Animal-Genome cDNA 20060611C-001157


Search to RefSeqSP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611C-001157
         (1470 letters)

Database: RefSeqSP 
           1040 sequences; 434,620 total letters

Searching...done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_999238.1| 20-beta-hydroxysteroid dehydrogenase [Sus scrofa]     53   2e-08
Alignment   gi|NP_998992.1| carbonyl reductase [Sus scrofa]                       53   2e-08

>ref|NP_999238.1| 20-beta-hydroxysteroid dehydrogenase [Sus scrofa]
          Length = 289

 Score = 53.1 bits (126), Expect = 2e-08
 Identities = 40/137 (29%), Positives = 62/137 (45%), Gaps = 1/137 (0%)
 Frame = +2

Query: 278 KVAVVTGANTGIGKETAKELAKRGAR-VYLACRDVQKGESVAREIQNMTGNQQVLVRKLD 454
           +VA+VTGAN GIG    ++L ++ A  V L  RDV +G++  +++Q           +LD
Sbjct: 6   RVALVTGANKGIGFAIVRDLCRQFAGDVVLTARDVARGQAAVKQLQ--AEGLSPRFHQLD 63

Query: 455 LADTKSIRAFAKGFLAEEKHLHILINNAGVMMCPYSKTADGFETHMGVNXXXXXXXXXXX 634
           + D +SIRA       E   L +L+NNA +     + T    +  + +            
Sbjct: 64  IIDLQSIRALCDFLRKEYGGLDVLVNNAAIAFQLDNPTPFHIQAELTMKTNFMGTRNVCT 123

Query: 635 XXXXKESAPSRVVNVSS 685
                     RVVNVSS
Sbjct: 124 ELLPLIKPQGRVVNVSS 140


>ref|NP_998992.1| carbonyl reductase [Sus scrofa]
          Length = 244

 Score = 53.1 bits (126), Expect = 2e-08
 Identities = 58/198 (29%), Positives = 83/198 (41%), Gaps = 3/198 (1%)
 Frame = +2

Query: 275 GKVAVVTGANTGIGKETAKELAKRGARVYLACRDVQKGESVAREIQNMTGNQQVLVRKLD 454
           G  A+VTGA  GIG++T K L   GARV    R    G+ V+   Q   G + V V   D
Sbjct: 7   GLRALVTGAGKGIGRDTVKALHVSGARVVAVTR--TNGDLVSLS-QECPGIEPVCV---D 60

Query: 455 LADTKSIRAFAKGFLAEEKHLHILINNAGV-MMCPY-SKTADGFETHMGVNXXXXXXXXX 628
           L D ++      G       + +L+NNA V +M P+   T + F+    VN         
Sbjct: 61  LGDWEATERALGGV----GPVDLLVNNAAVALMQPFLDTTKEVFDRSFNVNLRSVFQVSQ 116

Query: 629 XXXXXXKE-SAPSRVVNVSSLAHHMGRIHFHNLQGEKFYHAGLAYCNSKLANVLFTQELA 805
                  E   P  +VNVSS+  H+             Y    AY ++K A  + T+ +A
Sbjct: 117 IVARSMIERGVPGSIVNVSSMVSHV------------TYPGLAAYSSTKGAMTMLTKSMA 164

Query: 806 RRLKGSGVTTYSVHPGTV 859
             L    +   SV+P  V
Sbjct: 165 MELGPHKIRVNSVNPTVV 182


  Database: RefSeqSP
    Posted date:  Aug 1, 2006  7:14 PM
  Number of letters in database: 434,620
  Number of sequences in database:  1040
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,421,594
Number of Sequences: 1040
Number of extensions: 37307
Number of successful extensions: 112
Number of sequences better than 1.0e-05: 2
Number of HSP's better than  0.0 without gapping: 100
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 110
length of database: 434,620
effective HSP length: 80
effective length of database: 351,420
effective search space used: 143730780
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqBP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611C-001157
         (1470 letters)

Database: RefSeqBP 
           33,508 sequences; 16,112,626 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|XP_870721.1| PREDICTED: similar to Retinol dehydrogenase 11 ...   464   e-131
Alignment   gi|XP_582373.2| PREDICTED: similar to Retinol dehydrogenase 11 ...   458   e-129
Alignment   gi|NP_899207.1| double substrate-specificity short chain dehydr...   413   e-115
Alignment   gi|XP_592820.2| PREDICTED: similar to retinol dehydrogenase 11 ...   239   3e-63
Alignment   gi|XP_582319.2| PREDICTED: similar to retinol dehydrogenase 14 ...   229   3e-60
Alignment   gi|XP_584642.2| PREDICTED: similar to retinol dehydrogenase 11 ...   176   3e-44
Alignment   gi|XP_584629.2| PREDICTED: similar to Retinol dehydrogenase 13,...   143   3e-34
Alignment   gi|XP_591168.2| PREDICTED: similar to dehydrogenase/reductase (...   135   6e-32
Alignment   gi|XP_584810.2| PREDICTED: similar to retinol dehydrogenase 13 ...   121   2e-27
Alignment   gi|XP_583859.2| PREDICTED: similar to short chain dehydrogenase...   115   7e-26

>ref|XP_870721.1| PREDICTED: similar to Retinol dehydrogenase 11 (Retinal reductase 1)
            (RalR1) (Prostate short-chain dehydrogenase/reductase 1)
            (Androgen-regulated short-chain dehydrogenase/reductase
            1) (HCV core-binding protein HCBP12) isoform 2 [Bos
            taurus]
          Length = 314

 Score =  464 bits (1194), Expect(2) = e-131
 Identities = 230/303 (75%), Positives = 259/303 (85%)
 Frame = +2

Query: 233  MLSSGVCTSTVQLPGKVAVVTGANTGIGKETAKELAKRGARVYLACRDVQKGESVAREIQ 412
            MLSSGVCTST+QLPGKVAVVTGAN GIGKETAKELA+RGARVYLACRDVQ GE VAREIQ
Sbjct: 1    MLSSGVCTSTIQLPGKVAVVTGANAGIGKETAKELARRGARVYLACRDVQNGELVAREIQ 60

Query: 413  NMTGNQQVLVRKLDLADTKSIRAFAKGFLAEEKHLHILINNAGVMMCPYSKTADGFETHM 592
             MTGNQQVLVRKLDLADTKSIRAFAK FL + K++H++ ++   ++C +  ++ G ++  
Sbjct: 61   MMTGNQQVLVRKLDLADTKSIRAFAKRFLEDHKYIHLINSSPHFLICGFPGSSAGKDSAC 120

Query: 593  GVNXXXXXXXXXXXXXXXKESAPSRVVNVSSLAHHMGRIHFHNLQGEKFYHAGLAYCNSK 772
                              +ESAPSRVVNVSSLAH +GRIHFHNLQGEKFY +GLAYC+SK
Sbjct: 121  NTGYLGHFLLTHLLLEKLEESAPSRVVNVSSLAHLLGRIHFHNLQGEKFYQSGLAYCHSK 180

Query: 773  LANVLFTQELARRLKGSGVTTYSVHPGTVDSELVRHSSLLRWIWWLFSFFIKTPQQGAQT 952
            LAN+LFTQELARRLKGSGVT YSVHPGTV+SELVRHS+L+RWIWW+FSFFIKTPQQGAQT
Sbjct: 181  LANILFTQELARRLKGSGVTVYSVHPGTVNSELVRHSALMRWIWWIFSFFIKTPQQGAQT 240

Query: 953  SLYCALTEGLEVLSGNHFSDCHVAWVSAQARNETVARRLWDVSRDLLGIPMD*RVMAVGP 1132
            SLYCALTEGLEVLSGNHFSDCHVAWVSAQARNETVARRLWDVS DLLGIP+D  +MA GP
Sbjct: 241  SLYCALTEGLEVLSGNHFSDCHVAWVSAQARNETVARRLWDVSCDLLGIPVDWLMMAAGP 300

Query: 1133 REA 1141
            + +
Sbjct: 301  KRS 303



 Score = 25.0 bits (53), Expect(2) = e-131
 Identities = 10/14 (71%), Positives = 13/14 (92%)
 Frame = +1

Query: 1132 KRSLQHTTQYSLPK 1173
            KRSL+ TTQ++LPK
Sbjct: 301  KRSLKQTTQHTLPK 314


>ref|XP_582373.2| PREDICTED: similar to Retinol dehydrogenase 11 (Retinal reductase 1)
            (RalR1) (Prostate short-chain dehydrogenase/reductase 1)
            (Androgen-regulated short-chain dehydrogenase/reductase
            1) (HCV core-binding protein HCBP12) isoform 1 [Bos
            taurus]
          Length = 308

 Score =  458 bits (1178), Expect(2) = e-129
 Identities = 233/303 (76%), Positives = 257/303 (84%)
 Frame = +2

Query: 233  MLSSGVCTSTVQLPGKVAVVTGANTGIGKETAKELAKRGARVYLACRDVQKGESVAREIQ 412
            MLSSGVCTST+QLPGKVAVVTGAN GIGKETAKELA+RGARVYLACRDVQ GE VAREIQ
Sbjct: 1    MLSSGVCTSTIQLPGKVAVVTGANAGIGKETAKELARRGARVYLACRDVQNGELVAREIQ 60

Query: 413  NMTGNQQVLVRKLDLADTKSIRAFAKGFLAEEKHLHILINNAGVMMCPYSKTADGFETHM 592
             MTGNQQVLVRKLDLADTKSIRAFAK FL + K++H LIN+ G     +  ++ G ++  
Sbjct: 61   MMTGNQQVLVRKLDLADTKSIRAFAKRFLEDHKYIH-LINSVG-----FPGSSAGKDSAC 114

Query: 593  GVNXXXXXXXXXXXXXXXKESAPSRVVNVSSLAHHMGRIHFHNLQGEKFYHAGLAYCNSK 772
                              +ESAPSRVVNVSSLAH +GRIHFHNLQGEKFY +GLAYC+SK
Sbjct: 115  NTGYLGHFLLTHLLLEKLEESAPSRVVNVSSLAHLLGRIHFHNLQGEKFYQSGLAYCHSK 174

Query: 773  LANVLFTQELARRLKGSGVTTYSVHPGTVDSELVRHSSLLRWIWWLFSFFIKTPQQGAQT 952
            LAN+LFTQELARRLKGSGVT YSVHPGTV+SELVRHS+L+RWIWW+FSFFIKTPQQGAQT
Sbjct: 175  LANILFTQELARRLKGSGVTVYSVHPGTVNSELVRHSALMRWIWWIFSFFIKTPQQGAQT 234

Query: 953  SLYCALTEGLEVLSGNHFSDCHVAWVSAQARNETVARRLWDVSRDLLGIPMD*RVMAVGP 1132
            SLYCALTEGLEVLSGNHFSDCHVAWVSAQARNETVARRLWDVS DLLGIP+D  +MA GP
Sbjct: 235  SLYCALTEGLEVLSGNHFSDCHVAWVSAQARNETVARRLWDVSCDLLGIPVDWLMMAAGP 294

Query: 1133 REA 1141
            + +
Sbjct: 295  KRS 297



 Score = 25.0 bits (53), Expect(2) = e-129
 Identities = 10/14 (71%), Positives = 13/14 (92%)
 Frame = +1

Query: 1132 KRSLQHTTQYSLPK 1173
            KRSL+ TTQ++LPK
Sbjct: 295  KRSLKQTTQHTLPK 308


>ref|NP_899207.1| double substrate-specificity short chain dehydrogenase/reductase 2
            [Bos taurus]
          Length = 316

 Score =  413 bits (1061), Expect = e-115
 Identities = 206/298 (69%), Positives = 240/298 (80%)
 Frame = +2

Query: 206  YIAVPQIRKMLSSGVCTSTVQLPGKVAVVTGANTGIGKETAKELAKRGARVYLACRDVQK 385
            Y+  P IRK  + GVC + VQL GKV V+TGANTGIGKETA+ELA+RGARVY+ACRDV K
Sbjct: 16   YVIAPSIRKFFAGGVCRTDVQLFGKVVVITGANTGIGKETARELARRGARVYIACRDVLK 75

Query: 386  GESVAREIQNMTGNQQVLVRKLDLADTKSIRAFAKGFLAEEKHLHILINNAGVMMCPYSK 565
            GES A EIQ  T N QVLVRKLDL+DTKSIRAFA+GFLAEEK LHILINNAGVM+CPYSK
Sbjct: 76   GESAASEIQADTKNSQVLVRKLDLSDTKSIRAFAEGFLAEEKQLHILINNAGVMLCPYSK 135

Query: 566  TADGFETHMGVNXXXXXXXXXXXXXXXKESAPSRVVNVSSLAHHMGRIHFHNLQGEKFYH 745
            TADGFETH+ VN               KESAP+RVVN+SS+AHH+G+I FH+LQG+K+Y+
Sbjct: 136  TADGFETHLAVNHLGHFLLTHLLLGRLKESAPARVVNLSSVAHHLGKIRFHDLQGDKYYN 195

Query: 746  AGLAYCNSKLANVLFTQELARRLKGSGVTTYSVHPGTVDSELVRHSSLLRWIWWLFSFFI 925
             G AYC+SKLANVLFT+ELA+RLKG+GVTTY+VHPG V S+LVRHS LL  +W LFS F+
Sbjct: 196  LGFAYCHSKLANVLFTRELAKRLKGTGVTTYAVHPGIVRSKLVRHSFLLCLLWRLFSPFL 255

Query: 926  KTPQQGAQTSLYCALTEGLEVLSGNHFSDCHVAWVSAQARNETVARRLWDVSRDLLGI 1099
            KT  +GAQTSL+CAL EGLE LSG +FSDC   WVS +ARN   A RLW+VS +LLGI
Sbjct: 256  KTTWEGAQTSLHCALAEGLEPLSGKYFSDCKKTWVSPRARNNKTAERLWNVSCELLGI 313


>ref|XP_592820.2| PREDICTED: similar to retinol dehydrogenase 11 (predicted) [Bos
            taurus]
          Length = 377

 Score =  239 bits (611), Expect = 3e-63
 Identities = 140/291 (48%), Positives = 180/291 (61%), Gaps = 8/291 (2%)
 Frame = +2

Query: 251  CTSTVQLPGKVAVVTGANTGIGKETAKELAKRGARVYLACRDVQKGESVAREIQNMTGNQ 430
            C     L G+ AVVTGAN+GIGK TA ELA+RGARV LACR  ++GE+ A +++  +GN 
Sbjct: 28   CRGLASLRGRTAVVTGANSGIGKMTALELARRGARVVLACRSRERGEAAAFDLRQESGNN 87

Query: 431  QVLVRKLDLADTKSIRAFAKGFLAEEKHLHILINNAGVMMCPYSKTADGFETHMGVNXXX 610
            +V+   LDLA   S+RAFA  FL+ E  L ILI+NAG+  C   +T + F   + VN   
Sbjct: 88   EVIFMALDLASLASVRAFATAFLSSEPRLDILIHNAGISSC--GRTREPFNLLLRVNHIG 145

Query: 611  XXXXXXXXXXXXKESAPSRVVNVSSLAHHMGRIHFHNLQGE--KFYHAGLAYCNSKLANV 784
                        K SAPSRVV VSS AH  GR+ F  L      +     AY NSKLANV
Sbjct: 146  PFLLTHLLLPRLKTSAPSRVVVVSSAAHRRGRLDFTRLDHPVVGWQQELRAYANSKLANV 205

Query: 785  LFTQELARRLKGSGVTTYSVHPGTVDSEL-VRH-----SSLLRWIWWLFSFFIKTPQQGA 946
            LF +ELA +L+G+GVT Y+ HPG V+SEL +RH       LLR + WL    ++ P+ GA
Sbjct: 206  LFARELATQLEGTGVTCYAAHPGPVNSELFLRHVPGWLRPLLRPLAWL---VLRAPRGGA 262

Query: 947  QTSLYCALTEGLEVLSGNHFSDCHVAWVSAQARNETVARRLWDVSRDLLGI 1099
            QT LYCAL EG+E LSG +F++CHV  V   AR++  A RLW+ SR L G+
Sbjct: 263  QTPLYCALQEGIEPLSGRYFANCHVEEVPPAARDDRAAHRLWEASRKLAGL 313


>ref|XP_582319.2| PREDICTED: similar to retinol dehydrogenase 14 (all-trans and 9-cis)
            [Bos taurus]
          Length = 420

 Score =  229 bits (585), Expect = 3e-60
 Identities = 124/292 (42%), Positives = 176/292 (60%), Gaps = 17/292 (5%)
 Frame = +2

Query: 275  GKVAVVTGANTGIGKETAKELAKRGARVYLACRDVQKGESVAREIQ-------------N 415
            GK  ++TGAN+G+G+ TA EL + GARV + CRD ++ E  A +++             N
Sbjct: 127  GKTVLITGANSGLGRATAAELLRLGARVIMGCRDRERAEEAAGQLRREVCPAGGPDSGPN 186

Query: 416  MTGNQQVLVRKLDLADTKSIRAFAKGFLAEEKHLHILINNAGVMMCPYSKTADGFETHMG 595
              G  +++V++LDLA   S+R+F +  L EE  L +LINNAGV  CPY KT DGFE   G
Sbjct: 187  SGGAGELVVKELDLASLSSVRSFCQEMLQEEPRLDVLINNAGVFQCPYMKTEDGFEMQFG 246

Query: 596  VNXXXXXXXXXXXXXXXKESAPSRVVNVSSLAHHMGRIHFHNLQGEKFYHAGLAYCNSKL 775
            VN               K SAPSR+V VSS  +  G I+F +L  E+ Y+    Y  SKL
Sbjct: 247  VNHLGHFLLTNLLLGLLKSSAPSRIVVVSSKLYKYGDINFEDLNSEQSYNKSFCYSRSKL 306

Query: 776  ANVLFTQELARRLKGSGVTTYSVHPGTVDSELVRHSSLLRWIWWLFSF----FIKTPQQG 943
            AN+LFT+ELARRL+G+ VT   +HPG V + L RH  +   +  LF+     F KTP++G
Sbjct: 307  ANILFTRELARRLEGTSVTVNVLHPGIVRTNLGRHIHIPLLVRPLFNLVSWAFFKTPEEG 366

Query: 944  AQTSLYCALTEGLEVLSGNHFSDCHVAWVSAQARNETVARRLWDVSRDLLGI 1099
            AQT++Y A +  +E +SG +F DC    +  +A +E+VAR+LWD+S  ++GI
Sbjct: 367  AQTAVYLASSPEVEGVSGRYFGDCKEEELLPKAMDESVARKLWDISEVMVGI 418


>ref|XP_584642.2| PREDICTED: similar to retinol dehydrogenase 11 (predicted) [Bos
            taurus]
          Length = 330

 Score =  176 bits (447), Expect = 3e-44
 Identities = 108/277 (38%), Positives = 158/277 (57%), Gaps = 3/277 (1%)
 Frame = +2

Query: 260  TVQLPGKVAVVTGANTGIGKETAKELAKRGARVYLACRDVQKGESVAREIQNMTGNQQVL 439
            +  L GK AVVTGAN+GIGK  ++ELA RGARV LACR  ++G+    EIQ  + + ++L
Sbjct: 44   STDLTGKTAVVTGANSGIGKAVSQELAHRGARVILACRSRERGQQALAEIQATSKSNRLL 103

Query: 440  VRKLDLADTKSIRAFAKGFLAEEKHLHILINNAGVMMCPYSKTADGFETHMGVNXXXXXX 619
            + ++DL+   SIR+FA+  L E   +H+L+NNA V   P + T +G +     N      
Sbjct: 104  LGEVDLSSMASIRSFAQRLLQECPEIHLLVNNAAVCGFPTTLTPEGLDLTFATNYTGPFL 163

Query: 620  XXXXXXXXXKESAPSRVVNVSSLAHHMGRIHFHNLQGE-KFYHAGLAYCNSKLANVLFTQ 796
                     + +  +RVVNVSS     G I   +L G  +       Y  SKL    FT 
Sbjct: 164  LTNLLQGALQRAGSARVVNVSSFRQSHGYIDEDHLIGAGRPLTFNQNYDCSKLLLASFTG 223

Query: 797  ELARRLKGSGVTTYSVHPGTVDSELVRHSS-LLRWIWWLFSFFIKTPQQGAQTSLYCALT 973
            +LA+RL+G+GVT  SV PG V +++++H S   R+++WL SFF K  +QGA   LY +L 
Sbjct: 224  KLAQRLQGTGVTVNSVDPGVVYTKIMKHFSWSYRFLFWLLSFFFKDSKQGAVPVLYLSLA 283

Query: 974  EGLEVLSGNHF-SDCHVAWVSAQARNETVARRLWDVS 1081
            + L+ +SG HF S C +      A++  VA+ LW+ S
Sbjct: 284  KELDGISGKHFSSSCVITLPPEAAQDPHVAQSLWNTS 320


>ref|XP_584629.2| PREDICTED: similar to Retinol dehydrogenase 13, partial [Bos
           taurus]
          Length = 148

 Score =  143 bits (361), Expect = 3e-34
 Identities = 70/126 (55%), Positives = 88/126 (69%)
 Frame = +2

Query: 224 IRKMLSSGVCTSTVQLPGKVAVVTGANTGIGKETAKELAKRGARVYLACRDVQKGESVAR 403
           ++  ++ G C S   +PGK  +VTGANTGIGK+TA ELAKRG  + LACRD++K E+ A+
Sbjct: 21  LKDFVAGGACPSKATIPGKTVIVTGANTGIGKQTALELAKRGGNIILACRDMEKCEAAAK 80

Query: 404 EIQNMTGNQQVLVRKLDLADTKSIRAFAKGFLAEEKHLHILINNAGVMMCPYSKTADGFE 583
           EI+  T N +V  R LDLA  KSIR FA     EE+H+HILINNA VM CP+  T DGFE
Sbjct: 81  EIRGETLNHRVNARHLDLASLKSIREFAAKVTEEEEHVHILINNAAVMRCPHWTTEDGFE 140

Query: 584 THMGVN 601
             +GVN
Sbjct: 141 MQLGVN 146


>ref|XP_591168.2| PREDICTED: similar to dehydrogenase/reductase (SDR family) X-linked
            [Bos taurus]
          Length = 251

 Score =  135 bits (341), Expect = 6e-32
 Identities = 90/228 (39%), Positives = 120/228 (52%), Gaps = 12/228 (5%)
 Frame = +2

Query: 452  DLADTKSIRAFAKGFLAEEKHLHILINNAGVMMCPYSKTADGFETHMGVNXXXXXXXXXX 631
            DLA  +SIR F + F  ++  LH+L+NNAGVMM P   T DGFE H GVN          
Sbjct: 11   DLASMRSIREFVQTFKMKKLPLHVLVNNAGVMMVPQRTTEDGFEEHFGVNYLGHFLLTNL 70

Query: 632  XXXXXKES-AP---SRVVNVSSLAHHMGRIHFHNLQGEKFYHAGLAYCNSKLANVLFTQE 799
                 +ES AP   +RVV VSS  H++G ++  +LQ   +Y A  AY  SKLA VLFT  
Sbjct: 71   LLDTLQESGAPGHSARVVTVSSATHYVGELNLDDLQSSTYYSAHAAYAQSKLALVLFTYH 130

Query: 800  LARRLKGSG--VTTYSVHPGTVDSELVRH----SSLLRWI--WWLFSFFIKTPQQGAQTS 955
            L   L   G  VT     PG VD++L R+    + L++ +  WW+F    KTP +GA TS
Sbjct: 131  LQALLTAQGMPVTASVADPGVVDTDLYRYVFWGTRLVKKLLGWWVF----KTPDEGAWTS 186

Query: 956  LYCALTEGLEVLSGNHFSDCHVAWVSAQARNETVARRLWDVSRDLLGI 1099
            +Y A+T  LE L G +  +           +  + R+LW  S  L GI
Sbjct: 187  VYAAVTPALEGLGGRYLYNEKETRSLEATYDPELQRQLWARSCQLTGI 234


>ref|XP_584810.2| PREDICTED: similar to retinol dehydrogenase 13 (all-trans and 9-cis)
            [Bos taurus]
          Length = 223

 Score =  121 bits (303), Expect = 2e-27
 Identities = 73/163 (44%), Positives = 100/163 (61%), Gaps = 10/163 (6%)
 Frame = +2

Query: 647  KESAPSRVVNVSSLAHHMGRIHFHNLQGEKF-YHAGLAYCNSKLANVLFTQELARRLKGS 823
            K SAPSR++NVSSLAH  G I F +L  EK  Y    AYC SKLA V+ T+EL+RRL+G+
Sbjct: 50   KASAPSRIINVSSLAHVAGHIDFEDLNWEKRKYDTKAAYCQSKLAVVVSTKELSRRLQGT 109

Query: 824  GVTTYSVHPGTVDSELVRHSSL---------LRWIWWLFSFFIKTPQQGAQTSLYCALTE 976
            GVT  ++HPG   +EL RH+ +         L  I+WL    +K+P+  AQ S+Y A+ E
Sbjct: 110  GVTVNALHPGVARTELGRHTGMHSSAFSSFTLGPIFWL---LVKSPELAAQPSVYLAVAE 166

Query: 977  GLEVLSGNHFSDCHVAWVSAQARNETVARRLWDVSRDLLGIPM 1105
             LE +SG +F        + +A +E VA+RLW  S  L+G+ M
Sbjct: 167  ELEGVSGKYFDVLKEKPPAPEAEDEEVAKRLWAESVRLVGLEM 209


>ref|XP_583859.2| PREDICTED: similar to short chain dehydrogenase/reductase [Bos
            taurus]
          Length = 317

 Score =  115 bits (289), Expect = 7e-26
 Identities = 83/252 (32%), Positives = 123/252 (48%), Gaps = 2/252 (0%)
 Frame = +2

Query: 263  VQLPGKVAVVTGANTGIGKETAKELAKRGARVYLACRDVQKGESVAREIQNMTGNQQVLV 442
            VQ+PG+  +VTG N+GIGK TA E+AKRG  V+L CRD  + E    EI   +GNQ + +
Sbjct: 36   VQVPGRAFMVTGGNSGIGKATAMEIAKRGGTVHLVCRDHSRAEGAKAEIIRESGNQNIFL 95

Query: 443  RKLDLADTKSIRAFAKGFLAEEKHLHILINNAGVMMCPYSKTADGFETHMGVNXXXXXXX 622
              +DL+  KS+  F + F  +E  L++LINNAG M+     T DG E +   N       
Sbjct: 96   HIVDLSLPKSVWKFVENF-KQEHTLNVLINNAGCMVNKRELTEDGLEKNFATNTLGVYVL 154

Query: 623  XXXXXXXXKESAPSRVVNVSSLAHHMGRIHFHNLQGEKFYHAG-LAYCNSKLANVLFTQE 799
                    ++    RV+ VSS    + +++  + Q E+    G + Y  +K   V+ T+ 
Sbjct: 155  TTALIPVLEKEHDPRVITVSSGGMLVQKLNTDDPQSERTAFDGTMVYAQNKRQQVVLTER 214

Query: 800  LARRLKGSGVTTYSVHPGTVDSELVRHSSLLRWIWWLFSFFIKTPQQGAQTSLYCALTEG 979
             AR      +    +HPG VD+  VR S  +          +++  QGA T L+ AL   
Sbjct: 215  WAR--AHPAIHFSCMHPGWVDTPGVRLS--MPGFHARLGARLRSEAQGADTVLWLALAPA 270

Query: 980  LEVL-SGNHFSD 1012
                 SG  F D
Sbjct: 271  ATAQPSGCFFQD 282


  Database: RefSeqBP
    Posted date:  Aug 1, 2006  7:14 PM
  Number of letters in database: 16,112,626
  Number of sequences in database:  33,508
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 52,276,713
Number of Sequences: 33508
Number of extensions: 1405038
Number of successful extensions: 4070
Number of sequences better than 1.0e-05: 10
Number of HSP's better than  0.0 without gapping: 3570
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4029
length of database: 16,112,626
effective HSP length: 105
effective length of database: 12,594,286
effective search space used: 4836205824
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqHP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611C-001157
         (1470 letters)

Database: RefSeqHP 
           39,411 sequences; 17,774,539 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_057110.2| androgen-regulated short-chain dehydrogenase/re...   530   e-150
Alignment   gi|NP_689656.1| retinol dehydrogenase 12 (all-trans and 9-cis) ...   415   e-116
Alignment   gi|NP_065956.1| retinol dehydrogenase 14 (all-trans and 9-cis) ...   229   3e-60
Alignment   gi|NP_653284.1| hypothetical protein LOC147015 [Homo sapiens]        202   5e-52
Alignment   gi|NP_612421.1| retinol dehydrogenase 13 (all-trans and 9-cis) ...   188   1e-47
Alignment   gi|NP_057457.1| WW domain-containing oxidoreductase isoform 1 [...   179   7e-45
Alignment   gi|NP_660160.1| dehydrogenase/reductase (SDR family) X-linked [...   168   1e-41
Alignment   gi|XP_371503.3| PREDICTED: similar to short-chain dehydrogenase...    91   2e-18
Alignment   gi|XP_947127.1| PREDICTED: similar to short-chain dehydrogenase...    91   2e-18
Alignment   gi|NP_078981.1| hypothetical protein FLJ13639 isoform 2 [Homo s...    71   2e-12

>ref|NP_057110.2| androgen-regulated short-chain dehydrogenase/reductase 1 [Homo
            sapiens]
          Length = 318

 Score =  530 bits (1364), Expect = e-150
 Identities = 257/301 (85%), Positives = 276/301 (91%)
 Frame = +2

Query: 206  YIAVPQIRKMLSSGVCTSTVQLPGKVAVVTGANTGIGKETAKELAKRGARVYLACRDVQK 385
            Y+A PQIRKMLSSGVCTSTVQLPGKV VVTGANTGIGKETAKELA+RGARVYLACRDV+K
Sbjct: 18   YMAAPQIRKMLSSGVCTSTVQLPGKVVVVTGANTGIGKETAKELAQRGARVYLACRDVEK 77

Query: 386  GESVAREIQNMTGNQQVLVRKLDLADTKSIRAFAKGFLAEEKHLHILINNAGVMMCPYSK 565
            GE VA+EIQ  TGNQQVLVRKLDL+DTKSIRAFAKGFLAEEKHLH+LINNAGVMMCPYSK
Sbjct: 78   GELVAKEIQTTTGNQQVLVRKLDLSDTKSIRAFAKGFLAEEKHLHVLINNAGVMMCPYSK 137

Query: 566  TADGFETHMGVNXXXXXXXXXXXXXXXKESAPSRVVNVSSLAHHMGRIHFHNLQGEKFYH 745
            TADGFE H+GVN               KESAPSR+VNVSSLAHH+GRIHFHNLQGEKFY+
Sbjct: 138  TADGFEMHIGVNHLGHFLLTHLLLEKLKESAPSRIVNVSSLAHHLGRIHFHNLQGEKFYN 197

Query: 746  AGLAYCNSKLANVLFTQELARRLKGSGVTTYSVHPGTVDSELVRHSSLLRWIWWLFSFFI 925
            AGLAYC+SKLAN+LFTQELARRLKGSGVTTYSVHPGTV SELVRHSS +RW+WWLFSFFI
Sbjct: 198  AGLAYCHSKLANILFTQELARRLKGSGVTTYSVHPGTVQSELVRHSSFMRWMWWLFSFFI 257

Query: 926  KTPQQGAQTSLYCALTEGLEVLSGNHFSDCHVAWVSAQARNETVARRLWDVSRDLLGIPM 1105
            KTPQQGAQTSL+CALTEGLE+LSGNHFSDCHVAWVS QARNET+ARRLWDVS DLLG+P+
Sbjct: 258  KTPQQGAQTSLHCALTEGLEILSGNHFSDCHVAWVSVQARNETIARRLWDVSCDLLGLPI 317

Query: 1106 D 1108
            D
Sbjct: 318  D 318


>ref|NP_689656.1| retinol dehydrogenase 12 (all-trans and 9-cis) [Homo sapiens]
          Length = 316

 Score =  415 bits (1066), Expect = e-116
 Identities = 209/298 (70%), Positives = 239/298 (80%)
 Frame = +2

Query: 206  YIAVPQIRKMLSSGVCTSTVQLPGKVAVVTGANTGIGKETAKELAKRGARVYLACRDVQK 385
            Y+  P IRK  + GVC + VQLPGKV V+TGANTGIGKETA+ELA RGARVY+ACRDV K
Sbjct: 16   YMVAPSIRKFFAGGVCRTNVQLPGKVVVITGANTGIGKETARELASRGARVYIACRDVLK 75

Query: 386  GESVAREIQNMTGNQQVLVRKLDLADTKSIRAFAKGFLAEEKHLHILINNAGVMMCPYSK 565
            GES A EI+  T N QVLVRKLDL+DTKSIRAFA+GFLAEEK LHILINNAGVMMCPYSK
Sbjct: 76   GESAASEIRVDTKNSQVLVRKLDLSDTKSIRAFAEGFLAEEKQLHILINNAGVMMCPYSK 135

Query: 566  TADGFETHMGVNXXXXXXXXXXXXXXXKESAPSRVVNVSSLAHHMGRIHFHNLQGEKFYH 745
            TADGFETH+GVN               K SAP+RVVNVSS+AHH+G+I FH+LQ EK Y 
Sbjct: 136  TADGFETHLGVNHLGHFLLTYLLLEQLKVSAPARVVNVSSVAHHIGKIPFHDLQSEKRYS 195

Query: 746  AGLAYCNSKLANVLFTQELARRLKGSGVTTYSVHPGTVDSELVRHSSLLRWIWWLFSFFI 925
             G AYC+SKLANVLFT+ELA+RL+G+GVTTY+VHPG V SELVRHSSLL  +W LFS F+
Sbjct: 196  RGFAYCHSKLANVLFTRELAKRLQGTGVTTYAVHPGVVRSELVRHSSLLCLLWRLFSPFV 255

Query: 926  KTPQQGAQTSLYCALTEGLEVLSGNHFSDCHVAWVSAQARNETVARRLWDVSRDLLGI 1099
            KT ++GAQTSL+CAL EGLE LSG +FSDC   WVS +ARN   A RLW+VS +LLGI
Sbjct: 256  KTAREGAQTSLHCALAEGLEPLSGKYFSDCKRTWVSPRARNNKTAERLWNVSCELLGI 313


>ref|NP_065956.1| retinol dehydrogenase 14 (all-trans and 9-cis) [Homo sapiens]
          Length = 336

 Score =  229 bits (585), Expect = 3e-60
 Identities = 124/292 (42%), Positives = 176/292 (60%), Gaps = 17/292 (5%)
 Frame = +2

Query: 275  GKVAVVTGANTGIGKETAKELAKRGARVYLACRDVQKGESVAREIQN------------- 415
            GK  ++TGAN+G+G+ TA EL + GARV + CRD  + E  A +++              
Sbjct: 43   GKTVLITGANSGLGRATAAELLRLGARVIMGCRDRARAEEAAGQLRRELRQAAECGPEPG 102

Query: 416  MTGNQQVLVRKLDLADTKSIRAFAKGFLAEEKHLHILINNAGVMMCPYSKTADGFETHMG 595
            ++G  +++VR+LDLA  +S+RAF +  L EE  L +LINNAG+  CPY KT DGFE   G
Sbjct: 103  VSGVGELIVRELDLASLRSVRAFCQEMLQEEPRLDVLINNAGIFQCPYMKTEDGFEMQFG 162

Query: 596  VNXXXXXXXXXXXXXXXKESAPSRVVNVSSLAHHMGRIHFHNLQGEKFYHAGLAYCNSKL 775
            VN               K SAPSR+V VSS  +  G I+F +L  E+ Y+    Y  SKL
Sbjct: 163  VNHLGHFLLTNLLLGLLKSSAPSRIVVVSSKLYKYGDINFDDLNSEQSYNKSFCYSRSKL 222

Query: 776  ANVLFTQELARRLKGSGVTTYSVHPGTVDSELVRHSSLLRWIWWLFSF----FIKTPQQG 943
            AN+LFT+ELARRL+G+ VT   +HPG V + L RH  +   +  LF+     F KTP +G
Sbjct: 223  ANILFTRELARRLEGTNVTVNVLHPGIVRTNLGRHIHIPLLVKPLFNLVSWAFFKTPVEG 282

Query: 944  AQTSLYCALTEGLEVLSGNHFSDCHVAWVSAQARNETVARRLWDVSRDLLGI 1099
            AQTS+Y A +  +E +SG +F DC    +  +A +E+VAR+LWD+S  ++G+
Sbjct: 283  AQTSIYLASSPEVEGVSGRYFGDCKEEELLPKAMDESVARKLWDISEVMVGL 334


>ref|NP_653284.1| hypothetical protein LOC147015 [Homo sapiens]
          Length = 327

 Score =  202 bits (515), Expect = 5e-52
 Identities = 120/267 (44%), Positives = 162/267 (60%), Gaps = 8/267 (2%)
 Frame = +2

Query: 323  TAKELAKRGARVYLACRDVQKGESVAREIQNMTGNQQVLVRKLDLADTKSIRAFAKGFLA 502
            TA ELA+RGARV LACR  ++GE+ A +++  +GN +V+   LDLA   S+RAFA  FL+
Sbjct: 2    TALELARRGARVVLACRSQERGEAAAFDLRQESGNNEVIFMALDLASLASVRAFATAFLS 61

Query: 503  EEKHLHILINNAGVMMCPYSKTADGFETHMGVNXXXXXXXXXXXXXXXKESAPSRVVNVS 682
             E  L ILI+NAG+  C   +T + F   + VN               K  APSRVV V+
Sbjct: 62   SEPRLDILIHNAGISSC--GRTREAFNLLLRVNHIGPFLLTHLLLPCLKACAPSRVVVVA 119

Query: 683  SLAHHMGRIHFHNLQGE--KFYHAGLAYCNSKLANVLFTQELARRLKGSGVTTYSVHPGT 856
            S AH  GR+ F  L      +     AY ++KLANVLF +ELA +L+ +GVT Y+ HPG 
Sbjct: 120  SAAHCRGRLDFKRLDRPVVGWRQELRAYADTKLANVLFARELANQLEATGVTCYAAHPGP 179

Query: 857  VDSEL-VRH-----SSLLRWIWWLFSFFIKTPQQGAQTSLYCALTEGLEVLSGNHFSDCH 1018
            V+SEL +RH       LLR + WL    ++ P+ GAQT LYCAL EG+E LSG +F++CH
Sbjct: 180  VNSELFLRHVPGWLRPLLRPLAWL---VLRAPRGGAQTPLYCALQEGIEPLSGRYFANCH 236

Query: 1019 VAWVSAQARNETVARRLWDVSRDLLGI 1099
            V  V   AR++  A RLW+ S+ L G+
Sbjct: 237  VEEVPPAARDDRAAHRLWEASKRLAGL 263


>ref|NP_612421.1| retinol dehydrogenase 13 (all-trans and 9-cis) [Homo sapiens]
          Length = 260

 Score =  188 bits (477), Expect = 1e-47
 Identities = 112/251 (44%), Positives = 148/251 (58%), Gaps = 10/251 (3%)
 Frame = +2

Query: 377  VQKGESVAREIQNMTGNQQVLVRKLDLADTKSIRAFAKGFLAEEKHLHILINNAGVMMCP 556
            ++K E+ A++I+  T N  V  R LDLA  KSIR FA   + EE+ + ILINNAGVM CP
Sbjct: 1    MEKCEAAAKDIRGETLNHHVNARHLDLASLKSIREFAAKIIEEEERVDILINNAGVMRCP 60

Query: 557  YSKTADGFETHMGVNXXXXXXXXXXXXXXXKESAPSRVVNVSSLAHHMGRIHFHNLQGE- 733
            +  T DGFE   GVN               K SAPSR++N+SSLAH  G I F +L  + 
Sbjct: 61   HWTTEDGFEMQFGVNHLGHFLLTNLLLDKLKASAPSRIINLSSLAHVAGHIDFDDLNWQT 120

Query: 734  KFYHAGLAYCNSKLANVLFTQELARRLKGSGVTTYSVHPGTVDSELVRH---------SS 886
            + Y+   AYC SKLA VLFT+EL+RRL+GSGVT  ++HPG   +EL RH         S+
Sbjct: 121  RKYNTKAAYCQSKLAIVLFTKELSRRLQGSGVTVNALHPGVARTELGRHTGIHGSTFSST 180

Query: 887  LLRWIWWLFSFFIKTPQQGAQTSLYCALTEGLEVLSGNHFSDCHVAWVSAQARNETVARR 1066
             L  I+WL    +K+P+  AQ S Y A+ E L  +SG +F        + +A +E VARR
Sbjct: 181  TLGPIFWL---LVKSPELAAQPSTYLAVAEELADVSGKYFDGLKQKAPAPEAEDEEVARR 237

Query: 1067 LWDVSRDLLGI 1099
            LW  S  L+G+
Sbjct: 238  LWAESARLVGL 248


>ref|NP_057457.1| WW domain-containing oxidoreductase isoform 1 [Homo sapiens]
          Length = 414

 Score =  179 bits (453), Expect = 7e-45
 Identities = 113/288 (39%), Positives = 152/288 (52%), Gaps = 15/288 (5%)
 Frame = +2

Query: 275  GKVAVVTGANTGIGKETAKELAKRGARVYLACRDVQKGESVAREIQNMTGNQQVLVRKLD 454
            GKV VVTGAN+GIG ETAK  A  GA V LACR++ +       I       +V    LD
Sbjct: 124  GKVVVVTGANSGIGFETAKSFALHGAHVILACRNMARASEAVSRILEEWHKAKVEAMTLD 183

Query: 455  LADTKSIRAFAKGFLAEEKHLHILINNAGVMMCPYSKTADGFETHMGVNXXXXXXXXXXX 634
            LA  +S++ FA+ F A+   LH+L+ NA     P+S T DG ET   VN           
Sbjct: 184  LALLRSVQHFAEAFKAKNVPLHVLVCNAATFALPWSLTKDGLETTFQVNHLGHFYLVQLL 243

Query: 635  XXXXKESAPSRVVNVSSLAHH-------MGRIHFHNLQGEK-FYHAGLAYCNSKLANVLF 790
                  SAP+RV+ VSS +H        +G++ F  L   K  Y A LAY  SKL N+LF
Sbjct: 244  QDVLCRSAPARVIVVSSESHRFTDINDSLGKLDFSRLSPTKNDYWAMLAYNRSKLCNILF 303

Query: 791  TQELARRLKGSGVTTYSVHPGTVDSELVRHSSLLRWIWWLFSF-------FIKTPQQGAQ 949
            + EL RRL   GVT+ +VHPG +    +  S      WW+++        F K+ QQGA 
Sbjct: 304  SNELHRRLSPRGVTSNAVHPGNMMYSNIHRS------WWVYTLLFTLARPFTKSMQQGAA 357

Query: 950  TSLYCALTEGLEVLSGNHFSDCHVAWVSAQARNETVARRLWDVSRDLL 1093
            T++YCA    LE L G +F++C     S +A++E  AR LW +S  L+
Sbjct: 358  TTVYCAAVPELEGLGGMYFNNCCRCMPSPEAQSEETARTLWALSERLI 405


>ref|NP_660160.1| dehydrogenase/reductase (SDR family) X-linked [Homo sapiens]
          Length = 330

 Score =  168 bits (425), Expect = 1e-41
 Identities = 109/290 (37%), Positives = 148/290 (51%), Gaps = 14/290 (4%)
 Frame = +2

Query: 272  PGKVAVVTGANTGIGKETAKELAKRGARVYLACRDVQKGESVAREIQNMTGNQQVLVRKL 451
            P +VA+VTG   GIG  TAK LA+ G  V +A  +  K + V  +I+  T N +V     
Sbjct: 42   PDRVAIVTGGTDGIGYSTAKHLARLGMHVIIAGNNDSKAKQVVSKIKEETLNDKVEFLYC 101

Query: 452  DLADTKSIRAFAKGFLAEEKHLHILINNAGVMMCPYSKTADGFETHMGVNXXXXXXXXXX 631
            DLA   SIR F + F  ++  LH+LINNAGVMM P  KT DGFE H G+N          
Sbjct: 102  DLASMTSIRQFVQKFKMKKIPLHVLINNAGVMMVPQRKTRDGFEEHFGLNYLGHFLLTNL 161

Query: 632  XXXXXKESA----PSRVVNVSSLAHHMGRIHFHNLQGEKFYHAGLAYCNSKLANVLFTQE 799
                 KES      +RVV VSS  H++  ++  +LQ    Y    AY  SKLA VLFT  
Sbjct: 162  LLDTLKESGSPGHSARVVTVSSATHYVAELNMDDLQSSACYSPHAAYAQSKLALVLFTYH 221

Query: 800  LARRL--KGSGVTTYSVHPGTVDSELVRH--------SSLLRWIWWLFSFFIKTPQQGAQ 949
            L R L  +GS VT   V PG V+++L +H          LL W+        KTP +GA 
Sbjct: 222  LQRLLAAEGSHVTANVVDPGVVNTDLYKHVFWATRLAKKLLGWL------LFKTPDEGAW 275

Query: 950  TSLYCALTEGLEVLSGNHFSDCHVAWVSAQARNETVARRLWDVSRDLLGI 1099
            TS+Y A+T  LE + G +  +           N+ + ++LW  S ++ G+
Sbjct: 276  TSIYAAVTPELEGVGGRYLYNEKETKSLHVTYNQKLQQQLWSKSCEMTGV 325


>ref|XP_371503.3| PREDICTED: similar to short-chain dehydrogenase/reductase 1 [Homo
           sapiens]
          Length = 891

 Score = 91.3 bits (225), Expect = 2e-18
 Identities = 50/120 (41%), Positives = 78/120 (65%), Gaps = 3/120 (2%)
 Frame = +2

Query: 233 MLSSGVCTSTVQ--LPGKVAVVTGANTGIGKETAKELAKRGARVYLACRDVQKGESVARE 406
           +LSSGV     +  L GK+A+VTGAN+GIGK  +++LA+ GA+V L C+  + G+    E
Sbjct: 586 LLSSGVPEQEDKEDLTGKIAIVTGANSGIGKVVSQDLARCGAQVILTCQSRECGQQALAE 645

Query: 407 IQNMTGNQQVLVRKLDLADTKSIRAFAKGFLAEEKHLHILINNAGVM-MCPYSKTADGFE 583
           IQ  + + ++L+ ++DL+   SIR+FA+  L E   +H+L+NNAGV  M P + T  G +
Sbjct: 646 IQAASNSNRLLLGEVDLSSMTSIRSFARRLLQENPEIHLLVNNAGVSGMIPKTLTPGGLD 705


>ref|XP_947127.1| PREDICTED: similar to short-chain dehydrogenase/reductase 1 [Homo
           sapiens]
          Length = 916

 Score = 91.3 bits (225), Expect = 2e-18
 Identities = 50/120 (41%), Positives = 78/120 (65%), Gaps = 3/120 (2%)
 Frame = +2

Query: 233 MLSSGVCTSTVQ--LPGKVAVVTGANTGIGKETAKELAKRGARVYLACRDVQKGESVARE 406
           +LSSGV     +  L GK+A+VTGAN+GIGK  +++LA+ GA+V L C+  + G+    E
Sbjct: 611 LLSSGVPEQEDKEDLTGKIAIVTGANSGIGKVVSQDLARCGAQVILTCQSRECGQQALAE 670

Query: 407 IQNMTGNQQVLVRKLDLADTKSIRAFAKGFLAEEKHLHILINNAGVM-MCPYSKTADGFE 583
           IQ  + + ++L+ ++DL+   SIR+FA+  L E   +H+L+NNAGV  M P + T  G +
Sbjct: 671 IQAASNSNRLLLGEVDLSSMTSIRSFARRLLQENPEIHLLVNNAGVSGMIPKTLTPGGLD 730


>ref|NP_078981.1| hypothetical protein FLJ13639 isoform 2 [Homo sapiens]
          Length = 242

 Score = 71.2 bits (173), Expect = 2e-12
 Identities = 53/211 (25%), Positives = 98/211 (46%), Gaps = 1/211 (0%)
 Frame = +2

Query: 377  VQKGESVAREIQNMTGNQQVLVRKLDLADTKSIRAFAKGFLAEEKHLHILINNAGVMMCP 556
            +++  ++A+++   + ++ + +  +DL+D K I  F + F  E K LH+LINNAG M+  
Sbjct: 25   LEETAALAKQLPLKSPSENIFLHIVDLSDPKQIWKFVENFKQEHK-LHVLINNAGCMVNK 83

Query: 557  YSKTADGFETHMGVNXXXXXXXXXXXXXXXKESAPSRVVNVSSLAHHMGRIHFHNLQGEK 736
               T DG E +   N               ++    RV+ VSS    + +++ ++LQ E+
Sbjct: 84   RELTEDGLEKNFAANTLGVYILTTGLIPVLEKEHDPRVITVSSGGMLVQKLNTNDLQSER 143

Query: 737  F-YHAGLAYCNSKLANVLFTQELARRLKGSGVTTYSVHPGTVDSELVRHSSLLRWIWWLF 913
              +   + Y  +K   V+ T+  A+      +   S+HPG  D+  VR +  +      F
Sbjct: 144  TPFDGTMVYAQNKRQQVVLTERWAQ--GHPAIHFSSMHPGWADTPGVRQA--MPGFHARF 199

Query: 914  SFFIKTPQQGAQTSLYCALTEGLEVLSGNHF 1006
               +++  QGA T L+ AL+          F
Sbjct: 200  GDRLRSEAQGADTMLWLALSSAAAAQPSGRF 230


  Database: RefSeqHP
    Posted date:  Aug 2, 2006 12:57 AM
  Number of letters in database: 17,774,539
  Number of sequences in database:  39,411
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 59,205,810
Number of Sequences: 39411
Number of extensions: 1630015
Number of successful extensions: 4469
Number of sequences better than 1.0e-05: 10
Number of HSP's better than  0.0 without gapping: 3876
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4436
length of database: 17,774,539
effective HSP length: 106
effective length of database: 13,596,973
effective search space used: 5207640659
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqCP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611C-001157
         (1470 letters)

Database: RefSeqCP 
           33,732 sequences; 19,266,565 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|XP_854354.1| PREDICTED: similar to Retinol dehydrogenase 11 ...   507   e-143
Alignment   gi|XP_547866.2| PREDICTED: similar to retinol dehydrogenase 12 ...   412   e-115
Alignment   gi|XP_854127.1| PREDICTED: similar to Retinol dehydrogenase 13 ...   253   3e-67
Alignment   gi|XP_548293.2| PREDICTED: similar to retinol dehydrogenase 11 ...   231   1e-60
Alignment   gi|XP_540096.2| PREDICTED: similar to retinol dehydrogenase 14 ...   228   2e-59
Alignment   gi|XP_533000.2| PREDICTED: similar to Retinol dehydrogenase 12 ...   184   3e-46
Alignment   gi|XP_857582.1| PREDICTED: similar to retinol dehydrogenase 14 ...   174   3e-43
Alignment   gi|XP_852222.1| PREDICTED: similar to dehydrogenase/reductase (...   174   3e-43
Alignment   gi|XP_852623.1| PREDICTED: similar to WW domain-containing oxid...   143   4e-34
Alignment   gi|XP_857503.1| PREDICTED: similar to retinol dehydrogenase 14 ...    63   8e-10

>ref|XP_854354.1| PREDICTED: similar to Retinol dehydrogenase 11 (Retinal reductase 1)
            (RalR1) (Prostate short-chain dehydrogenase/reductase 1)
            (Androgen-regulated short-chain dehydrogenase/reductase
            1) (HCV core-binding protein HCBP12) [Canis familiaris]
          Length = 337

 Score =  507 bits (1306), Expect = e-143
 Identities = 248/298 (83%), Positives = 269/298 (90%)
 Frame = +2

Query: 215  VPQIRKMLSSGVCTSTVQLPGKVAVVTGANTGIGKETAKELAKRGARVYLACRDVQKGES 394
            V ++ K+LS GVCTSTVQLPGKVAVVTGANTGIGKETAKELA+RGARVYLACRDV KGE 
Sbjct: 40   VDRLMKILSRGVCTSTVQLPGKVAVVTGANTGIGKETAKELAQRGARVYLACRDVLKGEL 99

Query: 395  VAREIQNMTGNQQVLVRKLDLADTKSIRAFAKGFLAEEKHLHILINNAGVMMCPYSKTAD 574
            VAREIQ MTGN+QVLVRKLDLADTKSIRAFAKGFLAEEKHLHILINNAGVMMCPY+KT D
Sbjct: 100  VAREIQTMTGNKQVLVRKLDLADTKSIRAFAKGFLAEEKHLHILINNAGVMMCPYTKTVD 159

Query: 575  GFETHMGVNXXXXXXXXXXXXXXXKESAPSRVVNVSSLAHHMGRIHFHNLQGEKFYHAGL 754
            GFE HMGVN               KESAPSR+VNVSSLAHH+GRIHFH+LQGEKFY++GL
Sbjct: 160  GFEMHMGVNHLGHFLLTHLLLEKLKESAPSRIVNVSSLAHHLGRIHFHDLQGEKFYNSGL 219

Query: 755  AYCNSKLANVLFTQELARRLKGSGVTTYSVHPGTVDSELVRHSSLLRWIWWLFSFFIKTP 934
            AYC+SKLAN+LFTQELARRLKGSG+T YSVHPGTV SELVRHS  ++W+WWLFSFFIKTP
Sbjct: 220  AYCHSKLANILFTQELARRLKGSGITAYSVHPGTVKSELVRHSPFMKWMWWLFSFFIKTP 279

Query: 935  QQGAQTSLYCALTEGLEVLSGNHFSDCHVAWVSAQARNETVARRLWDVSRDLLGIPMD 1108
            QQGAQTSLYCA+TEGLEVLSG+HFSDC VAWVSAQARNET+ARRLWDVS DLLGIP+D
Sbjct: 280  QQGAQTSLYCAITEGLEVLSGHHFSDCSVAWVSAQARNETIARRLWDVSCDLLGIPVD 337


>ref|XP_547866.2| PREDICTED: similar to retinol dehydrogenase 12 (all-trans and 9-cis)
            [Canis familiaris]
          Length = 303

 Score =  412 bits (1059), Expect = e-115
 Identities = 205/294 (69%), Positives = 239/294 (81%)
 Frame = +2

Query: 227  RKMLSSGVCTSTVQLPGKVAVVTGANTGIGKETAKELAKRGARVYLACRDVQKGESVARE 406
            RK  + GVC S VQLPGKV V+TGANTGIGKETA+ELA+RGARVY+ACRDV KGES A E
Sbjct: 10   RKFFAGGVCRSNVQLPGKVVVITGANTGIGKETARELARRGARVYIACRDVLKGESAASE 69

Query: 407  IQNMTGNQQVLVRKLDLADTKSIRAFAKGFLAEEKHLHILINNAGVMMCPYSKTADGFET 586
            I+  T N QVLVRKLDL+DTKSIRAFA+GFLAEEK LHILINNAGVMMCPYSKTADGFET
Sbjct: 70   IRADTKNSQVLVRKLDLSDTKSIRAFAEGFLAEEKQLHILINNAGVMMCPYSKTADGFET 129

Query: 587  HMGVNXXXXXXXXXXXXXXXKESAPSRVVNVSSLAHHMGRIHFHNLQGEKFYHAGLAYCN 766
            H+GVN               KES P+RVVN+SS+AHH+G+IHFH+LQGEK Y  G AYC+
Sbjct: 130  HLGVNHLGHFLLTHLLLERLKESTPARVVNLSSVAHHIGKIHFHDLQGEKRYSRGFAYCH 189

Query: 767  SKLANVLFTQELARRLKGSGVTTYSVHPGTVDSELVRHSSLLRWIWWLFSFFIKTPQQGA 946
            SKLAN+LFT+ELA+RL+G+GVTTY+VHPG V SELVRHS LL  +W +FS F+K+ ++GA
Sbjct: 190  SKLANMLFTRELAKRLQGTGVTTYAVHPGVVSSELVRHSFLLCLLWRIFSPFVKSAREGA 249

Query: 947  QTSLYCALTEGLEVLSGNHFSDCHVAWVSAQARNETVARRLWDVSRDLLGIPMD 1108
            QTSL+CAL EGLE LSG +FSDC  AWVS +AR+   A RLW+VS +LLGI  D
Sbjct: 250  QTSLHCALAEGLEPLSGKYFSDCKRAWVSPRARDNKTAERLWNVSCELLGIQWD 303


>ref|XP_854127.1| PREDICTED: similar to Retinol dehydrogenase 13 [Canis familiaris]
          Length = 334

 Score =  253 bits (647), Expect = 3e-67
 Identities = 141/304 (46%), Positives = 186/304 (61%), Gaps = 10/304 (3%)
 Frame = +2

Query: 224  IRKMLSSGVCTSTVQLPGKVAVVTGANTGIGKETAKELAKRGARVYLACRDVQKGESVAR 403
            +R  ++ G C S   +PGK  +VTGANTGIGK+TA ELA+RG  + LACRD++K E+ A+
Sbjct: 21   LRDYIAGGACPSKATIPGKTVIVTGANTGIGKQTALELARRGGNIILACRDMEKCEAAAK 80

Query: 404  EIQNMTGNQQVLVRKLDLADTKSIRAFAKGFLAEEKHLHILINNAGVMMCPYSKTADGFE 583
            EI+  T N +V    LDLA  KSIR FA   + EE+ +HIL+NNA VM CP+  T DGFE
Sbjct: 81   EIRGETLNHRVSAWHLDLASLKSIREFAAKIIEEEEQVHILVNNAAVMRCPHWTTKDGFE 140

Query: 584  THMGVNXXXXXXXXXXXXXXXKESAPSRVVNVSSLAHHMGRIHFHNLQGEK-FYHAGLAY 760
               GVN               K SAPSR++N+SSLAH  G I F +L  EK  Y    AY
Sbjct: 141  MQFGVNHLGHFLLTNLLLDKLKASAPSRIINLSSLAHVAGHIDFDDLNWEKRKYDTKAAY 200

Query: 761  CNSKLANVLFTQELARRLKGSGVTTYSVHPGTVDSELVRHSSL---------LRWIWWLF 913
            C SKLA +LFT+EL+RRL+G+GVT  ++HPG   +EL RH+ +         L  I+WL 
Sbjct: 201  CQSKLAVILFTKELSRRLQGTGVTVNALHPGVARTELGRHTGMHSSAFSSFTLGPIFWL- 259

Query: 914  SFFIKTPQQGAQTSLYCALTEGLEVLSGNHFSDCHVAWVSAQARNETVARRLWDVSRDLL 1093
               +K+PQ  AQ S Y A+ E LE +SG +F        + +A +E VA+RLW  S  L+
Sbjct: 260  --LVKSPQLAAQPSTYLAVAEELEGVSGKYFDGLKEKAPAPEAEDEEVAQRLWAESARLV 317

Query: 1094 GIPM 1105
            G+ M
Sbjct: 318  GLEM 321


>ref|XP_548293.2| PREDICTED: similar to retinol dehydrogenase 11 (predicted) [Canis
            familiaris]
          Length = 377

 Score =  231 bits (590), Expect = 1e-60
 Identities = 146/337 (43%), Positives = 193/337 (57%), Gaps = 9/337 (2%)
 Frame = +2

Query: 251  CTSTVQLPGKVAVVTGANTGIGKETAKELAKRGARVYLACRDVQKGESVAREIQNMTGNQ 430
            C     L G+ AVVTGAN+GIGK TA ELA+RGARV LACR  ++GE+ A +++  +GN 
Sbjct: 28   CGGIASLRGRTAVVTGANSGIGKMTALELARRGARVVLACRSRERGEAAAFDLRQESGNN 87

Query: 431  QVLVRKLDLADTKSIRAFAKGFLAEEKHLHILINNAGVMMCPYSKTADGFETHMGVNXXX 610
            +V+   LDLA   S+RAFA  FL+ E  L ILI+NAG+  C   +T   F   + VN   
Sbjct: 88   EVIFMALDLASLASVRAFATAFLSSEPRLDILIHNAGISSC--GRTHKPFNLLLRVNHIG 145

Query: 611  XXXXXXXXXXXXKESAPSRVVNVSSLAHHMGRIHFHNLQGE--KFYHAGLAYCNSKLANV 784
                        K  APSRVV VSS AH  GR+ F  L      +     AY +SKLANV
Sbjct: 146  PFLLTHLLLPRLKTCAPSRVVVVSSAAHRRGRLDFTRLDRPVVGWQQELRAYADSKLANV 205

Query: 785  LFTQELARRLKGSGVTTYSVHPGTVDSEL-VRH-----SSLLRWIWWLFSFFIKTPQQGA 946
            LF +ELA +L+G+GVT Y+ HPG V+SEL +RH       LLR + WL    ++ P+ GA
Sbjct: 206  LFARELATQLEGTGVTCYAAHPGPVNSELFLRHVPGWLCPLLRPLAWL---MLRAPRGGA 262

Query: 947  QTSLYCALTEGLEVLSGNHFSDCHVAWVSAQARNETVARRLWDVSRDLLGIPMD*RVMAV 1126
            QT LYCAL EG+E LSG +F++CHV  V   AR++  A +LW+ S+ L G+         
Sbjct: 263  QTPLYCALQEGIEPLSGRYFANCHVEEVPPAARDDRAAHQLWEASKRLAGL--------- 313

Query: 1127 GP-REACSTLLSTPCQNDSPSGWPKP*AQRLQTFHPC 1234
            GP ++A +   S P    +PS    P  +      PC
Sbjct: 314  GPGKDAEADEDSQPEDPRTPSSPSSPHPEEPTVSEPC 350


>ref|XP_540096.2| PREDICTED: similar to retinol dehydrogenase 14 (all-trans and 9-cis)
            isoform 1 [Canis familiaris]
          Length = 336

 Score =  228 bits (580), Expect = 2e-59
 Identities = 126/292 (43%), Positives = 175/292 (59%), Gaps = 17/292 (5%)
 Frame = +2

Query: 275  GKVAVVTGANTGIGKETAKELAKRGARVYLACRDVQKGESVA----REIQNMTGNQ---- 430
            GK  ++TGAN+G+G+ TA  L + GARV + CRD  + E  A    RE++   G +    
Sbjct: 43   GKTVLITGANSGLGRATAAALLRLGARVIMGCRDRARAEEAAGQLRRELRQAGGREPGSD 102

Query: 431  -----QVLVRKLDLADTKSIRAFAKGFLAEEKHLHILINNAGVMMCPYSKTADGFETHMG 595
                 +++VR+LDLA  +S+RAF +  L EE  L +LINNAG+  CPY KT DGFE   G
Sbjct: 103  VGAAGELVVRELDLASLRSVRAFCQEVLQEEPRLDVLINNAGIFQCPYMKTEDGFEMQFG 162

Query: 596  VNXXXXXXXXXXXXXXXKESAPSRVVNVSSLAHHMGRIHFHNLQGEKFYHAGLAYCNSKL 775
            VN               K SAPSR+V VSS  +  G I+F +L  E+ Y+    Y  SKL
Sbjct: 163  VNHLGHFLLTNLLLGLLKNSAPSRIVVVSSKLYKYGDINFEDLNSEQSYNKSFCYSRSKL 222

Query: 776  ANVLFTQELARRLKGSGVTTYSVHPGTVDSELVRHSSLLRWIWWLFSF----FIKTPQQG 943
            AN+LFT+ELARRL+G+ VT   +HPG V + L RH  +   +  LF+     F KTP +G
Sbjct: 223  ANILFTRELARRLEGTNVTVNVLHPGIVRTNLGRHIHIPLLVRPLFNLVSWAFFKTPVEG 282

Query: 944  AQTSLYCALTEGLEVLSGNHFSDCHVAWVSAQARNETVARRLWDVSRDLLGI 1099
            AQTS+Y A +  +E +SG +F DC    +  +A +E+VAR+LWD+S  ++GI
Sbjct: 283  AQTSVYLASSPEVEGVSGKYFGDCKEEELLPKAMDESVARKLWDISEVMVGI 334


>ref|XP_533000.2| PREDICTED: similar to Retinol dehydrogenase 12 [Canis familiaris]
          Length = 596

 Score =  184 bits (466), Expect = 3e-46
 Identities = 111/283 (39%), Positives = 164/283 (57%), Gaps = 3/283 (1%)
 Frame = +2

Query: 260  TVQLPGKVAVVTGANTGIGKETAKELAKRGARVYLACRDVQKGESVAREIQNMTGNQQVL 439
            +  L GK AVVTGAN+GIGK   +ELA+RGARV LACR+ ++G+    EIQ  +    +L
Sbjct: 310  STDLTGKTAVVTGANSGIGKAVCQELARRGARVILACRNWERGQKALAEIQVASKGTCLL 369

Query: 440  VRKLDLADTKSIRAFAKGFLAEEKHLHILINNAGVMMCPYSKTADGFETHMGVNXXXXXX 619
            + ++DL+   SIR+FA+  L E   +H+L+NNA +   P + T +G +     N      
Sbjct: 370  LGQVDLSSMASIRSFARWLLQEYPEIHLLVNNAAISGFPKTLTPEGLDLTFATNYVGPFL 429

Query: 620  XXXXXXXXXKESAPSRVVNVSSLAHHMGRIHFHNLQGE-KFYHAGLAYCNSKLANVLFTQ 796
                     + +  +RVVNVSS  H  G +   +L G  K  +   +Y  SKL    FT 
Sbjct: 430  LTNLLQGALQRAGSARVVNVSSFRHAHGYVDEKHLTGAGKPLNLIQSYDCSKLLLTSFTG 489

Query: 797  ELARRLKGSGVTTYSVHPGTVDSELVR-HSSLLRWIWWLFSFFIKTPQQGAQTSLYCALT 973
            ELARRL+G+GVT  SV PG V +E+++ +  L R+++WLFSFF K  +QGA   LY +L 
Sbjct: 490  ELARRLQGTGVTVNSVDPGVVYTEIMKPYPWLYRFLFWLFSFFCKDVKQGAIPVLYLSLA 549

Query: 974  EGLEVLSGNHF-SDCHVAWVSAQARNETVARRLWDVSRDLLGI 1099
            + L+ +SG +F S C +   +  A++  VA+ LW+ S  L  +
Sbjct: 550  KELDGVSGKYFSSSCMITLPTEAAQDPQVAQSLWNASVQLTNL 592


>ref|XP_857582.1| PREDICTED: similar to retinol dehydrogenase 14 (all-trans and 9-cis)
            isoform 4 [Canis familiaris]
          Length = 307

 Score =  174 bits (440), Expect = 3e-43
 Identities = 108/292 (36%), Positives = 155/292 (53%), Gaps = 17/292 (5%)
 Frame = +2

Query: 275  GKVAVVTGANTGIGKETAKELAKRGARVYLACRDVQKGESVA----REIQNMTGNQ---- 430
            GK  ++TGAN+G+G+ TA  L + GARV + CRD  + E  A    RE++   G +    
Sbjct: 43   GKTVLITGANSGLGRATAAALLRLGARVIMGCRDRARAEEAAGQLRRELRQAGGREPGSD 102

Query: 431  -----QVLVRKLDLADTKSIRAFAKGFLAEEKHLHILINNAGVMMCPYSKTADGFETHMG 595
                 +++VR+LDLA  +S+RAF +  L                               G
Sbjct: 103  VGAAGELVVRELDLASLRSVRAFCQEVL-----------------------------QFG 133

Query: 596  VNXXXXXXXXXXXXXXXKESAPSRVVNVSSLAHHMGRIHFHNLQGEKFYHAGLAYCNSKL 775
            VN               K SAPSR+V VSS  +  G I+F +L  E+ Y+    Y  SKL
Sbjct: 134  VNHLGHFLLTNLLLGLLKNSAPSRIVVVSSKLYKYGDINFEDLNSEQSYNKSFCYSRSKL 193

Query: 776  ANVLFTQELARRLKGSGVTTYSVHPGTVDSELVRHSSLLRWIWWLFSF----FIKTPQQG 943
            AN+LFT+ELARRL+G+ VT   +HPG V + L RH  +   +  LF+     F KTP +G
Sbjct: 194  ANILFTRELARRLEGTNVTVNVLHPGIVRTNLGRHIHIPLLVRPLFNLVSWAFFKTPVEG 253

Query: 944  AQTSLYCALTEGLEVLSGNHFSDCHVAWVSAQARNETVARRLWDVSRDLLGI 1099
            AQTS+Y A +  +E +SG +F DC    +  +A +E+VAR+LWD+S  ++GI
Sbjct: 254  AQTSVYLASSPEVEGVSGKYFGDCKEEELLPKAMDESVARKLWDISEVMVGI 305


>ref|XP_852222.1| PREDICTED: similar to dehydrogenase/reductase (SDR family) X-linked
            [Canis familiaris]
          Length = 387

 Score =  174 bits (440), Expect = 3e-43
 Identities = 117/288 (40%), Positives = 151/288 (52%), Gaps = 12/288 (4%)
 Frame = +2

Query: 272  PGKVAVVTGANTGIGKETAKELAKRGARVYLACRDVQKGESVAREIQNMTGNQQVLVRKL 451
            P +VA+VTG   GIG  TAK LA+ G  V LA  +      V R+IQ  T N +V     
Sbjct: 94   PERVAIVTGGTDGIGYSTAKHLARLGMHVILAGNNDSSAPDVVRKIQEETLNDKVEFLYC 153

Query: 452  DLADTKSIRAFAKGFLAEEKHLHILINNAGVMMCPYSKTADGFETHMGVNXXXXXXXXXX 631
            DLA  +SIR F + F  ++  LH+L+NNAGVMM P   T DGFE H G+N          
Sbjct: 154  DLASLRSIRQFVQKFKKKKIPLHVLVNNAGVMMVPERTTEDGFEEHFGLNYLGHFLLTNL 213

Query: 632  XXXXXKES-AP---SRVVNVSSLAHHMGRIHFHNLQGEKFYHAGLAYCNSKLANVLFTQE 799
                 KES AP   +RVV VSS  H++G +   +LQG + Y    AY  SKLA VLFT  
Sbjct: 214  LLDTLKESGAPGRCARVVTVSSATHYIGELDMDDLQGSRCYSPHAAYAQSKLALVLFTYH 273

Query: 800  LARRL--KGSGVTTYSVHPGTVDSELVRH----SSLLRWI--WWLFSFFIKTPQQGAQTS 955
            L R L  +GS VT   V PG V++ L RH    + L++ +  WW    F KTP +GA TS
Sbjct: 274  LQRLLAAQGSPVTANVVDPGVVNTNLYRHVFWGTRLIKKLFGWW----FFKTPDEGAWTS 329

Query: 956  LYCALTEGLEVLSGNHFSDCHVAWVSAQARNETVARRLWDVSRDLLGI 1099
            +Y A+T  LE L G +  +       A   +  +   LW  S  + GI
Sbjct: 330  VYAAVTPDLEGLGGRYLYNEKETKSLAVTYDLDLQTELWARSCQMTGI 377


>ref|XP_852623.1| PREDICTED: similar to WW domain-containing oxidoreductase isoform 1
           [Canis familiaris]
          Length = 383

 Score =  143 bits (361), Expect = 4e-34
 Identities = 93/243 (38%), Positives = 127/243 (52%), Gaps = 8/243 (3%)
 Frame = +2

Query: 275 GKVAVVTGANTGIGKETAKELAKRGARVYLACRDVQKGESVAREIQNMTGNQQVLVRKLD 454
           GKV VVTGAN+GIG ETAK  A  GA V LACR++ +      +I       +V    LD
Sbjct: 124 GKVVVVTGANSGIGFETAKSFALHGAHVILACRNMTRANEAVSQILGEWHKAKVEAMTLD 183

Query: 455 LADTKSIRAFAKGFLAEEKHLHILINNAGVMMCPYSKTADGFETHMGVNXXXXXXXXXXX 634
           LA  +S++ FA+ F A+   LH+L+ NA     P+S T DG ET   VN           
Sbjct: 184 LALLRSVQHFAQAFKAKNVSLHVLVCNAAAFALPWSLTKDGLETTFQVNHLGHFYLVQLL 243

Query: 635 XXXXKESAPSRVVNVSSLAHHM-------GRIHFHNLQGEKF-YHAGLAYCNSKLANVLF 790
                 SAP+RVV VSS +H         G++ F  L   K  Y A LAY  SKL N+LF
Sbjct: 244 QDVLCRSAPARVVVVSSESHRFTDINDSSGKLDFSRLSPSKSDYWAMLAYNRSKLCNILF 303

Query: 791 TQELARRLKGSGVTTYSVHPGTVDSELVRHSSLLRWIWWLFSFFIKTPQQGAQTSLYCAL 970
           + EL RRL   GVT+ +VHPG      + +SS+ R  WW+++      +   ++ L  + 
Sbjct: 304 SNELHRRLSPRGVTSNAVHPGN-----MMYSSIHR-NWWVYTLLFTLARPFTKSMLLVSC 357

Query: 971 TEG 979
           ++G
Sbjct: 358 SDG 360


>ref|XP_857503.1| PREDICTED: similar to retinol dehydrogenase 14 (all-trans and
           9-cis) isoform 3 [Canis familiaris]
          Length = 153

 Score = 62.8 bits (151), Expect = 8e-10
 Identities = 35/92 (38%), Positives = 53/92 (57%), Gaps = 13/92 (14%)
 Frame = +2

Query: 275 GKVAVVTGANTGIGKETAKELAKRGARVYLACRDVQKGESVA----REIQNMTGNQ---- 430
           GK  ++TGAN+G+G+ TA  L + GARV + CRD  + E  A    RE++   G +    
Sbjct: 43  GKTVLITGANSGLGRATAAALLRLGARVIMGCRDRARAEEAAGQLRRELRQAGGREPGSD 102

Query: 431 -----QVLVRKLDLADTKSIRAFAKGFLAEEK 511
                +++VR+LDLA  +S+RAF +  L   K
Sbjct: 103 VGAAGELVVRELDLASLRSVRAFCQEVLQGRK 134


  Database: RefSeqCP
    Posted date:  Aug 1, 2006  9:25 PM
  Number of letters in database: 19,266,565
  Number of sequences in database:  33,732
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 61,198,624
Number of Sequences: 33732
Number of extensions: 1634772
Number of successful extensions: 4524
Number of sequences better than 1.0e-05: 10
Number of HSP's better than  0.0 without gapping: 3977
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4482
length of database: 19,266,565
effective HSP length: 107
effective length of database: 15,657,241
effective search space used: 5981066062
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqMP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611C-001157
         (1470 letters)

Database: RefSeqMP 
           45,328 sequences; 21,768,885 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_067532.2| short-chain dehydrogenase/reductase 1 [Mus musc...   487   e-137
Alignment   gi|NP_084293.1| retinol dehydrogenase 12 [Mus musculus]              390   e-108
Alignment   gi|NP_780581.1| retinol dehydrogenase 13 (all-trans and 9-cis) ...   250   2e-66
Alignment   gi|NP_076186.1| alcohol dehydrogenase PAN2 [Mus musculus]            229   6e-60
Alignment   gi|NP_062519.2| WW-domain oxidoreductase [Mus musculus]              177   3e-44
Alignment   gi|NP_001028498.1| dehydrogenase/reductase (SDR family) X chrom...   173   4e-43
Alignment   gi|NP_899109.1| hypothetical protein LOC70451 [Mus musculus]         170   4e-42
Alignment   gi|NP_079798.1| retinal short-chain dehydrogenase/reductase 4 [...    68   2e-11
Alignment   gi|NP_671755.1| retinol dehydrogenase similar protein 2 [Mus mu...    62   1e-09
Alignment   gi|NP_663403.1| hypothetical protein LOC216820 [Mus musculus]         61   3e-09

>ref|NP_067532.2| short-chain dehydrogenase/reductase 1 [Mus musculus]
          Length = 316

 Score =  487 bits (1254), Expect = e-137
 Identities = 237/301 (78%), Positives = 262/301 (87%)
 Frame = +2

Query: 206  YIAVPQIRKMLSSGVCTSTVQLPGKVAVVTGANTGIGKETAKELAKRGARVYLACRDVQK 385
            Y+  P+IRKMLSSGVCTS VQLPGKVA+VTGANTGIGKETAK+LA+RGARVYLACRDV K
Sbjct: 15   YLVTPKIRKMLSSGVCTSNVQLPGKVAIVTGANTGIGKETAKDLAQRGARVYLACRDVDK 74

Query: 386  GESVAREIQNMTGNQQVLVRKLDLADTKSIRAFAKGFLAEEKHLHILINNAGVMMCPYSK 565
            GE  AREIQ +TGN QV VRKLDLADTKSIRAFAK FLAEEKHLH+LINNAGVMMCPYSK
Sbjct: 75   GELAAREIQAVTGNSQVFVRKLDLADTKSIRAFAKDFLAEEKHLHLLINNAGVMMCPYSK 134

Query: 566  TADGFETHMGVNXXXXXXXXXXXXXXXKESAPSRVVNVSSLAHHMGRIHFHNLQGEKFYH 745
            TADGFE H+GVN               KESAPSR+VN+SSL HH+GRIHFHNLQGEKFY 
Sbjct: 135  TADGFEMHIGVNHLGHFLLTHLLLEKLKESAPSRIVNLSSLGHHLGRIHFHNLQGEKFYS 194

Query: 746  AGLAYCNSKLANVLFTQELARRLKGSGVTTYSVHPGTVDSELVRHSSLLRWIWWLFSFFI 925
            AGLAYC+SKLAN+LFT+ELA+RLKGSGVTTYSVHPGTV SEL R+SS++RW+W LF  FI
Sbjct: 195  AGLAYCHSKLANILFTKELAKRLKGSGVTTYSVHPGTVHSELTRYSSIMRWLWQLFFVFI 254

Query: 926  KTPQQGAQTSLYCALTEGLEVLSGNHFSDCHVAWVSAQARNETVARRLWDVSRDLLGIPM 1105
            KTPQ+GAQTSLYCALTEGLE LSG+HFSDC +AWVS Q RNE +ARRLWDVS DLLG+P+
Sbjct: 255  KTPQEGAQTSLYCALTEGLESLSGSHFSDCQLAWVSYQGRNEIIARRLWDVSCDLLGLPV 314

Query: 1106 D 1108
            D
Sbjct: 315  D 315


>ref|NP_084293.1| retinol dehydrogenase 12 [Mus musculus]
          Length = 316

 Score =  390 bits (1001), Expect = e-108
 Identities = 197/298 (66%), Positives = 234/298 (78%)
 Frame = +2

Query: 206  YIAVPQIRKMLSSGVCTSTVQLPGKVAVVTGANTGIGKETAKELAKRGARVYLACRDVQK 385
            Y+  P IRK  + GVCT+ VQ+PGKV V+TGANTGIGKETA+ELA+RGARVY+ACRDV K
Sbjct: 16   YLTAPSIRKFFAGGVCTTNVQIPGKVVVITGANTGIGKETARELARRGARVYIACRDVLK 75

Query: 386  GESVAREIQNMTGNQQVLVRKLDLADTKSIRAFAKGFLAEEKHLHILINNAGVMMCPYSK 565
            GES A EI+  T N QVLVRKLDL+DTKSIRAFA+ FLAEEK LHILINNAGVMMCPYSK
Sbjct: 76   GESAASEIRADTKNSQVLVRKLDLSDTKSIRAFAERFLAEEKKLHILINNAGVMMCPYSK 135

Query: 566  TADGFETHMGVNXXXXXXXXXXXXXXXKESAPSRVVNVSSLAHHMGRIHFHNLQGEKFYH 745
            T DGFETH GVN               KESAP+RVVN+SS+AH +G+I FH+LQG+K Y 
Sbjct: 136  TTDGFETHFGVNHLGHFLLTYLLLERLKESAPARVVNLSSIAHLIGKIRFHDLQGQKRYC 195

Query: 746  AGLAYCNSKLANVLFTQELARRLKGSGVTTYSVHPGTVDSELVRHSSLLRWIWWLFSFFI 925
            +  AY +SKLAN+LFT+ELA+RL+G+GVT Y+VHPG V SE+ R+S LL  +W LFS F 
Sbjct: 196  SAFAYGHSKLANLLFTRELAKRLQGTGVTAYAVHPGVVLSEITRNSYLLCLLWRLFSPFF 255

Query: 926  KTPQQGAQTSLYCALTEGLEVLSGNHFSDCHVAWVSAQARNETVARRLWDVSRDLLGI 1099
            K+  QGAQTSL+CAL E LE LSG +FSDC   WVS++ARN+  A RLW+VS +LLGI
Sbjct: 256  KSTSQGAQTSLHCALAEDLEPLSGKYFSDCKRMWVSSRARNKKTAERLWNVSCELLGI 313


>ref|NP_780581.1| retinol dehydrogenase 13 (all-trans and 9-cis) [Mus musculus]
          Length = 334

 Score =  250 bits (639), Expect = 2e-66
 Identities = 141/305 (46%), Positives = 183/305 (60%), Gaps = 11/305 (3%)
 Frame = +2

Query: 224  IRKMLSSGVCTSTVQLPGKVAVVTGANTGIGKETAKELAKRGARVYLACRDVQKGESVAR 403
            ++  ++ G C S   +PGK  +VTGANTGIGK+TA ELAKRG  V LACRD++K E  A+
Sbjct: 21   LKDYVAGGACPSKATIPGKTVIVTGANTGIGKQTALELAKRGGNVILACRDMEKCEVAAK 80

Query: 404  EIQNMTGNQQVLVRKLDLADTKSIRAFAKGFLAEEKHLHILINNAGVMMCPYSKTADGFE 583
            +I+  T N +V   +LDLA  KSIR FA+  + EE+ + IL+NNA VM CP+  T DGFE
Sbjct: 81   DIRGETLNPRVRAERLDLASLKSIREFARKVIKEEERVDILVNNAAVMRCPHWTTEDGFE 140

Query: 584  THMGVNXXXXXXXXXXXXXXXKESAPSRVVNVSSLAHHMGRIHFHNLQGE-KFYHAGLAY 760
               GVN               K SAPSR++N+SSLAH  G I F +L  + K Y    AY
Sbjct: 141  MQFGVNYLGHFLLTNLLLDKLKASAPSRIINLSSLAHVAGHIDFEDLNWQMKKYDTKAAY 200

Query: 761  CNSKLANVLFTQELARRLKGSGVTTYSVHPGTVDSELVRHSSLLR----------WIWWL 910
            C SKLA VLFT+EL+ RL+GSGVT  ++HPG   +EL RH+ +            + W L
Sbjct: 201  CQSKLAVVLFTKELSHRLQGSGVTVNALHPGVARTELGRHTGMHNSAFSGFMLGPFFWLL 260

Query: 911  FSFFIKTPQQGAQTSLYCALTEGLEVLSGNHFSDCHVAWVSAQARNETVARRLWDVSRDL 1090
            F    K+PQ  AQ S Y A+ E LE +SG +F        S +A +E VARRLW  S  L
Sbjct: 261  F----KSPQLAAQPSTYLAVAEELENVSGKYFDGLREKAPSPEAEDEEVARRLWTESARL 316

Query: 1091 LGIPM 1105
            +G+ M
Sbjct: 317  VGLAM 321


>ref|NP_076186.1| alcohol dehydrogenase PAN2 [Mus musculus]
          Length = 334

 Score =  229 bits (584), Expect = 6e-60
 Identities = 127/289 (43%), Positives = 177/289 (61%), Gaps = 14/289 (4%)
 Frame = +2

Query: 275  GKVAVVTGANTGIGKETAKELAKRGARVYLACRDVQKGESVAREIQNMT----------G 424
            GK  ++TGAN+G+G+ TA EL + GARV + CRD  + E  A +++              
Sbjct: 44   GKTVLITGANSGLGRATAAELLRLGARVIMGCRDRARAEEAAGQLRQELCQAGGAGPDGT 103

Query: 425  NQQVLVRKLDLADTKSIRAFAKGFLAEEKHLHILINNAGVMMCPYSKTADGFETHMGVNX 604
            + Q++V++LDLA  +S+RAF +  L EE  L +LINNAGV  CPY+KT DGFE   GVN 
Sbjct: 104  DGQLVVKELDLASLRSVRAFCQELLQEEPRLDVLINNAGVFHCPYTKTEDGFEMQFGVNH 163

Query: 605  XXXXXXXXXXXXXXKESAPSRVVNVSSLAHHMGRIHFHNLQGEKFYHAGLAYCNSKLANV 784
                          K SAPSR+V VSS  +  G I+F +L  E+ Y+    Y  SKLAN+
Sbjct: 164  LGHFLLTNLLLGLLKSSAPSRIVVVSSKLYKYGEINFEDLNSEQSYNKSFCYSRSKLANI 223

Query: 785  LFTQELARRLKGSGVTTYSVHPGTVDSELVRH---SSLLRWIWWLFSF-FIKTPQQGAQT 952
            LFT+ELARRL+G+ VT   +HPG V + L RH     L R ++ L S+ F KTP +GAQT
Sbjct: 224  LFTRELARRLEGTNVTVNVLHPGIVRTNLGRHIHIPLLARPLFNLVSWAFFKTPLEGAQT 283

Query: 953  SLYCALTEGLEVLSGNHFSDCHVAWVSAQARNETVARRLWDVSRDLLGI 1099
            S+Y A +  +E +SG +F DC    +  +A +E+VAR+LWD+S  ++GI
Sbjct: 284  SIYLACSPDVEGVSGRYFGDCKEEELLPKAMDESVARKLWDISEVMVGI 332


>ref|NP_062519.2| WW-domain oxidoreductase [Mus musculus]
          Length = 414

 Score =  177 bits (449), Expect = 3e-44
 Identities = 113/289 (39%), Positives = 158/289 (54%), Gaps = 13/289 (4%)
 Frame = +2

Query: 275  GKVAVVTGANTGIGKETAKELAKRGARVYLACRDVQKGESVAREIQNMTGNQQVLVRKLD 454
            GKV +VTGAN+GIG ETAK  A  GA V LACR++ +       I       +V    LD
Sbjct: 124  GKVVLVTGANSGIGFETAKSFALHGAHVILACRNLSRASEAVSRILEEWHKAKVEAMTLD 183

Query: 455  LADTKSIRAFAKGFLAEEKHLHILINNAGVMMCPYSKTADGFETHMGVNXXXXXXXXXXX 634
            LA  +S++ FA+ F A+   LH+L+ NAG    P+  T DG ET   VN           
Sbjct: 184  LAVLRSVQHFAEAFKAKNVSLHVLVCNAGTFALPWGLTKDGLETTFQVNHLGHFYLVQLL 243

Query: 635  XXXXKESAPSRVVNVSSLAHHM-------GRIHFHNLQGEKF-YHAGLAYCNSKLANVLF 790
                  S+P+RV+ VSS +H         G++    L   +  Y A LAY  SKL N+LF
Sbjct: 244  QDVLCRSSPARVIVVSSESHRFTDINDSSGKLDLSRLSPPRSDYWAMLAYNRSKLCNILF 303

Query: 791  TQELARRLKGSGVTTYSVHPGT-VDSELVRHSSLLRWIWWLFSFFIKTPQQGAQTSLYCA 967
            + EL RRL   GVT+ +VHPG  + S + R+S + + ++ L   F K+ QQGA T++YCA
Sbjct: 304  SNELHRRLSPRGVTSNAVHPGNMMYSAIHRNSWVYKLLFTLARPFTKSMQQGAATTVYCA 363

Query: 968  LTEGLEVLSGNHFSDCHVAWVSAQARNETVARRLWDVS----RDLLGIP 1102
            +   LE L G +F++C     S +A++E  AR LW++S    +D LG P
Sbjct: 364  VAPELEGLGGMYFNNCCRCLPSEEAQSEETARALWELSERLIQDRLGSP 412


>ref|NP_001028498.1| dehydrogenase/reductase (SDR family) X chromosome [Mus musculus]
          Length = 335

 Score =  173 bits (439), Expect = 4e-43
 Identities = 109/286 (38%), Positives = 150/286 (52%), Gaps = 11/286 (3%)
 Frame = +2

Query: 272  PGKVAVVTGANTGIGKETAKELAKRGARVYLACRDVQKGESVAREIQNMTGNQQVLVRKL 451
            PG+VA+VTGA  GIG+ TA++LA+ G  V +A  D  +G+ V   I+   G+ +     L
Sbjct: 42   PGRVAIVTGATAGIGRSTARQLARLGMCVVVAGNDEHRGQEVVSSIRAEMGSDRAHFLPL 101

Query: 452  DLADTKSIRAFAKGFLAEEKHLHILINNAGVMMCPYSKTADGFETHMGVNXXXXXXXXX- 628
            DLA   S+R FA+ F A    LH+L+NNAGVM+ P ++T DGFE H+GVN          
Sbjct: 102  DLASLASVRGFARDFQALGLPLHLLVNNAGVMLEPRAETEDGFERHLGVNFLGHFLLTLL 161

Query: 629  ---XXXXXXKESAPSRVVNVSSLAHHMGRIHFHNLQGEKFYHAGLAYCNSKLANVLFTQE 799
                      E   SRVV V S  H++G +   +L G   Y    AY  SKLA  LF  +
Sbjct: 162  LLPALRASGAEGRGSRVVTVGSATHYVGTVDMADLHGRHAYSPYAAYAQSKLALALFALQ 221

Query: 800  LARRL--KGSGVTTYSVHPGTVDSELVRHSSLL-----RWIWWLFSFFIKTPQQGAQTSL 958
            L R L  +G  VT+    PG VD+EL RH+  +     R++ WL     K+P++GA T +
Sbjct: 222  LQRILDARGDPVTSNMADPGVVDTELYRHAGWVLRTAKRFLGWL---VFKSPEEGAWTLV 278

Query: 959  YCALTEGLEVLSGNHFSDCHVAWVSAQARNETVARRLWDVSRDLLG 1096
            Y A    LE + G +  D   A     AR++ + RRLW     L G
Sbjct: 279  YAAAAPELEGVGGRYLRDEAEAEPLGTARDQELQRRLWAEGLRLTG 324


>ref|NP_899109.1| hypothetical protein LOC70451 [Mus musculus]
          Length = 260

 Score =  170 bits (430), Expect = 4e-42
 Identities = 103/230 (44%), Positives = 137/230 (59%), Gaps = 8/230 (3%)
 Frame = +2

Query: 251 CTSTVQLPGKVAVVTGANTGIGKETAKELAKRGARVYLACRDVQKGESVAREIQNMTGNQ 430
           C     L G+  VVTGAN+GIGK TA ELA+RGARV LACR  ++GE+ A +++  +GN 
Sbjct: 28  CGGIGSLRGRTVVVTGANSGIGKMTALELARRGARVVLACRSRERGEAAAFDLRQESGNN 87

Query: 431 QVLVRKLDLADTKSIRAFAKGFLAEEKHLHILINNAGVMMCPYSKTADGFETHMGVNXXX 610
           +V+   LDLA   S++AFA  FL+ E  L +LI+NAG+  C   +T + F   + VN   
Sbjct: 88  EVIFMALDLASLASVQAFATAFLSSEPRLDVLIHNAGISSC--GRTRETFNLLLRVNHVG 145

Query: 611 XXXXXXXXXXXXKESAPSRVVNVSSLAHHMGRIHFHNLQGE--KFYHAGLAYCNSKLANV 784
                       +  APSRVV VSS AH  GR+ F  L      +     AY +SKLANV
Sbjct: 146 PFLLTHLLLPRLRSCAPSRVVIVSSAAHRRGRLDFTRLDCPVVGWQQELRAYADSKLANV 205

Query: 785 LFTQELARRLKGSGVTTYSVHPGTVDSEL-VRH-----SSLLRWIWWLFS 916
           LF +ELA +L+G+GVT Y+ HPG V+SEL +RH       +LR + WL S
Sbjct: 206 LFARELATQLEGTGVTCYAAHPGPVNSELFLRHLRGWLRPILRPLAWLCS 255


>ref|NP_079798.1| retinal short-chain dehydrogenase/reductase 4 [Mus musculus]
          Length = 288

 Score = 68.2 bits (165), Expect = 2e-11
 Identities = 63/207 (30%), Positives = 91/207 (43%), Gaps = 6/207 (2%)
 Frame = +2

Query: 281 VAVVTGANTGIGKETAKELAKRGARVYLACRDVQKGESVAREIQNMTGN---QQVLVRKL 451
           V  VTGA++GIG+E A +L+K G  + L+ R  Q+ E V R      GN   + +LV  L
Sbjct: 2   VVWVTGASSGIGEELAFQLSKLGVSLVLSARRAQELERVKRRCLE-NGNLKEKDILVLPL 60

Query: 452 DLADTKSIRAFAKGFLAEEKHLHILINNAG--VMMCPYSKTADGFETHMGVNXXXXXXXX 625
           DL DT S  A  K  L E   + IL+NN G            D F+  + +N        
Sbjct: 61  DLTDTSSHEAATKAVLQEFGKIDILVNNGGRSQRSLVLETNLDVFKELINLNYIGTVSLT 120

Query: 626 XXXXXXXKESAPSRVVNVSSLAHHMGRIHFHNLQGEKFYHAGLAYCNSKLANVLFTQELA 805
                   E    ++V V+S+A            G         YC SK A   F   L 
Sbjct: 121 KCVLPHMIERKQGKIVTVNSIA------------GIASVSLSSGYCASKHALRGFFNALH 168

Query: 806 RRL-KGSGVTTYSVHPGTVDSELVRHS 883
             L +  G+T  +V+PG V S++V+++
Sbjct: 169 SELGQYPGITFCNVYPGPVQSDIVKNA 195


>ref|NP_671755.1| retinol dehydrogenase similar protein 2 [Mus musculus]
          Length = 318

 Score = 62.4 bits (150), Expect = 1e-09
 Identities = 68/221 (30%), Positives = 98/221 (44%), Gaps = 9/221 (4%)
 Frame = +2

Query: 269 LPGKVAVVTGANTGIGKETAKELAKRGARVYLACRDVQKGESVAREIQNMTGNQQVLVRK 448
           L  K   +TG ++G G   A++L +RG RV  AC   +KG   A E++N T ++   V  
Sbjct: 27  LQDKYVFITGCDSGFGNLLARQLDRRGMRVLAACL-TEKG---AEELRNKTSDRLETV-I 81

Query: 449 LDLADTKSIRAFAKGFLAE---EKHLHILINNAGVMM---CPYSKTADGFETHMGVNXXX 610
           LD+  T+SI A A  ++ E    + L  L+NNAG+ +            F + + VN   
Sbjct: 82  LDVTKTESIVA-ATQWVKERVGNRGLWGLVNNAGISVPLGLSQWMNKQNFASVLDVNLLG 140

Query: 611 XXXXXXXXXXXXKESAPSRVVNVSSLAHHMGRIHFHNLQGEKFYHAGLAYCNSKLANVLF 790
                       ++ A  RVVNVSS+   MGR+  H   G         YC SK     F
Sbjct: 141 MIEVTLTMLPLVRK-ARGRVVNVSSI---MGRVSLHGNGG---------YCISKYGVEAF 187

Query: 791 TQELARRLKGSGVTTYSVHPG---TVDSELVRHSSLLRWIW 904
           +  L R L   GV    + PG   T  +   R SS  + +W
Sbjct: 188 SDSLRRELSYFGVKVAIIEPGFFLTGMASSARLSSNTQMLW 228


>ref|NP_663403.1| hypothetical protein LOC216820 [Mus musculus]
          Length = 323

 Score = 60.8 bits (146), Expect = 3e-09
 Identities = 59/207 (28%), Positives = 90/207 (43%), Gaps = 2/207 (0%)
 Frame = +2

Query: 257 STVQLPGKVAVVTGANTGIGKETAKELAKRGARVYLACRDVQKGESVAREIQNMTGNQ-- 430
           S   L   V VVTGA +G+G+E AK     GA++ L  R+V+  E ++RE+   +  Q  
Sbjct: 46  SKAYLRNAVVVVTGATSGLGRECAKVFHAAGAKLVLCGRNVKALEELSRELAGSSQGQTH 105

Query: 431 QVLVRKLDLADTKSIRAFAKGFLAEEKHLHILINNAGVMMCPYSKTADGFETHMGVNXXX 610
           Q  V   DLAD  +I A A   L    ++ +LINNAG+    Y  T    +T + V+   
Sbjct: 106 QPFVVTFDLADPGTIAAAAAEILQCFGYVDVLINNAGI---SYRGTIS--DTIVDVDRKV 160

Query: 611 XXXXXXXXXXXXKESAPSRVVNVSSLAHHMGRIHFHNLQGEKFYHAGLAYCNSKLANVLF 790
                       K   PS V        H+  +   ++QG+       AY  SK A   F
Sbjct: 161 MEINYFGPVALTKALLPSMVERKQG---HI--VAISSIQGKISIPFRSAYSASKHATQAF 215

Query: 791 TQELARRLKGSGVTTYSVHPGTVDSEL 871
              L   ++ + +    + PG + + L
Sbjct: 216 FDCLRAEMEEANIKVTVISPGYIHTNL 242


  Database: RefSeqMP
    Posted date:  Aug 2, 2006 12:58 AM
  Number of letters in database: 21,768,885
  Number of sequences in database:  45,328
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 70,454,799
Number of Sequences: 45328
Number of extensions: 1872812
Number of successful extensions: 5030
Number of sequences better than 1.0e-05: 10
Number of HSP's better than  0.0 without gapping: 4347
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4988
length of database: 21,768,885
effective HSP length: 107
effective length of database: 16,918,789
effective search space used: 6462977398
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)