Animal-Genome cDNA 20060611C-000823


Search to RefSeqSP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611C-000823
         (1231 letters)

Database: RefSeqSP 
           1040 sequences; 434,620 total letters

Searching...done

 ***** No hits found ******

  Database: RefSeqSP
    Posted date:  Aug 1, 2006  7:14 PM
  Number of letters in database: 434,620
  Number of sequences in database:  1040
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,116,710
Number of Sequences: 1040
Number of extensions: 26527
Number of successful extensions: 77
Number of sequences better than 1.0e-05: 0
Number of HSP's better than  0.0 without gapping: 70
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 77
length of database: 434,620
effective HSP length: 79
effective length of database: 352,460
effective search space used: 116311800
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqBP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611C-000823
         (1231 letters)

Database: RefSeqBP 
           33,508 sequences; 16,112,626 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|XP_612082.2| PREDICTED: similar to LanC-like protein 1 (40 k...   732   0.0  
Alignment   gi|XP_614740.2| PREDICTED: similar to LanC-like protein 2 (Test...   296   3e-80
Alignment   gi|XP_611101.2| PREDICTED: similar to LanC-like protein 2 (Test...   149   2e-38
Alignment   gi|XP_597454.2| PREDICTED: similar to LanC lantibiotic syntheta...   152   9e-38

>ref|XP_612082.2| PREDICTED: similar to LanC-like protein 1 (40 kDa erythrocyte
            membrane protein) (p40) [Bos taurus]
          Length = 399

 Score =  732 bits (1889), Expect(2) = 0.0
 Identities = 343/374 (91%), Positives = 359/374 (95%)
 Frame = +1

Query: 58   MAQRAFPNPYADFNKSLAEGYFDSAGRLTPEFSQRVNNKIRELLQQMERGLKSADPRDGT 237
            MAQRAFPNPYAD+NKSLAEGYFDSAGRLTPEFSQR+NNKIRELLQQMERGLKSADPRD T
Sbjct: 1    MAQRAFPNPYADYNKSLAEGYFDSAGRLTPEFSQRLNNKIRELLQQMERGLKSADPRDST 60

Query: 238  AYTGWAGIAVLYLHLYDVFGDPAYLQMAHGYAKQSLNCLTKRSITFLCGDAGPLAVAAVV 417
             YTGWAGIAVLYLHLYDVFGDP YLQMAHGY KQSLN L+K SITFLCGD GPLAVAAVV
Sbjct: 61   VYTGWAGIAVLYLHLYDVFGDPNYLQMAHGYVKQSLNSLSKHSITFLCGDGGPLAVAAVV 120

Query: 418  HDKMNNEKQAEDCITRLIHLNKIDPHAPNEMLYGRMGYIYALLFVNKNFGVEKIPRSHIQ 597
            H KMNNEKQAE+CITRLIHLNKIDPHAP+EMLYGRMGYI ALLFVNKNFG EKIP+SHIQ
Sbjct: 121  HHKMNNEKQAEECITRLIHLNKIDPHAPSEMLYGRMGYISALLFVNKNFGEEKIPQSHIQ 180

Query: 598  QICETVLTSGENLARKRNFTEKTPLMYEWYQEYYVGAAHGLAGIYYYLMQPSLQVSHAKL 777
            QICETVLTSGE+LARKR FT KTPLMYEWYQEYYVGAAHGLAGIYYYLMQPSLQVSHAKL
Sbjct: 181  QICETVLTSGEDLARKRRFTGKTPLMYEWYQEYYVGAAHGLAGIYYYLMQPSLQVSHAKL 240

Query: 778  QSLVKPSVDYVCQLKFPSGNYPPCVDDTRDLLVHWCHGSPGVIYMLIQAYKVFREERYLN 957
             +LVKPSVDYVCQLKFPSGNYPPCVDD+RDLL+HWCHG+PGVIYML QAYKVF+EERYLN
Sbjct: 241  HNLVKPSVDYVCQLKFPSGNYPPCVDDSRDLLIHWCHGAPGVIYMLTQAYKVFKEERYLN 300

Query: 958  DAYQCADVIWKYGLLKKGYGLCHGTAGNAYAFLTLFNLTQDMKYLYRACKFAEWCLDYGE 1137
            DAYQCADVIW+YGLLKKGYGLCHGTAGNAYAFL+L++LTQD KYLYRACKFAEWCLDYGE
Sbjct: 301  DAYQCADVIWQYGLLKKGYGLCHGTAGNAYAFLSLYSLTQDAKYLYRACKFAEWCLDYGE 360

Query: 1138 HGCRTPDTPFSLFE 1179
            HGCRTPDTPFSLFE
Sbjct: 361  HGCRTPDTPFSLFE 374



 Score = 37.0 bits (84), Expect(2) = 0.0
 Identities = 16/18 (88%), Positives = 18/18 (100%)
 Frame = +2

Query: 1178 KGMAGTIYFLADLLMPTK 1231
            +GMAGTIYFLADLL+PTK
Sbjct: 374  EGMAGTIYFLADLLVPTK 391


>ref|XP_614740.2| PREDICTED: similar to LanC-like protein 2 (Testis-specific
           adriamycin sensitivity protein), partial [Bos taurus]
          Length = 331

 Score =  296 bits (757), Expect = 3e-80
 Identities = 143/313 (45%), Positives = 206/313 (65%), Gaps = 22/313 (7%)
 Frame = +1

Query: 58  MAQRAFPNPYADFNKSLAEGY------------------FDSAGRLTPEFSQRVNNKIRE 183
           M  RAFPNP+ D+  +                       F S G++   F++R+  KI++
Sbjct: 19  MEDRAFPNPFPDYEAAAERQAEEPPCSRTPLSPEELGLPFHSDGKIINNFTRRIQTKIKD 78

Query: 184 LLQQMERGLKSADPRDGTAYTGWAGIAVLYLHLYDVFGDPAYLQMAHGYAKQSLNCLTKR 363
           LLQQME GLK+ADP D +AYTGW GIA+LYL LY V  D +YL  +  Y K++L  L  R
Sbjct: 79  LLQQMEEGLKTADPHDCSAYTGWTGIALLYLQLYRVTCDQSYLLRSLDYVKRTLRNLNGR 138

Query: 364 SITFLCGDAGPLAVAAVVHDKMNNEKQAEDCITRLIHLNKI----DPHAPNEMLYGRMGY 531
            +TFLCGDAGPLAV AVV+ K+ ++ ++++CIT+L+ L +     D   P+E+LYGR GY
Sbjct: 139 RVTFLCGDAGPLAVGAVVYHKLKSDCESQECITKLLQLQRTIVCRDSDLPDELLYGRAGY 198

Query: 532 IYALLFVNKNFGVEKIPRSHIQQICETVLTSGENLARKRNFTEKTPLMYEWYQEYYVGAA 711
           +YALL+VN   G   +  S I+++   ++ SG+ L+++    E+ PL+Y+W+++ YVGAA
Sbjct: 199 LYALLYVNTEIGPGAVCESAIKEVVNAIIESGKALSKEEKKVERCPLLYQWHRKQYVGAA 258

Query: 712 HGLAGIYYYLMQPSLQVSHAKLQSLVKPSVDYVCQLKFPSGNYPPCVDDTRDLLVHWCHG 891
           HG+AGIYY LMQP+ +V    L  +VKPS+DY+   +F SGNYP  + +  D LVHWCHG
Sbjct: 259 HGMAGIYYMLMQPAAKVDQETLTEMVKPSIDYMRHKRFRSGNYPSSLSNETDRLVHWCHG 318

Query: 892 SPGVIYMLIQAYK 930
           +PGVI++L+QA+K
Sbjct: 319 APGVIHVLMQAHK 331


>ref|XP_611101.2| PREDICTED: similar to LanC-like protein 2 (Testis-specific adriamycin
            sensitivity protein), partial [Bos taurus]
          Length = 149

 Score =  149 bits (377), Expect(2) = 2e-38
 Identities = 61/83 (73%), Positives = 75/83 (90%)
 Frame = +1

Query: 931  VFREERYLNDAYQCADVIWKYGLLKKGYGLCHGTAGNAYAFLTLFNLTQDMKYLYRACKF 1110
            VF+EE+YL DA +C+DVIW+ GLL+KGYG+CHGTAGN Y+FL+L+++TQD KYLYRACKF
Sbjct: 30   VFKEEKYLKDAVECSDVIWQRGLLRKGYGICHGTAGNGYSFLSLYHITQDKKYLYRACKF 89

Query: 1111 AEWCLDYGEHGCRTPDTPFSLFE 1179
            AEWCL+YG HGCR PD P+SLFE
Sbjct: 90   AEWCLEYGAHGCRIPDRPYSLFE 112



 Score = 28.5 bits (62), Expect(2) = 2e-38
 Identities = 11/16 (68%), Positives = 15/16 (93%)
 Frame = +2

Query: 1178 KGMAGTIYFLADLLMP 1225
            +GMAGTI+FL+D+L P
Sbjct: 112  EGMAGTIHFLSDILAP 127


>ref|XP_597454.2| PREDICTED: similar to LanC lantibiotic synthetase component C-like 3
            [Bos taurus]
          Length = 244

 Score =  152 bits (383), Expect(2) = 9e-38
 Identities = 81/211 (38%), Positives = 131/211 (62%), Gaps = 4/211 (1%)
 Frame = +1

Query: 559  NFGVEKIPRSHIQQICETVLTSGENLARKRNFTEKTPLMYEWYQEYYVGAAHGLAGIYYY 738
            +F  + +  + I+ IC+ +L SG+  A K+   +  PLMY +Y   Y+GAAHGL+ I   
Sbjct: 11   DFLTQVLTPAQIKSICQAILDSGKQYAMKKR--KPFPLMYSYYGTEYLGAAHGLSSILQM 68

Query: 739  LMQPSLQVSHAKLQSLVKPSVDYVCQLKFPSGNYPPCVDDT---RDLLVHWCHGSPGVIY 909
            L+     +  +  Q LV  SVD++ + +  + N+PP + +     + LVHWCHG+PG+ Y
Sbjct: 69   LLSYHEHLKPSD-QELVWQSVDFLMEQE-QNCNWPPELGEAIERENELVHWCHGAPGIAY 126

Query: 910  MLIQAYKVFREERYLNDAYQCADVIWKYGLLKKGYGLCHGTAGNAYAFLTLFNLTQDMKY 1089
            +  +AY V ++ +YL+   +C ++ W+ GLLKKG G+CHG AG+AY FL L+ LT + KY
Sbjct: 127  LFAKAYLVSKKPQYLDTCIRCGELTWQKGLLKKGPGICHGVAGSAYVFLLLYRLTGNSKY 186

Query: 1090 LYRACKFAEWCL-DYGEHGCRTPDTPFSLFE 1179
            +YRA +FAE+   +  + G R  ++ +SL+E
Sbjct: 187  IYRAQRFAEFLFTEEFKAGSRVLESIYSLYE 217



 Score = 24.3 bits (51), Expect(2) = 9e-38
 Identities = 9/18 (50%), Positives = 13/18 (72%)
 Frame = +2

Query: 1178 KGMAGTIYFLADLLMPTK 1231
            +G +GT+ FL DLL P +
Sbjct: 217  EGFSGTVCFLIDLLQPNQ 234


  Database: RefSeqBP
    Posted date:  Aug 1, 2006  7:14 PM
  Number of letters in database: 16,112,626
  Number of sequences in database:  33,508
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 40,645,576
Number of Sequences: 33508
Number of extensions: 962675
Number of successful extensions: 2593
Number of sequences better than 1.0e-05: 4
Number of HSP's better than  0.0 without gapping: 2384
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2586
length of database: 16,112,626
effective HSP length: 104
effective length of database: 12,627,794
effective search space used: 3851477170
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqHP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611C-000823
         (1231 letters)

Database: RefSeqHP 
           39,411 sequences; 17,774,539 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_006046.1| lanthionine synthetase C-like protein 1 [Homo s...   742   0.0  
Alignment   gi|NP_061167.1| LanC lantibiotic synthetase component C-like 2 ...   442   e-125
Alignment   gi|NP_940913.1| LanC lantibiotic synthetase component C-like 3 ...   171   2e-42

>ref|NP_006046.1| lanthionine synthetase C-like protein 1 [Homo sapiens]
          Length = 399

 Score =  742 bits (1916), Expect(2) = 0.0
 Identities = 346/374 (92%), Positives = 363/374 (97%)
 Frame = +1

Query: 58   MAQRAFPNPYADFNKSLAEGYFDSAGRLTPEFSQRVNNKIRELLQQMERGLKSADPRDGT 237
            MAQRAFPNPYAD+NKSLAEGYFD+AGRLTPEFSQR+ NKIRELLQQMERGLKSADPRDGT
Sbjct: 1    MAQRAFPNPYADYNKSLAEGYFDAAGRLTPEFSQRLTNKIRELLQQMERGLKSADPRDGT 60

Query: 238  AYTGWAGIAVLYLHLYDVFGDPAYLQMAHGYAKQSLNCLTKRSITFLCGDAGPLAVAAVV 417
             YTGWAGIAVLYLHLYDVFGDPAYLQ+AHGY KQSLNCLTKRSITFLCGDAGPLAVAAV+
Sbjct: 61   GYTGWAGIAVLYLHLYDVFGDPAYLQLAHGYVKQSLNCLTKRSITFLCGDAGPLAVAAVL 120

Query: 418  HDKMNNEKQAEDCITRLIHLNKIDPHAPNEMLYGRMGYIYALLFVNKNFGVEKIPRSHIQ 597
            + KMNNEKQAEDCITRLIHLNKIDPHAPNEMLYGR+GYIYALLFVNKNFGVEKIP+SHIQ
Sbjct: 121  YHKMNNEKQAEDCITRLIHLNKIDPHAPNEMLYGRIGYIYALLFVNKNFGVEKIPQSHIQ 180

Query: 598  QICETVLTSGENLARKRNFTEKTPLMYEWYQEYYVGAAHGLAGIYYYLMQPSLQVSHAKL 777
            QICET+LTSGENLARKRNFT K+PLMYEWYQEYYVGAAHGLAGIYYYLMQPSLQVS  KL
Sbjct: 181  QICETILTSGENLARKRNFTAKSPLMYEWYQEYYVGAAHGLAGIYYYLMQPSLQVSQGKL 240

Query: 778  QSLVKPSVDYVCQLKFPSGNYPPCVDDTRDLLVHWCHGSPGVIYMLIQAYKVFREERYLN 957
             SLVKPSVDYVCQLKFPSGNYPPC+ D RDLLVHWCHG+PGVIYMLIQAYKVFREE+YL 
Sbjct: 241  HSLVKPSVDYVCQLKFPSGNYPPCIGDNRDLLVHWCHGAPGVIYMLIQAYKVFREEKYLC 300

Query: 958  DAYQCADVIWKYGLLKKGYGLCHGTAGNAYAFLTLFNLTQDMKYLYRACKFAEWCLDYGE 1137
            DAYQCADVIW+YGLLKKGYGLCHG+AGNAYAFLTL+NLTQDMKYLYRACKFAEWCL+YGE
Sbjct: 301  DAYQCADVIWQYGLLKKGYGLCHGSAGNAYAFLTLYNLTQDMKYLYRACKFAEWCLEYGE 360

Query: 1138 HGCRTPDTPFSLFE 1179
            HGCRTPDTPFSLFE
Sbjct: 361  HGCRTPDTPFSLFE 374



 Score = 37.0 bits (84), Expect(2) = 0.0
 Identities = 16/18 (88%), Positives = 18/18 (100%)
 Frame = +2

Query: 1178 KGMAGTIYFLADLLMPTK 1231
            +GMAGTIYFLADLL+PTK
Sbjct: 374  EGMAGTIYFLADLLVPTK 391


>ref|NP_061167.1| LanC lantibiotic synthetase component C-like 2 [Homo sapiens]
          Length = 450

 Score =  442 bits (1137), Expect(2) = e-125
 Identities = 208/401 (51%), Positives = 281/401 (70%), Gaps = 27/401 (6%)
 Frame = +1

Query: 58   MAQRAFPNPYADFNKS----LAEGYFDSAGRLTP-------------------EFSQRVN 168
            M +RAF NP+ D+  +    LA G  +  G + P                    F +R+ 
Sbjct: 19   MEERAFVNPFPDYEAAAGALLASGAAEETGCVRPPATTDEPGLPFHQDGKIIHNFIRRIQ 78

Query: 169  NKIRELLQQMERGLKSADPRDGTAYTGWAGIAVLYLHLYDVFGDPAYLQMAHGYAKQSLN 348
             KI++LLQQME GLK+ADP D +AYTGW GIA+LYL LY V  D  YL  +  Y K++L 
Sbjct: 79   TKIKDLLQQMEEGLKTADPHDCSAYTGWTGIALLYLQLYRVTCDQTYLLRSLDYVKRTLR 138

Query: 349  CLTKRSITFLCGDAGPLAVAAVVHDKMNNEKQAEDCITRLIHLNKI----DPHAPNEMLY 516
             L  R +TFLCGDAGPLAV AV++ K+ ++ ++++C+T+L+ L +     +   P+E+LY
Sbjct: 139  NLNGRRVTFLCGDAGPLAVGAVIYHKLRSDCESQECVTKLLQLQRSVVCQESDLPDELLY 198

Query: 517  GRMGYIYALLFVNKNFGVEKIPRSHIQQICETVLTSGENLARKRNFTEKTPLMYEWYQEY 696
            GR GY+YALL++N   G   +  S I+++   ++ SG+ L+R+   TE+ PL+Y+W+++ 
Sbjct: 199  GRAGYLYALLYLNTEIGPGTVCESAIKEVVNAIIESGKTLSREERKTERCPLLYQWHRKQ 258

Query: 697  YVGAAHGLAGIYYYLMQPSLQVSHAKLQSLVKPSVDYVCQLKFPSGNYPPCVDDTRDLLV 876
            YVGAAHG+AGIYY LMQP+ +V    L  +VKPS+DYV   KF SGNYP  + +  D LV
Sbjct: 259  YVGAAHGMAGIYYMLMQPAAKVDQETLTEMVKPSIDYVRHKKFRSGNYPSSLSNETDRLV 318

Query: 877  HWCHGSPGVIYMLIQAYKVFREERYLNDAYQCADVIWKYGLLKKGYGLCHGTAGNAYAFL 1056
            HWCHG+PGVI+ML+QAYKVF+EE+YL +A +C+DVIW+ GLL+KGYG+CHGTAGN Y+FL
Sbjct: 319  HWCHGAPGVIHMLMQAYKVFKEEKYLKEAMECSDVIWQRGLLRKGYGICHGTAGNGYSFL 378

Query: 1057 TLFNLTQDMKYLYRACKFAEWCLDYGEHGCRTPDTPFSLFE 1179
            +L+ LTQD KYLYRACKFAEWCLDYG HGCR PD P+SLFE
Sbjct: 379  SLYRLTQDKKYLYRACKFAEWCLDYGAHGCRIPDRPYSLFE 419



 Score = 25.4 bits (54), Expect(2) = e-125
 Identities = 10/16 (62%), Positives = 14/16 (87%)
 Frame = +2

Query: 1178 KGMAGTIYFLADLLMP 1225
            +GMAG I+FL+D+L P
Sbjct: 419  EGMAGAIHFLSDVLGP 434


>ref|NP_940913.1| LanC lantibiotic synthetase component C-like 3 [Homo sapiens]
          Length = 388

 Score =  171 bits (432), Expect = 2e-42
 Identities = 118/379 (31%), Positives = 186/379 (49%), Gaps = 30/379 (7%)
 Frame = +1

Query: 55   MMAQRAFPNPYADFNKSLAEGYFDSAGRLTPEFSQRVNNKIRELLQQMERGLKSADPRDG 234
            M  +R F N + D+  SL  G  + A       +  V   I  +LQ++      A+ R  
Sbjct: 1    MDTKRCFANRFDDYQGSLLAGQCEEA------VAPLVTATIERILQELPPLGGGAEARGA 54

Query: 235  TA---------YTGWAGIAVLYLHLYDVFGDPAYLQMAHGY---AKQSLNCLTKRS---- 366
            TA         Y G AG+A +   LY V   P +      Y   AK+ ++   +      
Sbjct: 55   TAGASACQGGLYGGVAGVAYM---LYHVSQSPLFATARERYLRSAKRLIDACARAEEWGE 111

Query: 367  ------ITFLCGDAGPLAVAAVVHDKMNNEKQAED-----CITRLIHLNKIDPHAPNEML 513
                    FL G AG  AVA +V+  +      +       +  +           +E+ 
Sbjct: 112  PDADTRAAFLLGGAGVYAVATLVYHALGRSDYVQPLGKFRALCAVCAPVSFLECGSDELF 171

Query: 514  YGRMGYIYALLFVNKNFGVEKIPRSHIQQICETVLTSGENLARKRNFTEKTPLMYEWYQE 693
             GR GY+ A L + +    E +  + I+ IC+ +L SG+  A K+   +  PLMY +Y  
Sbjct: 172  VGRAGYLCAALVLKQKLAQEVLTPAQIKSICQAILDSGKQYAIKKR--KPFPLMYSYYGT 229

Query: 694  YYVGAAHGLAGIYYYLMQPSLQVSHAKLQSLVKPSVDYVCQLKFPSGNYPPCVDDT---R 864
             Y+GAAHGL+ I   L+     +  +  + LV  SVD++ + +  + N+PP + +T    
Sbjct: 230  EYLGAAHGLSSILQMLLSYHEHLKPSD-RELVWQSVDFLMEQE-QNCNWPPELGETIERE 287

Query: 865  DLLVHWCHGSPGVIYMLIQAYKVFREERYLNDAYQCADVIWKYGLLKKGYGLCHGTAGNA 1044
            + LVHWCHG+PG+ Y+  +AY V ++ +YL+   +C ++ W+ GLLKKG G+CHG AG+A
Sbjct: 288  NELVHWCHGAPGIAYLFAKAYLVSKKPQYLDTCIRCGELTWQKGLLKKGPGICHGVAGSA 347

Query: 1045 YAFLTLFNLTQDMKYLYRA 1101
            Y FL L+ LT + KY+YRA
Sbjct: 348  YVFLLLYRLTGNSKYIYRA 366


  Database: RefSeqHP
    Posted date:  Aug 2, 2006 12:57 AM
  Number of letters in database: 17,774,539
  Number of sequences in database:  39,411
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 45,757,313
Number of Sequences: 39411
Number of extensions: 1106000
Number of successful extensions: 3065
Number of sequences better than 1.0e-05: 3
Number of HSP's better than  0.0 without gapping: 2765
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3054
length of database: 17,774,539
effective HSP length: 104
effective length of database: 13,675,795
effective search space used: 4171117475
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqCP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611C-000823
         (1231 letters)

Database: RefSeqCP 
           33,732 sequences; 19,266,565 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|XP_536055.1| PREDICTED: similar to LanC-like protein 1 (40 k...   734   0.0  
Alignment   gi|XP_540359.2| PREDICTED: similar to LanC-like protein 2 (Test...   436   e-123
Alignment   gi|XP_548943.2| PREDICTED: similar to LanC lantibiotic syntheta...   179   8e-46

>ref|XP_536055.1| PREDICTED: similar to LanC-like protein 1 (40 kDa erythrocyte
            membrane protein) (p40) [Canis familiaris]
          Length = 399

 Score =  734 bits (1894), Expect(2) = 0.0
 Identities = 344/374 (91%), Positives = 356/374 (95%)
 Frame = +1

Query: 58   MAQRAFPNPYADFNKSLAEGYFDSAGRLTPEFSQRVNNKIRELLQQMERGLKSADPRDGT 237
            MAQRAFPNPYADFNKSLAE YFD AGRLTPEFSQR+NNKIRELLQQMERGLKSADPRD T
Sbjct: 1    MAQRAFPNPYADFNKSLAESYFDCAGRLTPEFSQRLNNKIRELLQQMERGLKSADPRDST 60

Query: 238  AYTGWAGIAVLYLHLYDVFGDPAYLQMAHGYAKQSLNCLTKRSITFLCGDAGPLAVAAVV 417
             YTGWAGIA+LYLHLYDVFGDPAYLQMAHGY KQSLN LTKRSITFLCGDAGPLA+ AVV
Sbjct: 61   VYTGWAGIALLYLHLYDVFGDPAYLQMAHGYVKQSLNSLTKRSITFLCGDAGPLAIGAVV 120

Query: 418  HDKMNNEKQAEDCITRLIHLNKIDPHAPNEMLYGRMGYIYALLFVNKNFGVEKIPRSHIQ 597
            + KMNNEKQAEDCITRLIHLNKID HAPNEMLYGRMGY+YALLFVNKNFGVEKIP+SHIQ
Sbjct: 121  YHKMNNEKQAEDCITRLIHLNKIDHHAPNEMLYGRMGYVYALLFVNKNFGVEKIPQSHIQ 180

Query: 598  QICETVLTSGENLARKRNFTEKTPLMYEWYQEYYVGAAHGLAGIYYYLMQPSLQVSHAKL 777
            QICE VLTSGENLA+KRNFT KTPLMYEWYQEYYVGAAHGLAGIYY LMQPSLQVSH KL
Sbjct: 181  QICEAVLTSGENLAQKRNFTAKTPLMYEWYQEYYVGAAHGLAGIYYLLMQPSLQVSHVKL 240

Query: 778  QSLVKPSVDYVCQLKFPSGNYPPCVDDTRDLLVHWCHGSPGVIYMLIQAYKVFREERYLN 957
             +LVKPSVDYVCQLKFPSGNYPPCVDD RDLLVHWCHGSPGVIYMLIQAYK FR E YLN
Sbjct: 241  HNLVKPSVDYVCQLKFPSGNYPPCVDDNRDLLVHWCHGSPGVIYMLIQAYKAFRGEHYLN 300

Query: 958  DAYQCADVIWKYGLLKKGYGLCHGTAGNAYAFLTLFNLTQDMKYLYRACKFAEWCLDYGE 1137
            DA+QCADVIW+YGLL+KGYGLCHGTAGNAYAFLTL+NLTQDMKYLYRACKFAEWCLDYGE
Sbjct: 301  DAHQCADVIWRYGLLRKGYGLCHGTAGNAYAFLTLYNLTQDMKYLYRACKFAEWCLDYGE 360

Query: 1138 HGCRTPDTPFSLFE 1179
            HGCRTPDTPFSLFE
Sbjct: 361  HGCRTPDTPFSLFE 374



 Score = 37.0 bits (84), Expect(2) = 0.0
 Identities = 16/18 (88%), Positives = 18/18 (100%)
 Frame = +2

Query: 1178 KGMAGTIYFLADLLMPTK 1231
            +GMAGTIYFLADLL+PTK
Sbjct: 374  EGMAGTIYFLADLLVPTK 391


>ref|XP_540359.2| PREDICTED: similar to LanC-like protein 2 (Testis-specific adriamycin
            sensitivity protein) [Canis familiaris]
          Length = 452

 Score =  436 bits (1122), Expect(2) = e-123
 Identities = 198/352 (56%), Positives = 266/352 (75%), Gaps = 4/352 (1%)
 Frame = +1

Query: 136  RLTPEFSQRVNNKIRELLQQMERGLKSADPRDGTAYTGWAGIAVLYLHLYDVFGDPAYLQ 315
            R+   F++R+  KI++LLQQME GLK+ADP D +AYTGW GIA+LYL LY V  D  YL 
Sbjct: 67   RIVQNFTKRIQTKIKDLLQQMEEGLKTADPHDCSAYTGWTGIALLYLQLYRVTCDQTYLL 126

Query: 316  MAHGYAKQSLNCLTKRSITFLCGDAGPLAVAAVVHDKMNNEKQAEDCITRLIHLNKI--- 486
             +  Y K++L  L  R +TFLCGDAGPLAV AVV+ K+ ++ ++++CIT+L+ L +    
Sbjct: 127  RSLDYVKRTLRNLNGRRVTFLCGDAGPLAVGAVVYHKLKSDCESQECITKLLQLQRTIVC 186

Query: 487  -DPHAPNEMLYGRMGYIYALLFVNKNFGVEKIPRSHIQQICETVLTSGENLARKRNFTEK 663
             D   P+E+LYGR GY+YALL++N   G   +  S I+++   ++ SG+ L+R+    E+
Sbjct: 187  RDSDLPDELLYGRAGYLYALLYLNTEIGPGTVCESAIKEVVCAIIESGKTLSREERKAER 246

Query: 664  TPLMYEWYQEYYVGAAHGLAGIYYYLMQPSLQVSHAKLQSLVKPSVDYVCQLKFPSGNYP 843
             PL+Y+W+++ YVGAAHG+AGIYY LMQP+ +V    L  +VKPS+DYV   +F SGNYP
Sbjct: 247  CPLLYQWHRKQYVGAAHGMAGIYYMLMQPAAKVDQETLTEMVKPSIDYVRHKRFRSGNYP 306

Query: 844  PCVDDTRDLLVHWCHGSPGVIYMLIQAYKVFREERYLNDAYQCADVIWKYGLLKKGYGLC 1023
              + +  D LVHWCHG+PGVI+ML+QAYKVF+EE+YL DA +C+DVIW+ GLL+KGYG+C
Sbjct: 307  SSLSNETDRLVHWCHGAPGVIHMLMQAYKVFKEEKYLKDAMECSDVIWQRGLLRKGYGIC 366

Query: 1024 HGTAGNAYAFLTLFNLTQDMKYLYRACKFAEWCLDYGEHGCRTPDTPFSLFE 1179
            HGTAGN Y+FL+L++LTQD KYLYRACKFAEWCL+YG HGCR PD P+SLFE
Sbjct: 367  HGTAGNGYSFLSLYHLTQDKKYLYRACKFAEWCLEYGAHGCRIPDRPYSLFE 418



 Score = 26.6 bits (57), Expect(2) = e-123
 Identities = 10/16 (62%), Positives = 14/16 (87%)
 Frame = +2

Query: 1178 KGMAGTIYFLADLLMP 1225
            +GMAG I+FL+D+L P
Sbjct: 418  EGMAGAIHFLSDILAP 433


>ref|XP_548943.2| PREDICTED: similar to LanC lantibiotic synthetase component C-like 3
            [Canis familiaris]
          Length = 420

 Score =  179 bits (454), Expect(2) = 8e-46
 Identities = 123/402 (30%), Positives = 200/402 (49%), Gaps = 27/402 (6%)
 Frame = +1

Query: 55   MMAQRAFPNPYADFNKSLAEGYFDSAGRLTPEFSQRVNNKIRELLQ-----QMERGLKSA 219
            M  +R F N + D+  SL  G  + A  + P  +  +   ++EL       +      +A
Sbjct: 1    MDTKRCFANRFDDYQGSLLAGQCEEA--VAPLVTATIERILQELPPLGGGAEARGAAAAA 58

Query: 220  DPRDGTAYTGWAGIAVLYLHLYDVFGDPAYLQMAHGY---AKQSLNCLTKRS-------- 366
                G  Y G AG+A +   LY V   P +      Y   AK+ ++   +          
Sbjct: 59   SSCQGGLYGGVAGVAYM---LYHVSQSPLFAGARERYLRSAKRLIDACARAEEWGEPDAD 115

Query: 367  --ITFLCGDAGPLAVAAVVHDKMNNEKQAED-----CITRLIHLNKIDPHAPNEMLYGRM 525
                FL G AG  AVA +V+  +      +       +  +           +E+  GR 
Sbjct: 116  TRAAFLLGGAGVYAVATLVYHALGRSDYVQPLGKFRALCAVCAPVSFLECGSDELFVGRA 175

Query: 526  GYIYALLFVNKNFGVEKIPRSHIQQICETVLTSGENLARKRNFTEKTPLMYEWYQEYYVG 705
            GY+ A L + +    E +  + I+ IC+ +L SG+  A K+   +  PLMY +Y   Y+G
Sbjct: 176  GYLCAALVLKQKLAQEVLTPAQIKSICQAILDSGKQYAMKKR--KPFPLMYSYYGTEYLG 233

Query: 706  AAHGLAGIYYYLMQPSLQVSHAKLQSLVKPSVDYVCQLKFPSGNYPPCVDDT---RDLLV 876
            AAHGL+ I   L+     +  +  Q LV  SVD++ + +  + N+PP + +     + LV
Sbjct: 234  AAHGLSSILQMLLSYHEHLKPSD-QELVWQSVDFLMEQE-QNCNWPPELGEAIERENELV 291

Query: 877  HWCHGSPGVIYMLIQAYKVFREERYLNDAYQCADVIWKYGLLKKGYGLCHGTAGNAYAFL 1056
            HWCHG+PG+ Y+  +AY V ++ +YL+   +C ++ W+ GLLKKG G+CHG AG+AY FL
Sbjct: 292  HWCHGAPGIAYLFAKAYLVSKKPQYLDTCIRCGELTWQKGLLKKGPGICHGVAGSAYVFL 351

Query: 1057 TLFNLTQDMKYLYRACKFAEWCL-DYGEHGCRTPDTPFSLFE 1179
             L+ LT + KY+YRA +FAE+   +  + G R  ++ +SL+E
Sbjct: 352  LLYRLTGNSKYIYRAQRFAEFLFTEEFKAGSRVLESIYSLYE 393



 Score = 24.3 bits (51), Expect(2) = 8e-46
 Identities = 9/18 (50%), Positives = 13/18 (72%)
 Frame = +2

Query: 1178 KGMAGTIYFLADLLMPTK 1231
            +G +GT+ FL DLL P +
Sbjct: 393  EGFSGTVCFLIDLLQPNQ 410


  Database: RefSeqCP
    Posted date:  Aug 1, 2006  9:25 PM
  Number of letters in database: 19,266,565
  Number of sequences in database:  33,732
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 47,632,048
Number of Sequences: 33732
Number of extensions: 1124537
Number of successful extensions: 3057
Number of sequences better than 1.0e-05: 3
Number of HSP's better than  0.0 without gapping: 2827
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3049
length of database: 19,266,565
effective HSP length: 105
effective length of database: 15,724,705
effective search space used: 4780310320
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqMP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611C-000823
         (1231 letters)

Database: RefSeqMP 
           45,328 sequences; 21,768,885 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_067270.1| LanC (bacterial lantibiotic synthetase componen...   705   0.0  
Alignment   gi|NP_598498.1| LanC (bacterial lantibiotic synthetase componen...   447   e-127
Alignment   gi|XP_984245.1| PREDICTED: similar to LanC (bacterial lantibiot...   303   3e-82
Alignment   gi|NP_775590.1| LanC lantibiotic synthetase component C-like 3 ...   182   1e-46

>ref|NP_067270.1| LanC (bacterial lantibiotic synthetase component C)-like 1 [Mus
            musculus]
          Length = 399

 Score =  705 bits (1820), Expect(2) = 0.0
 Identities = 327/374 (87%), Positives = 352/374 (94%)
 Frame = +1

Query: 58   MAQRAFPNPYADFNKSLAEGYFDSAGRLTPEFSQRVNNKIRELLQQMERGLKSADPRDGT 237
            MAQRAFPNPYAD+NKSLAE YFDS GRLTPEFS R+ NKIRELLQQMERGLKSADPRDGT
Sbjct: 1    MAQRAFPNPYADYNKSLAENYFDSTGRLTPEFSHRLTNKIRELLQQMERGLKSADPRDGT 60

Query: 238  AYTGWAGIAVLYLHLYDVFGDPAYLQMAHGYAKQSLNCLTKRSITFLCGDAGPLAVAAVV 417
             YTGWAGIAVLYLHL++VFGDPAYLQMAH Y KQSLNCL++RSITFLCGDAGPLAVAAV+
Sbjct: 61   GYTGWAGIAVLYLHLHNVFGDPAYLQMAHSYVKQSLNCLSRRSITFLCGDAGPLAVAAVL 120

Query: 418  HDKMNNEKQAEDCITRLIHLNKIDPHAPNEMLYGRMGYIYALLFVNKNFGVEKIPRSHIQ 597
            + KMN+EKQAE+CITRLIHLNKIDPH PNEMLYGR+GYI+ALLFVNKNFG EKIP+SHIQ
Sbjct: 121  YHKMNSEKQAEECITRLIHLNKIDPHVPNEMLYGRIGYIFALLFVNKNFGEEKIPQSHIQ 180

Query: 598  QICETVLTSGENLARKRNFTEKTPLMYEWYQEYYVGAAHGLAGIYYYLMQPSLQVSHAKL 777
            QICE +LTSGENL+RKRN   K+PLMYEWYQEYYVGAAHGLAGIYYYLMQPSLQV+  KL
Sbjct: 181  QICENILTSGENLSRKRNLAAKSPLMYEWYQEYYVGAAHGLAGIYYYLMQPSLQVNQGKL 240

Query: 778  QSLVKPSVDYVCQLKFPSGNYPPCVDDTRDLLVHWCHGSPGVIYMLIQAYKVFREERYLN 957
             SLVKPSVD+VC+LKFPSGNYPPC+DDTRDLLVHWCHG+PGVIYMLIQAYKVF+EERYL 
Sbjct: 241  HSLVKPSVDFVCRLKFPSGNYPPCLDDTRDLLVHWCHGAPGVIYMLIQAYKVFKEERYLC 300

Query: 958  DAYQCADVIWKYGLLKKGYGLCHGTAGNAYAFLTLFNLTQDMKYLYRACKFAEWCLDYGE 1137
            DA QCADVIW+YGLLKKGYGLCHG AGNAYAFL L+NLTQD+KYLYRACKFAEWCLDYGE
Sbjct: 301  DAQQCADVIWQYGLLKKGYGLCHGAAGNAYAFLALYNLTQDLKYLYRACKFAEWCLDYGE 360

Query: 1138 HGCRTPDTPFSLFE 1179
            HGCRT DTPFSLFE
Sbjct: 361  HGCRTADTPFSLFE 374



 Score = 37.0 bits (84), Expect(2) = 0.0
 Identities = 16/18 (88%), Positives = 18/18 (100%)
 Frame = +2

Query: 1178 KGMAGTIYFLADLLMPTK 1231
            +GMAGTIYFLADLL+PTK
Sbjct: 374  EGMAGTIYFLADLLVPTK 391


>ref|NP_598498.1| LanC (bacterial lantibiotic synthetase component C)-like 2 [Mus
            musculus]
          Length = 450

 Score =  447 bits (1150), Expect(2) = e-127
 Identities = 206/402 (51%), Positives = 286/402 (71%), Gaps = 28/402 (6%)
 Frame = +1

Query: 58   MAQRAFPNPYADFNKS-----LAEGYFDSAGR-------------------LTPEFSQRV 165
            M +R+FPNP+ D+  +     LA G  +  GR                   + P F +R+
Sbjct: 18   MEERSFPNPFPDYEAAASAAGLAAGSAEETGRVCPLPTTEDPGLPFHPNGKIVPNFIKRI 77

Query: 166  NNKIRELLQQMERGLKSADPRDGTAYTGWAGIAVLYLHLYDVFGDPAYLQMAHGYAKQSL 345
              KI++LLQQME GLK+ADP D +AYTGW GIA+LYL LY V GD  YL  +  Y K++L
Sbjct: 78   QTKIKDLLQQMEEGLKTADPHDCSAYTGWTGIALLYLQLYRVTGDQTYLLRSLDYVKRTL 137

Query: 346  NCLTKRSITFLCGDAGPLAVAAVVHDKMNNEKQAEDCITRLIHLNKI----DPHAPNEML 513
              L+ R +TFLCGDAGPLAV AV++ K+ +E ++++CIT+L+ +++     +   P+E+L
Sbjct: 138  RNLSGRRVTFLCGDAGPLAVGAVIYHKLKSECESQECITKLLQMHRTIVCQESELPDELL 197

Query: 514  YGRMGYIYALLFVNKNFGVEKIPRSHIQQICETVLTSGENLARKRNFTEKTPLMYEWYQE 693
            YGR GY+YALL++N   G   +  + I+++   ++ SG++L+R+   +E+ PL+Y+W+++
Sbjct: 198  YGRAGYLYALLYLNTEIGPGTVGETAIKEVVSAIIESGKSLSREERKSERCPLLYQWHRK 257

Query: 694  YYVGAAHGLAGIYYYLMQPSLQVSHAKLQSLVKPSVDYVCQLKFPSGNYPPCVDDTRDLL 873
             YVGAAHG+AGIYY LMQP  +V    L  +VKPS+DYV   KF SGNYP  + +  D L
Sbjct: 258  QYVGAAHGMAGIYYMLMQPEAKVDQETLTEMVKPSIDYVRHKKFRSGNYPSSLSNETDRL 317

Query: 874  VHWCHGSPGVIYMLIQAYKVFREERYLNDAYQCADVIWKYGLLKKGYGLCHGTAGNAYAF 1053
            VHWCHG+PGVI++L+QAY+VF+EE+YL +A +C+DVIW+ GLL+KGYG+CHGT+GN Y+F
Sbjct: 318  VHWCHGAPGVIHVLLQAYQVFKEEKYLKEAMECSDVIWQRGLLRKGYGICHGTSGNGYSF 377

Query: 1054 LTLFNLTQDMKYLYRACKFAEWCLDYGEHGCRTPDTPFSLFE 1179
            L+L+ LTQD KYLYRACKFAEWCLDYG HGCR PD P+SLFE
Sbjct: 378  LSLYRLTQDKKYLYRACKFAEWCLDYGAHGCRIPDRPYSLFE 419



 Score = 26.9 bits (58), Expect(2) = e-127
 Identities = 9/16 (56%), Positives = 15/16 (93%)
 Frame = +2

Query: 1178 KGMAGTIYFLADLLMP 1225
            +GMAG ++FL+D+L+P
Sbjct: 419  EGMAGAVHFLSDILVP 434


>ref|XP_984245.1| PREDICTED: similar to LanC (bacterial lantibiotic synthetase
           component C)-like 2 [Mus musculus]
          Length = 390

 Score =  303 bits (775), Expect = 3e-82
 Identities = 145/319 (45%), Positives = 212/319 (66%), Gaps = 28/319 (8%)
 Frame = +1

Query: 58  MAQRAFPNPYADFNKS-----LAEGYFDSAGR-------------------LTPEFSQRV 165
           M +R+FPNP+ D+  +     LA G  +  GR                   + P F +R+
Sbjct: 18  MEERSFPNPFPDYEAAASAAGLAAGSAEETGRVCPLPTTEDPGLPFHPNGKIVPNFIKRI 77

Query: 166 NNKIRELLQQMERGLKSADPRDGTAYTGWAGIAVLYLHLYDVFGDPAYLQMAHGYAKQSL 345
             KI++LLQQME GLK+ADP D +AYTGW GIA+LYL LY V GD  YL  +  Y K++L
Sbjct: 78  QTKIKDLLQQMEEGLKTADPHDCSAYTGWTGIALLYLQLYRVTGDQTYLLRSLDYVKRTL 137

Query: 346 NCLTKRSITFLCGDAGPLAVAAVVHDKMNNEKQAEDCITRLIHLNKI----DPHAPNEML 513
             L+ R +TFLCGDAGPLAV AV++ K+ +E ++++CIT+L+ +++     +   P+E+L
Sbjct: 138 RNLSGRRVTFLCGDAGPLAVGAVIYHKLKSECESQECITKLLQMHRTIVCQESELPDELL 197

Query: 514 YGRMGYIYALLFVNKNFGVEKIPRSHIQQICETVLTSGENLARKRNFTEKTPLMYEWYQE 693
           YGR GY+YALL++N   G   +  + I+++   ++ SG++L+R+   +E+ PL+Y+W+++
Sbjct: 198 YGRAGYLYALLYLNTEIGPGTVGETAIKEVVSAIIESGKSLSREERKSERCPLLYQWHRK 257

Query: 694 YYVGAAHGLAGIYYYLMQPSLQVSHAKLQSLVKPSVDYVCQLKFPSGNYPPCVDDTRDLL 873
            YVGAAHG+AGIYY LMQP  +V    L  +VKPS+DYV   KF SGNYP  + +  D L
Sbjct: 258 QYVGAAHGMAGIYYMLMQPEAKVDQETLTEMVKPSIDYVRHKKFRSGNYPSSLSNETDRL 317

Query: 874 VHWCHGSPGVIYMLIQAYK 930
           VHWCHG+PGVI++L+QAY+
Sbjct: 318 VHWCHGAPGVIHVLLQAYQ 336


>ref|NP_775590.1| LanC lantibiotic synthetase component C-like 3 [Mus musculus]
          Length = 420

 Score =  182 bits (461), Expect(2) = 1e-46
 Identities = 128/408 (31%), Positives = 207/408 (50%), Gaps = 33/408 (8%)
 Frame = +1

Query: 55   MMAQRAFPNPYADFNKSLAEGYFDSAGRLTPEFSQRVNNKIRELLQQMERGLKSADPRDG 234
            M  +R F N + D+  SL  G  + A       +  V + I  +LQ++      A+ R  
Sbjct: 1    MDTKRCFANRFDDYQGSLLAGQCEEA------VAPLVTSTIERILQELPPLGGGAEARGA 54

Query: 235  TA---------YTGWAGIAVLYLHLYDVFGDPAYLQMAHGY---AKQSLN-CLTKRS--- 366
            T          Y+G AG+A +   LY V   P +      Y   AK+ ++ CL       
Sbjct: 55   TGAGSSCQGGLYSGVAGVAYM---LYHVSQSPLFAAARERYLRFAKRLIDACLRAEEWGE 111

Query: 367  ------ITFLCGDAGPLAVAAVVHDKMNNEKQAED-----CITRLIHLNKIDPHAPNEML 513
                    FL G AG  AVA +V+  +      +       +  +           +E+ 
Sbjct: 112  TDADTRAAFLLGGAGVYAVATLVYHALGRPDYVQPLGKFRALCAVCAPVSFLDCGSDELF 171

Query: 514  YGRMGYIYALLFVNKNFGVEKIPRSHIQQICETVLTSGENLARKRNFTEKTPLMYEWYQE 693
             GR GY+ A L + +    E +  + I+ IC+ +L SG+  A K+   +  PLMY +Y  
Sbjct: 172  VGRAGYLCAALVLKQKLAQEVLTPTQIKAICQAILDSGKQYALKKR--KPFPLMYSYYGT 229

Query: 694  YYVGAAHGLAGIYYYLM--QPSLQVSHAKLQSLVKPSVDYVCQLKFPSGNYPPCVDDT-- 861
             Y+GAAHGL+ I   L+  Q  L+ S    + LV+ SVD++ + +  + N+PP + +T  
Sbjct: 230  EYLGAAHGLSSILQMLLSYQEHLKPSD---RELVRQSVDFLMEQE-QNCNWPPELGETIE 285

Query: 862  -RDLLVHWCHGSPGVIYMLIQAYKVFREERYLNDAYQCADVIWKYGLLKKGYGLCHGTAG 1038
              + LVHWCHG+PG+ Y+  +AY + ++ +YL+   +C ++ W+ GLLKKG G+CHG AG
Sbjct: 286  RENELVHWCHGAPGIAYLFAKAYLISKKPQYLDTCIRCGELTWQKGLLKKGPGICHGVAG 345

Query: 1039 NAYAFLTLFNLTQDMKYLYRACKFAEWCL-DYGEHGCRTPDTPFSLFE 1179
            +AY FL L+ LT + KY+YRA +FA++   +  + G R  ++ +SL+E
Sbjct: 346  SAYVFLLLYRLTGNSKYIYRAQRFAQFLFTEEFKSGSRVLESIYSLYE 393



 Score = 24.3 bits (51), Expect(2) = 1e-46
 Identities = 9/18 (50%), Positives = 13/18 (72%)
 Frame = +2

Query: 1178 KGMAGTIYFLADLLMPTK 1231
            +G +GT+ FL DLL P +
Sbjct: 393  EGFSGTVCFLIDLLQPNQ 410


  Database: RefSeqMP
    Posted date:  Aug 2, 2006 12:58 AM
  Number of letters in database: 21,768,885
  Number of sequences in database:  45,328
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 55,074,572
Number of Sequences: 45328
Number of extensions: 1310425
Number of successful extensions: 3518
Number of sequences better than 1.0e-05: 4
Number of HSP's better than  0.0 without gapping: 3188
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3505
length of database: 21,768,885
effective HSP length: 106
effective length of database: 16,964,117
effective search space used: 5140127451
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)