Animal-Genome cDNA 20060611C-000822


Search to RefSeqSP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611C-000822
         (1000 letters)

Database: RefSeqSP 
           1040 sequences; 434,620 total letters

Searching...done

 ***** No hits found ******

  Database: RefSeqSP
    Posted date:  Aug 1, 2006  7:14 PM
  Number of letters in database: 434,620
  Number of sequences in database:  1040
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 981,411
Number of Sequences: 1040
Number of extensions: 26057
Number of successful extensions: 111
Number of sequences better than 1.0e-05: 0
Number of HSP's better than  0.0 without gapping: 91
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 110
length of database: 434,620
effective HSP length: 77
effective length of database: 354,540
effective search space used: 90407700
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqBP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611C-000822
         (1000 letters)

Database: RefSeqBP 
           33,508 sequences; 16,112,626 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|XP_612082.2| PREDICTED: similar to LanC-like protein 1 (40 k...   375   e-107
Alignment   gi|XP_614740.2| PREDICTED: similar to LanC-like protein 2 (Test...   181   1e-48

>ref|XP_612082.2| PREDICTED: similar to LanC-like protein 1 (40 kDa erythrocyte
           membrane protein) (p40) [Bos taurus]
          Length = 399

 Score =  375 bits (962), Expect(2) = e-107
 Identities = 182/204 (89%), Positives = 190/204 (93%)
 Frame = +3

Query: 318 MAQRAFPNPYADFNKSLAEGYFDSAGRLTPEFSQRVNNKIRELLQQMERGLKSADPRDGT 497
           MAQRAFPNPYAD+NKSLAEGYFDSAGRLTPEFSQR+NNKIRELLQQMERGLKSADPRD T
Sbjct: 1   MAQRAFPNPYADYNKSLAEGYFDSAGRLTPEFSQRLNNKIRELLQQMERGLKSADPRDST 60

Query: 498 AYTGWAGIAVLYLHLYDVFGDPAYLQMAHGYAKQSLNCLTKRSITFLCGDAGPLAVAAVV 677
            YTGWAGIAVLYLHLYDVFGDP YLQMAHGY KQSLN L+K SITFLCGD GPLAVAAVV
Sbjct: 61  VYTGWAGIAVLYLHLYDVFGDPNYLQMAHGYVKQSLNSLSKHSITFLCGDGGPLAVAAVV 120

Query: 678 HDKMNNEKQAEDCITRLIHLNKIDPHAPNEMLYGRMGYIYALLFVNKNFGVEKIPRSHIQ 857
           H KMNNEKQAE+CITRLIHLNKIDPHAP+EMLYGRMGYI ALLFVNKNFG EKIP+SHIQ
Sbjct: 121 HHKMNNEKQAEECITRLIHLNKIDPHAPSEMLYGRMGYISALLFVNKNFGEEKIPQSHIQ 180

Query: 858 QICETVLTSGENLARKKNFQKKLP 929
           QICETVLTSGE+LARK+ F  K P
Sbjct: 181 QICETVLTSGEDLARKRRFTGKTP 204



 Score = 33.5 bits (75), Expect(2) = e-107
 Identities = 15/18 (83%), Positives = 16/18 (88%)
 Frame = +1

Query: 946 QKNYVGAALGLAGIYYYL 999
           Q+ YVGAA GLAGIYYYL
Sbjct: 211 QEYYVGAAHGLAGIYYYL 228


>ref|XP_614740.2| PREDICTED: similar to LanC-like protein 2 (Testis-specific
           adriamycin sensitivity protein), partial [Bos taurus]
          Length = 331

 Score =  181 bits (460), Expect(2) = 1e-48
 Identities = 93/226 (41%), Positives = 139/226 (61%), Gaps = 22/226 (9%)
 Frame = +3

Query: 318 MAQRAFPNPYADFNKSLAEGY------------------FDSAGRLTPEFSQRVNNKIRE 443
           M  RAFPNP+ D+  +                       F S G++   F++R+  KI++
Sbjct: 19  MEDRAFPNPFPDYEAAAERQAEEPPCSRTPLSPEELGLPFHSDGKIINNFTRRIQTKIKD 78

Query: 444 LLQQMERGLKSADPRDGTAYTGWAGIAVLYLHLYDVFGDPAYLQMAHGYAKQSLNCLTKR 623
           LLQQME GLK+ADP D +AYTGW GIA+LYL LY V  D +YL  +  Y K++L  L  R
Sbjct: 79  LLQQMEEGLKTADPHDCSAYTGWTGIALLYLQLYRVTCDQSYLLRSLDYVKRTLRNLNGR 138

Query: 624 SITFLCGDAGPLAVAAVVHDKMNNEKQAEDCITRLIHLNKI----DPHAPNEMLYGRMGY 791
            +TFLCGDAGPLAV AVV+ K+ ++ ++++CIT+L+ L +     D   P+E+LYGR GY
Sbjct: 139 RVTFLCGDAGPLAVGAVVYHKLKSDCESQECITKLLQLQRTIVCRDSDLPDELLYGRAGY 198

Query: 792 IYALLFVNKNFGVEKIPRSHIQQICETVLTSGENLARKKNFQKKLP 929
           +YALL+VN   G   +  S I+++   ++ SG+ L++++   ++ P
Sbjct: 199 LYALLYVNTEIGPGAVCESAIKEVVNAIIESGKALSKEEKKVERCP 244



 Score = 30.4 bits (67), Expect(2) = 1e-48
 Identities = 13/18 (72%), Positives = 15/18 (83%)
 Frame = +1

Query: 946 QKNYVGAALGLAGIYYYL 999
           +K YVGAA G+AGIYY L
Sbjct: 251 RKQYVGAAHGMAGIYYML 268


  Database: RefSeqBP
    Posted date:  Aug 1, 2006  7:14 PM
  Number of letters in database: 16,112,626
  Number of sequences in database:  33,508
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 36,589,156
Number of Sequences: 33508
Number of extensions: 1001402
Number of successful extensions: 3654
Number of sequences better than 1.0e-05: 2
Number of HSP's better than  0.0 without gapping: 3135
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3626
length of database: 16,112,626
effective HSP length: 102
effective length of database: 12,694,810
effective search space used: 2919806300
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqHP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611C-000822
         (1000 letters)

Database: RefSeqHP 
           39,411 sequences; 17,774,539 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_006046.1| lanthionine synthetase C-like protein 1 [Homo s...   392   e-112
Alignment   gi|NP_061167.1| LanC lantibiotic synthetase component C-like 2 ...   175   1e-46
Alignment   gi|NP_940913.1| LanC lantibiotic synthetase component C-like 3 ...    52   6e-07

>ref|NP_006046.1| lanthionine synthetase C-like protein 1 [Homo sapiens]
          Length = 399

 Score =  392 bits (1006), Expect(2) = e-112
 Identities = 187/204 (91%), Positives = 197/204 (96%)
 Frame = +3

Query: 318 MAQRAFPNPYADFNKSLAEGYFDSAGRLTPEFSQRVNNKIRELLQQMERGLKSADPRDGT 497
           MAQRAFPNPYAD+NKSLAEGYFD+AGRLTPEFSQR+ NKIRELLQQMERGLKSADPRDGT
Sbjct: 1   MAQRAFPNPYADYNKSLAEGYFDAAGRLTPEFSQRLTNKIRELLQQMERGLKSADPRDGT 60

Query: 498 AYTGWAGIAVLYLHLYDVFGDPAYLQMAHGYAKQSLNCLTKRSITFLCGDAGPLAVAAVV 677
            YTGWAGIAVLYLHLYDVFGDPAYLQ+AHGY KQSLNCLTKRSITFLCGDAGPLAVAAV+
Sbjct: 61  GYTGWAGIAVLYLHLYDVFGDPAYLQLAHGYVKQSLNCLTKRSITFLCGDAGPLAVAAVL 120

Query: 678 HDKMNNEKQAEDCITRLIHLNKIDPHAPNEMLYGRMGYIYALLFVNKNFGVEKIPRSHIQ 857
           + KMNNEKQAEDCITRLIHLNKIDPHAPNEMLYGR+GYIYALLFVNKNFGVEKIP+SHIQ
Sbjct: 121 YHKMNNEKQAEDCITRLIHLNKIDPHAPNEMLYGRIGYIYALLFVNKNFGVEKIPQSHIQ 180

Query: 858 QICETVLTSGENLARKKNFQKKLP 929
           QICET+LTSGENLARK+NF  K P
Sbjct: 181 QICETILTSGENLARKRNFTAKSP 204



 Score = 33.5 bits (75), Expect(2) = e-112
 Identities = 15/18 (83%), Positives = 16/18 (88%)
 Frame = +1

Query: 946 QKNYVGAALGLAGIYYYL 999
           Q+ YVGAA GLAGIYYYL
Sbjct: 211 QEYYVGAAHGLAGIYYYL 228


>ref|NP_061167.1| LanC lantibiotic synthetase component C-like 2 [Homo sapiens]
          Length = 450

 Score =  175 bits (443), Expect(2) = 1e-46
 Identities = 91/231 (39%), Positives = 139/231 (60%), Gaps = 27/231 (11%)
 Frame = +3

Query: 318 MAQRAFPNPYADFNKS----LAEGYFDSAGRLTP-------------------EFSQRVN 428
           M +RAF NP+ D+  +    LA G  +  G + P                    F +R+ 
Sbjct: 19  MEERAFVNPFPDYEAAAGALLASGAAEETGCVRPPATTDEPGLPFHQDGKIIHNFIRRIQ 78

Query: 429 NKIRELLQQMERGLKSADPRDGTAYTGWAGIAVLYLHLYDVFGDPAYLQMAHGYAKQSLN 608
            KI++LLQQME GLK+ADP D +AYTGW GIA+LYL LY V  D  YL  +  Y K++L 
Sbjct: 79  TKIKDLLQQMEEGLKTADPHDCSAYTGWTGIALLYLQLYRVTCDQTYLLRSLDYVKRTLR 138

Query: 609 CLTKRSITFLCGDAGPLAVAAVVHDKMNNEKQAEDCITRLIHLNKI----DPHAPNEMLY 776
            L  R +TFLCGDAGPLAV AV++ K+ ++ ++++C+T+L+ L +     +   P+E+LY
Sbjct: 139 NLNGRRVTFLCGDAGPLAVGAVIYHKLRSDCESQECVTKLLQLQRSVVCQESDLPDELLY 198

Query: 777 GRMGYIYALLFVNKNFGVEKIPRSHIQQICETVLTSGENLARKKNFQKKLP 929
           GR GY+YALL++N   G   +  S I+++   ++ SG+ L+R++   ++ P
Sbjct: 199 GRAGYLYALLYLNTEIGPGTVCESAIKEVVNAIIESGKTLSREERKTERCP 249



 Score = 30.4 bits (67), Expect(2) = 1e-46
 Identities = 13/18 (72%), Positives = 15/18 (83%)
 Frame = +1

Query: 946 QKNYVGAALGLAGIYYYL 999
           +K YVGAA G+AGIYY L
Sbjct: 256 RKQYVGAAHGMAGIYYML 273


>ref|NP_940913.1| LanC lantibiotic synthetase component C-like 3 [Homo sapiens]
          Length = 388

 Score = 52.4 bits (124), Expect = 6e-07
 Identities = 55/225 (24%), Positives = 88/225 (39%), Gaps = 27/225 (12%)
 Frame = +3

Query: 315 MMAQRAFPNPYADFNKSLAEGYFDSAGRLTPEFSQRVNNKIRELLQQMERGLKSADPRDG 494
           M  +R F N + D+  SL  G  + A       +  V   I  +LQ++      A+ R  
Sbjct: 1   MDTKRCFANRFDDYQGSLLAGQCEEA------VAPLVTATIERILQELPPLGGGAEARGA 54

Query: 495 TA---------YTGWAGIAVLYLHLYDVFGDPAYLQMAHGY---AKQSLNCLTKRS---- 626
           TA         Y G AG+A +   LY V   P +      Y   AK+ ++   +      
Sbjct: 55  TAGASACQGGLYGGVAGVAYM---LYHVSQSPLFATARERYLRSAKRLIDACARAEEWGE 111

Query: 627 ------ITFLCGDAGPLAVAAVVHDKMNNEKQAED-----CITRLIHLNKIDPHAPNEML 773
                   FL G AG  AVA +V+  +      +       +  +           +E+ 
Sbjct: 112 PDADTRAAFLLGGAGVYAVATLVYHALGRSDYVQPLGKFRALCAVCAPVSFLECGSDELF 171

Query: 774 YGRMGYIYALLFVNKNFGVEKIPRSHIQQICETVLTSGENLARKK 908
            GR GY+ A L + +    E +  + I+ IC+ +L SG+  A KK
Sbjct: 172 VGRAGYLCAALVLKQKLAQEVLTPAQIKSICQAILDSGKQYAIKK 216


  Database: RefSeqHP
    Posted date:  Aug 2, 2006 12:57 AM
  Number of letters in database: 17,774,539
  Number of sequences in database:  39,411
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 41,574,402
Number of Sequences: 39411
Number of extensions: 1188027
Number of successful extensions: 4936
Number of sequences better than 1.0e-05: 3
Number of HSP's better than  0.0 without gapping: 3932
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4916
length of database: 17,774,539
effective HSP length: 102
effective length of database: 13,754,617
effective search space used: 3163561910
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqCP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611C-000822
         (1000 letters)

Database: RefSeqCP 
           33,732 sequences; 19,266,565 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|XP_536055.1| PREDICTED: similar to LanC-like protein 1 (40 k...   380   e-108
Alignment   gi|XP_540359.2| PREDICTED: similar to LanC-like protein 2 (Test...   172   1e-45
Alignment   gi|XP_548943.2| PREDICTED: similar to LanC lantibiotic syntheta...    52   9e-07

>ref|XP_536055.1| PREDICTED: similar to LanC-like protein 1 (40 kDa erythrocyte
           membrane protein) (p40) [Canis familiaris]
          Length = 399

 Score =  380 bits (976), Expect(2) = e-108
 Identities = 183/204 (89%), Positives = 191/204 (93%)
 Frame = +3

Query: 318 MAQRAFPNPYADFNKSLAEGYFDSAGRLTPEFSQRVNNKIRELLQQMERGLKSADPRDGT 497
           MAQRAFPNPYADFNKSLAE YFD AGRLTPEFSQR+NNKIRELLQQMERGLKSADPRD T
Sbjct: 1   MAQRAFPNPYADFNKSLAESYFDCAGRLTPEFSQRLNNKIRELLQQMERGLKSADPRDST 60

Query: 498 AYTGWAGIAVLYLHLYDVFGDPAYLQMAHGYAKQSLNCLTKRSITFLCGDAGPLAVAAVV 677
            YTGWAGIA+LYLHLYDVFGDPAYLQMAHGY KQSLN LTKRSITFLCGDAGPLA+ AVV
Sbjct: 61  VYTGWAGIALLYLHLYDVFGDPAYLQMAHGYVKQSLNSLTKRSITFLCGDAGPLAIGAVV 120

Query: 678 HDKMNNEKQAEDCITRLIHLNKIDPHAPNEMLYGRMGYIYALLFVNKNFGVEKIPRSHIQ 857
           + KMNNEKQAEDCITRLIHLNKID HAPNEMLYGRMGY+YALLFVNKNFGVEKIP+SHIQ
Sbjct: 121 YHKMNNEKQAEDCITRLIHLNKIDHHAPNEMLYGRMGYVYALLFVNKNFGVEKIPQSHIQ 180

Query: 858 QICETVLTSGENLARKKNFQKKLP 929
           QICE VLTSGENLA+K+NF  K P
Sbjct: 181 QICEAVLTSGENLAQKRNFTAKTP 204



 Score = 30.4 bits (67), Expect(2) = e-108
 Identities = 14/18 (77%), Positives = 15/18 (83%)
 Frame = +1

Query: 946 QKNYVGAALGLAGIYYYL 999
           Q+ YVGAA GLAGIYY L
Sbjct: 211 QEYYVGAAHGLAGIYYLL 228


>ref|XP_540359.2| PREDICTED: similar to LanC-like protein 2 (Testis-specific
           adriamycin sensitivity protein) [Canis familiaris]
          Length = 452

 Score =  172 bits (435), Expect(2) = 1e-45
 Identities = 83/182 (45%), Positives = 124/182 (68%), Gaps = 4/182 (2%)
 Frame = +3

Query: 396 RLTPEFSQRVNNKIRELLQQMERGLKSADPRDGTAYTGWAGIAVLYLHLYDVFGDPAYLQ 575
           R+   F++R+  KI++LLQQME GLK+ADP D +AYTGW GIA+LYL LY V  D  YL 
Sbjct: 67  RIVQNFTKRIQTKIKDLLQQMEEGLKTADPHDCSAYTGWTGIALLYLQLYRVTCDQTYLL 126

Query: 576 MAHGYAKQSLNCLTKRSITFLCGDAGPLAVAAVVHDKMNNEKQAEDCITRLIHLNKI--- 746
            +  Y K++L  L  R +TFLCGDAGPLAV AVV+ K+ ++ ++++CIT+L+ L +    
Sbjct: 127 RSLDYVKRTLRNLNGRRVTFLCGDAGPLAVGAVVYHKLKSDCESQECITKLLQLQRTIVC 186

Query: 747 -DPHAPNEMLYGRMGYIYALLFVNKNFGVEKIPRSHIQQICETVLTSGENLARKKNFQKK 923
            D   P+E+LYGR GY+YALL++N   G   +  S I+++   ++ SG+ L+R++   ++
Sbjct: 187 RDSDLPDELLYGRAGYLYALLYLNTEIGPGTVCESAIKEVVCAIIESGKTLSREERKAER 246

Query: 924 LP 929
            P
Sbjct: 247 CP 248



 Score = 30.4 bits (67), Expect(2) = 1e-45
 Identities = 13/18 (72%), Positives = 15/18 (83%)
 Frame = +1

Query: 946 QKNYVGAALGLAGIYYYL 999
           +K YVGAA G+AGIYY L
Sbjct: 255 RKQYVGAAHGMAGIYYML 272


>ref|XP_548943.2| PREDICTED: similar to LanC lantibiotic synthetase component C-like
           3 [Canis familiaris]
          Length = 420

 Score = 52.0 bits (123), Expect = 9e-07
 Identities = 52/221 (23%), Positives = 87/221 (39%), Gaps = 23/221 (10%)
 Frame = +3

Query: 315 MMAQRAFPNPYADFNKSLAEGYFDSAGRLTPEFSQRVNNKIRELLQ-----QMERGLKSA 479
           M  +R F N + D+  SL  G  + A  + P  +  +   ++EL       +      +A
Sbjct: 1   MDTKRCFANRFDDYQGSLLAGQCEEA--VAPLVTATIERILQELPPLGGGAEARGAAAAA 58

Query: 480 DPRDGTAYTGWAGIAVLYLHLYDVFGDPAYLQMAHGY---AKQSLNCLTKRS-------- 626
               G  Y G AG+A +   LY V   P +      Y   AK+ ++   +          
Sbjct: 59  SSCQGGLYGGVAGVAYM---LYHVSQSPLFAGARERYLRSAKRLIDACARAEEWGEPDAD 115

Query: 627 --ITFLCGDAGPLAVAAVVHDKMNNEKQAED-----CITRLIHLNKIDPHAPNEMLYGRM 785
               FL G AG  AVA +V+  +      +       +  +           +E+  GR 
Sbjct: 116 TRAAFLLGGAGVYAVATLVYHALGRSDYVQPLGKFRALCAVCAPVSFLECGSDELFVGRA 175

Query: 786 GYIYALLFVNKNFGVEKIPRSHIQQICETVLTSGENLARKK 908
           GY+ A L + +    E +  + I+ IC+ +L SG+  A KK
Sbjct: 176 GYLCAALVLKQKLAQEVLTPAQIKSICQAILDSGKQYAMKK 216


  Database: RefSeqCP
    Posted date:  Aug 1, 2006  9:25 PM
  Number of letters in database: 19,266,565
  Number of sequences in database:  33,732
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 42,910,411
Number of Sequences: 33732
Number of extensions: 1179290
Number of successful extensions: 4615
Number of sequences better than 1.0e-05: 3
Number of HSP's better than  0.0 without gapping: 3853
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4598
length of database: 19,266,565
effective HSP length: 103
effective length of database: 15,792,169
effective search space used: 3616406701
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqMP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611C-000822
         (1000 letters)

Database: RefSeqMP 
           45,328 sequences; 21,768,885 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_067270.1| LanC (bacterial lantibiotic synthetase componen...   365   e-104
Alignment   gi|NP_598498.1| LanC (bacterial lantibiotic synthetase componen...   186   8e-50
Alignment   gi|XP_984245.1| PREDICTED: similar to LanC (bacterial lantibiot...   186   8e-50
Alignment   gi|NP_775590.1| LanC lantibiotic synthetase component C-like 3 ...    53   6e-07

>ref|NP_067270.1| LanC (bacterial lantibiotic synthetase component C)-like 1 [Mus
           musculus]
          Length = 399

 Score =  365 bits (937), Expect(2) = e-104
 Identities = 173/204 (84%), Positives = 189/204 (92%)
 Frame = +3

Query: 318 MAQRAFPNPYADFNKSLAEGYFDSAGRLTPEFSQRVNNKIRELLQQMERGLKSADPRDGT 497
           MAQRAFPNPYAD+NKSLAE YFDS GRLTPEFS R+ NKIRELLQQMERGLKSADPRDGT
Sbjct: 1   MAQRAFPNPYADYNKSLAENYFDSTGRLTPEFSHRLTNKIRELLQQMERGLKSADPRDGT 60

Query: 498 AYTGWAGIAVLYLHLYDVFGDPAYLQMAHGYAKQSLNCLTKRSITFLCGDAGPLAVAAVV 677
            YTGWAGIAVLYLHL++VFGDPAYLQMAH Y KQSLNCL++RSITFLCGDAGPLAVAAV+
Sbjct: 61  GYTGWAGIAVLYLHLHNVFGDPAYLQMAHSYVKQSLNCLSRRSITFLCGDAGPLAVAAVL 120

Query: 678 HDKMNNEKQAEDCITRLIHLNKIDPHAPNEMLYGRMGYIYALLFVNKNFGVEKIPRSHIQ 857
           + KMN+EKQAE+CITRLIHLNKIDPH PNEMLYGR+GYI+ALLFVNKNFG EKIP+SHIQ
Sbjct: 121 YHKMNSEKQAEECITRLIHLNKIDPHVPNEMLYGRIGYIFALLFVNKNFGEEKIPQSHIQ 180

Query: 858 QICETVLTSGENLARKKNFQKKLP 929
           QICE +LTSGENL+RK+N   K P
Sbjct: 181 QICENILTSGENLSRKRNLAAKSP 204



 Score = 33.5 bits (75), Expect(2) = e-104
 Identities = 15/18 (83%), Positives = 16/18 (88%)
 Frame = +1

Query: 946 QKNYVGAALGLAGIYYYL 999
           Q+ YVGAA GLAGIYYYL
Sbjct: 211 QEYYVGAAHGLAGIYYYL 228


>ref|NP_598498.1| LanC (bacterial lantibiotic synthetase component C)-like 2 [Mus
           musculus]
          Length = 450

 Score =  186 bits (472), Expect(2) = 8e-50
 Identities = 93/232 (40%), Positives = 145/232 (62%), Gaps = 28/232 (12%)
 Frame = +3

Query: 318 MAQRAFPNPYADFNKS-----LAEGYFDSAGR-------------------LTPEFSQRV 425
           M +R+FPNP+ D+  +     LA G  +  GR                   + P F +R+
Sbjct: 18  MEERSFPNPFPDYEAAASAAGLAAGSAEETGRVCPLPTTEDPGLPFHPNGKIVPNFIKRI 77

Query: 426 NNKIRELLQQMERGLKSADPRDGTAYTGWAGIAVLYLHLYDVFGDPAYLQMAHGYAKQSL 605
             KI++LLQQME GLK+ADP D +AYTGW GIA+LYL LY V GD  YL  +  Y K++L
Sbjct: 78  QTKIKDLLQQMEEGLKTADPHDCSAYTGWTGIALLYLQLYRVTGDQTYLLRSLDYVKRTL 137

Query: 606 NCLTKRSITFLCGDAGPLAVAAVVHDKMNNEKQAEDCITRLIHLNKI----DPHAPNEML 773
             L+ R +TFLCGDAGPLAV AV++ K+ +E ++++CIT+L+ +++     +   P+E+L
Sbjct: 138 RNLSGRRVTFLCGDAGPLAVGAVIYHKLKSECESQECITKLLQMHRTIVCQESELPDELL 197

Query: 774 YGRMGYIYALLFVNKNFGVEKIPRSHIQQICETVLTSGENLARKKNFQKKLP 929
           YGR GY+YALL++N   G   +  + I+++   ++ SG++L+R++   ++ P
Sbjct: 198 YGRAGYLYALLYLNTEIGPGTVGETAIKEVVSAIIESGKSLSREERKSERCP 249



 Score = 30.4 bits (67), Expect(2) = 8e-50
 Identities = 13/18 (72%), Positives = 15/18 (83%)
 Frame = +1

Query: 946 QKNYVGAALGLAGIYYYL 999
           +K YVGAA G+AGIYY L
Sbjct: 256 RKQYVGAAHGMAGIYYML 273


>ref|XP_984245.1| PREDICTED: similar to LanC (bacterial lantibiotic synthetase
           component C)-like 2 [Mus musculus]
          Length = 390

 Score =  186 bits (472), Expect(2) = 8e-50
 Identities = 93/232 (40%), Positives = 145/232 (62%), Gaps = 28/232 (12%)
 Frame = +3

Query: 318 MAQRAFPNPYADFNKS-----LAEGYFDSAGR-------------------LTPEFSQRV 425
           M +R+FPNP+ D+  +     LA G  +  GR                   + P F +R+
Sbjct: 18  MEERSFPNPFPDYEAAASAAGLAAGSAEETGRVCPLPTTEDPGLPFHPNGKIVPNFIKRI 77

Query: 426 NNKIRELLQQMERGLKSADPRDGTAYTGWAGIAVLYLHLYDVFGDPAYLQMAHGYAKQSL 605
             KI++LLQQME GLK+ADP D +AYTGW GIA+LYL LY V GD  YL  +  Y K++L
Sbjct: 78  QTKIKDLLQQMEEGLKTADPHDCSAYTGWTGIALLYLQLYRVTGDQTYLLRSLDYVKRTL 137

Query: 606 NCLTKRSITFLCGDAGPLAVAAVVHDKMNNEKQAEDCITRLIHLNKI----DPHAPNEML 773
             L+ R +TFLCGDAGPLAV AV++ K+ +E ++++CIT+L+ +++     +   P+E+L
Sbjct: 138 RNLSGRRVTFLCGDAGPLAVGAVIYHKLKSECESQECITKLLQMHRTIVCQESELPDELL 197

Query: 774 YGRMGYIYALLFVNKNFGVEKIPRSHIQQICETVLTSGENLARKKNFQKKLP 929
           YGR GY+YALL++N   G   +  + I+++   ++ SG++L+R++   ++ P
Sbjct: 198 YGRAGYLYALLYLNTEIGPGTVGETAIKEVVSAIIESGKSLSREERKSERCP 249



 Score = 30.4 bits (67), Expect(2) = 8e-50
 Identities = 13/18 (72%), Positives = 15/18 (83%)
 Frame = +1

Query: 946 QKNYVGAALGLAGIYYYL 999
           +K YVGAA G+AGIYY L
Sbjct: 256 RKQYVGAAHGMAGIYYML 273


>ref|NP_775590.1| LanC lantibiotic synthetase component C-like 3 [Mus musculus]
          Length = 420

 Score = 52.8 bits (125), Expect = 6e-07
 Identities = 56/225 (24%), Positives = 90/225 (40%), Gaps = 27/225 (12%)
 Frame = +3

Query: 315 MMAQRAFPNPYADFNKSLAEGYFDSAGRLTPEFSQRVNNKIRELLQQMERGLKSADPRDG 494
           M  +R F N + D+  SL  G  + A       +  V + I  +LQ++      A+ R  
Sbjct: 1   MDTKRCFANRFDDYQGSLLAGQCEEA------VAPLVTSTIERILQELPPLGGGAEARGA 54

Query: 495 TA---------YTGWAGIAVLYLHLYDVFGDPAYLQMAHGY---AKQSLN-CLTKRS--- 626
           T          Y+G AG+A +   LY V   P +      Y   AK+ ++ CL       
Sbjct: 55  TGAGSSCQGGLYSGVAGVAYM---LYHVSQSPLFAAARERYLRFAKRLIDACLRAEEWGE 111

Query: 627 ------ITFLCGDAGPLAVAAVVHDKMNNEKQAED-----CITRLIHLNKIDPHAPNEML 773
                   FL G AG  AVA +V+  +      +       +  +           +E+ 
Sbjct: 112 TDADTRAAFLLGGAGVYAVATLVYHALGRPDYVQPLGKFRALCAVCAPVSFLDCGSDELF 171

Query: 774 YGRMGYIYALLFVNKNFGVEKIPRSHIQQICETVLTSGENLARKK 908
            GR GY+ A L + +    E +  + I+ IC+ +L SG+  A KK
Sbjct: 172 VGRAGYLCAALVLKQKLAQEVLTPTQIKAICQAILDSGKQYALKK 216


  Database: RefSeqMP
    Posted date:  Aug 2, 2006 12:58 AM
  Number of letters in database: 21,768,885
  Number of sequences in database:  45,328
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 48,965,866
Number of Sequences: 45328
Number of extensions: 1321517
Number of successful extensions: 4832
Number of sequences better than 1.0e-05: 4
Number of HSP's better than  0.0 without gapping: 4148
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4813
length of database: 21,768,885
effective HSP length: 104
effective length of database: 17,054,773
effective search space used: 3888488244
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)