVTEQEWREKAKKDLE 625
           +++NGP D YAAI+Q DRL  EPESIRKWREEQ +RL+ LDA S+  E EW+EKA K+LE
Sbjct: 6   RESNGPTDSYAAISQVDRLQSEPESIRKWREEQTERLEALDANSRKQEAEWKEKAIKELE 65

Query: 626 EWNQRQSEQVEKNKINNRASEEAFVKESKEETPGTEWEKVAQLCDFNPKSSKQCKDVSRL 805
           EW  RQ EQ++K K NNRA+EEAFV +  E +PGTEWE+VA+LCDFNPKSSKQ KDVSR+
Sbjct: 66  EWYARQDEQLQKTKANNRAAEEAFVNDIDESSPGTEWERVARLCDFNPKSSKQAKDVSRM 125

Query: 806 RSVLMSLKQTPL 841
           RSVL+SLKQ PL
Sbjct: 126 RSVLISLKQAPL 137


  Database: RefSeqCP
    Posted date:  Aug 1, 2006  9:25 PM
  Number of letters in database: 19,266,565
  Number of sequences in database:  33,732
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 39,626,790
Number of Sequences: 33732
Number of extensions: 1068321
Number of successful extensions: 7770
Number of sequences better than 1.0e-05: 10
Number of HSP's better than  0.0 without gapping: 5378
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7514
length of database: 19,266,565
effective HSP length: 103
effective length of database: 15,792,169
effective search space used: 3569030194
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqMP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611C-000543
         (991 letters)

Database: RefSeqMP 
           45,328 sequences; 21,768,885 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_083146.1| clathrin, light polypeptide (Lcb) [Mus musculus]     348   4e-96
Alignment   gi|NP_058040.1| clathrin, light polypeptide (Lca) [Mus musculus]     218   6e-57

>ref|NP_083146.1| clathrin, light polypeptide (Lcb) [Mus musculus]
          Length = 211

 Score =  348 bits (894), Expect = 4e-96
 Identities = 179/211 (84%), Positives = 182/211 (86%), Gaps = 1/211 (0%)
 Frame = +2

Query: 218 MADDXXXXXXXXXXXXXXXXXXXXXXFLAQQESEIAGIENDEGFGAPAGSQAALAQPGLA 397
           MA+D                      FLAQQESEIAGIEND GFGAPA SQ A AQPGLA
Sbjct: 1   MAEDFGFFSSSESGAPEAAEEDPAAAFLAQQESEIAGIENDPGFGAPAASQVASAQPGLA 60

Query: 398 SG-GPEDMGTTVNGDVFQDANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAA 574
           SG G EDM TTVNGDVFQ+ANGPADGYAAIAQADRLTQEPESIRKWREEQ+KRLQELDAA
Sbjct: 61  SGAGSEDMSTTVNGDVFQEANGPADGYAAIAQADRLTQEPESIRKWREEQKKRLQELDAA 120

Query: 575 SKVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNRASEEAFVKESKEETPGTEWEKVAQL 754
           SKVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNRASEEAFVKESKEETPGTEWEKVAQL
Sbjct: 121 SKVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNRASEEAFVKESKEETPGTEWEKVAQL 180

Query: 755 CDFNPKSSKQCKDVSRLRSVLMSLKQTPLSR 847
           CDFNPKSSKQCKDVSRLRSVLMSLKQTPLSR
Sbjct: 181 CDFNPKSSKQCKDVSRLRSVLMSLKQTPLSR 211


>ref|NP_058040.1| clathrin, light polypeptide (Lca) [Mus musculus]
          Length = 235

 Score =  218 bits (556), Expect = 6e-57
 Identities = 114/200 (57%), Positives = 137/200 (68%), Gaps = 18/200 (9%)
 Frame = +2

Query: 296 FLAQQESEIAGIENDEGFGAPAGSQAALAQPGLASGGPEDMGTTVNGDVFQDANGPADGY 475
           FLA +ESEIAGIENDE F    G     A    A GGP+ +   +NG+ +Q++NGP D Y
Sbjct: 35  FLAHEESEIAGIENDEAFAILDGGAPGRATRR-AGGGPDAVDGVMNGEYYQESNGPTDSY 93

Query: 476 AAIAQADRLTQEPESIRKWREEQRKRLQELDAASKVTEQEWREKAKKDLEEWNQRQSEQV 655
           AAI++ DRL  EPESIRKWREEQ +RL+ LDA S+  E EW+EKA K+LEEW  RQ EQ+
Sbjct: 94  AAISEVDRLQSEPESIRKWREEQTERLEALDANSRKQEAEWKEKAIKELEEWYARQDEQL 153

Query: 656 EKNKINNRASEEAFVKES------------------KEETPGTEWEKVAQLCDFNPKSSK 781
           +K K NNRA+EEAF K+                    E +PGTEWE+VA LCDFNPKSSK
Sbjct: 154 QKTKANNRAAEEAFYKQPFADVIGYVAAEEAFVNDIDESSPGTEWERVAPLCDFNPKSSK 213

Query: 782 QCKDVSRLRSVLMSLKQTPL 841
           Q KDVSR+RSVL+SLKQ PL
Sbjct: 214 QAKDVSRMRSVLISLKQAPL 233


  Database: RefSeqMP
    Posted date:  Aug 2, 2006 12:58 AM
  Number of letters in database: 21,768,885
  Number of sequences in database:  45,328
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 44,689,168
Number of Sequences: 45328
Number of extensions: 1183126
Number of successful extensions: 9685
Number of sequences better than 1.0e-05: 2
Number of HSP's better than  0.0 without gapping: 5847
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 8480
length of database: 21,768,885
effective HSP length: 104
effective length of database: 17,054,773
effective search space used: 3837323925
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)