Animal-Genome cDNA 20060611C-001314


Search to RefSeqSP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611C-001314
         (1574 letters)

Database: RefSeqSP 
           1040 sequences; 434,620 total letters

Searching...done

 ***** No hits found ******

  Database: RefSeqSP
    Posted date:  Aug 1, 2006  7:14 PM
  Number of letters in database: 434,620
  Number of sequences in database:  1040
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,457,856
Number of Sequences: 1040
Number of extensions: 37757
Number of successful extensions: 152
Number of sequences better than 1.0e-05: 0
Number of HSP's better than  0.0 without gapping: 107
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 152
length of database: 434,620
effective HSP length: 81
effective length of database: 350,380
effective search space used: 155218340
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqBP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611C-001314
         (1574 letters)

Database: RefSeqBP 
           33,508 sequences; 16,112,626 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|XP_614740.2| PREDICTED: similar to LanC-like protein 2 (Test...   597   e-171
Alignment   gi|XP_612082.2| PREDICTED: similar to LanC-like protein 1 (40 k...   371   e-120
Alignment   gi|XP_611101.2| PREDICTED: similar to LanC-like protein 2 (Test...    98   6e-40
Alignment   gi|XP_597454.2| PREDICTED: similar to LanC lantibiotic syntheta...   125   5e-35

>ref|XP_614740.2| PREDICTED: similar to LanC-like protein 2 (Testis-specific adriamycin
            sensitivity protein), partial [Bos taurus]
          Length = 331

 Score =  597 bits (1539), Expect = e-171
 Identities = 292/331 (88%), Positives = 305/331 (92%)
 Frame = +3

Query: 291  MGETISRRLWFQGDWDAEMEERAFPNPFPDYXXXXXXXXXXXXXXXXXLTPEELGLPFHS 470
            MGET+SRRL  Q   DA+ME+RAFPNPFPDY                 L+PEELGLPFHS
Sbjct: 1    MGETMSRRLKLQLGGDADMEDRAFPNPFPDYEAAAERQAEEPPCSRTPLSPEELGLPFHS 60

Query: 471  DGKIIHNFTRRIQSKIKDLLQQMEEGLKTADPHDCSAYTGWTGIALLYLQLYRVTCDQNY 650
            DGKII+NFTRRIQ+KIKDLLQQMEEGLKTADPHDCSAYTGWTGIALLYLQLYRVTCDQ+Y
Sbjct: 61   DGKIINNFTRRIQTKIKDLLQQMEEGLKTADPHDCSAYTGWTGIALLYLQLYRVTCDQSY 120

Query: 651  LLRSLDYVKRTLRNLNGRRVTFLCGDAGPLAVGAVVYHKLKSDGESQECITKLLQLQRTI 830
            LLRSLDYVKRTLRNLNGRRVTFLCGDAGPLAVGAVVYHKLKSD ESQECITKLLQLQRTI
Sbjct: 121  LLRSLDYVKRTLRNLNGRRVTFLCGDAGPLAVGAVVYHKLKSDCESQECITKLLQLQRTI 180

Query: 831  VCRDSDLPDELLFGRAGYLYALLYVNTEMGPGAVCESAIKEVVDAIIDSGKTLSKEERKA 1010
            VCRDSDLPDELL+GRAGYLYALLYVNTE+GPGAVCESAIKEVV+AII+SGK LSKEE+K 
Sbjct: 181  VCRDSDLPDELLYGRAGYLYALLYVNTEIGPGAVCESAIKEVVNAIIESGKALSKEEKKV 240

Query: 1011 ERCPLLYQWHRKQYVGAAHGMAGIYYMLMQPAAKVDQETLTEMVKPSIDYMRHKRFRSGN 1190
            ERCPLLYQWHRKQYVGAAHGMAGIYYMLMQPAAKVDQETLTEMVKPSIDYMRHKRFRSGN
Sbjct: 241  ERCPLLYQWHRKQYVGAAHGMAGIYYMLMQPAAKVDQETLTEMVKPSIDYMRHKRFRSGN 300

Query: 1191 YPSSLSNETDRLVHWCHGAPGVIHTLMQAYK 1283
            YPSSLSNETDRLVHWCHGAPGVIH LMQA+K
Sbjct: 301  YPSSLSNETDRLVHWCHGAPGVIHVLMQAHK 331


>ref|XP_612082.2| PREDICTED: similar to LanC-like protein 1 (40 kDa erythrocyte
            membrane protein) (p40) [Bos taurus]
          Length = 399

 Score =  371 bits (952), Expect(2) = e-120
 Identities = 174/352 (49%), Positives = 241/352 (68%)
 Frame = +3

Query: 345  MEERAFPNPFPDYXXXXXXXXXXXXXXXXXLTPEELGLPFHSDGKIIHNFTRRIQSKIKD 524
            M +RAFPNP+ DY                          F S G++   F++R+ +KI++
Sbjct: 1    MAQRAFPNPYADYNKSLAEGY------------------FDSAGRLTPEFSQRLNNKIRE 42

Query: 525  LLQQMEEGLKTADPHDCSAYTGWTGIALLYLQLYRVTCDQNYLLRSLDYVKRTLRNLNGR 704
            LLQQME GLK+ADP D + YTGW GIA+LYL LY V  D NYL  +  YVK++L +L+  
Sbjct: 43   LLQQMERGLKSADPRDSTVYTGWAGIAVLYLHLYDVFGDPNYLQMAHGYVKQSLNSLSKH 102

Query: 705  RVTFLCGDAGPLAVGAVVYHKLKSDGESQECITKLLQLQRTIVCRDSDLPDELLFGRAGY 884
             +TFLCGD GPLAV AVV+HK+ ++ +++ECIT+L+ L +     D   P E+L+GR GY
Sbjct: 103  SITFLCGDGGPLAVAAVVHHKMNNEKQAEECITRLIHLNKI----DPHAPSEMLYGRMGY 158

Query: 885  LYALLYVNTEMGPGAVCESAIKEVVDAIIDSGKTLSKEERKAERCPLLYQWHRKQYVGAA 1064
            + ALL+VN   G   + +S I+++ + ++ SG+ L+++ R   + PL+Y+W+++ YVGAA
Sbjct: 159  ISALLFVNKNFGEEKIPQSHIQQICETVLTSGEDLARKRRFTGKTPLMYEWYQEYYVGAA 218

Query: 1065 HGMAGIYYMLMQPAAKVDQETLTEMVKPSIDYMRHKRFRSGNYPSSLSNETDRLVHWCHG 1244
            HG+AGIYY LMQP+ +V    L  +VKPS+DY+   +F SGNYP  + +  D L+HWCHG
Sbjct: 219  HGLAGIYYYLMQPSLQVSHAKLHNLVKPSVDYVCQLKFPSGNYPPCVDDSRDLLIHWCHG 278

Query: 1245 APGVIHTLMQAYKVFKEEKYLTDAVECSDVIWQRGLLRKGYGICHGTAGNGY 1400
            APGVI+ L QAYKVFKEE+YL DA +C+DVIWQ GLL+KGYG+CHGTAGN Y
Sbjct: 279  APGVIYMLTQAYKVFKEERYLNDAYQCADVIWQYGLLKKGYGLCHGTAGNAY 330



 Score = 80.9 bits (198), Expect(2) = e-120
 Identities = 34/49 (69%), Positives = 40/49 (81%)
 Frame = +2

Query: 1424 TQDKKYLYRALQFAEWCLEYXAHGCRISDRPYSLFEGMGGRIHFLSDIL 1570
            TQD KYLYRA +FAEWCL+Y  HGCR  D P+SLFEGM G I+FL+D+L
Sbjct: 339  TQDAKYLYRACKFAEWCLDYGEHGCRTPDTPFSLFEGMAGTIYFLADLL 387


>ref|XP_611101.2| PREDICTED: similar to LanC-like protein 2 (Testis-specific adriamycin
            sensitivity protein), partial [Bos taurus]
          Length = 149

 Score = 97.8 bits (242), Expect(2) = 6e-40
 Identities = 44/50 (88%), Positives = 45/50 (90%)
 Frame = +2

Query: 1424 TQDKKYLYRALQFAEWCLEYXAHGCRISDRPYSLFEGMGGRIHFLSDILA 1573
            TQDKKYLYRA +FAEWCLEY AHGCRI DRPYSLFEGM G IHFLSDILA
Sbjct: 77   TQDKKYLYRACKFAEWCLEYGAHGCRIPDRPYSLFEGMAGTIHFLSDILA 126



 Score = 86.3 bits (212), Expect(2) = 6e-40
 Identities = 41/63 (65%), Positives = 44/63 (69%)
 Frame = +3

Query: 1212 ETDRLVHWCHGAPGVIHTLMQAYKVFKEEKYLTDAVECSDVIWQRGLLRKGYGICHGTAG 1391
            + D    W    P     + +   VFKEEKYL DAVECSDVIWQRGLLRKGYGICHGTAG
Sbjct: 6    DVDGRAVWNLPLPSTRVGVSELQPVFKEEKYLKDAVECSDVIWQRGLLRKGYGICHGTAG 65

Query: 1392 NGY 1400
            NGY
Sbjct: 66   NGY 68


>ref|XP_597454.2| PREDICTED: similar to LanC lantibiotic synthetase component C-like 3
            [Bos taurus]
          Length = 244

 Score =  125 bits (313), Expect(2) = 5e-35
 Identities = 62/155 (40%), Positives = 96/155 (61%), Gaps = 3/155 (1%)
 Frame = +3

Query: 945  IKEVVDAIIDSGKTLSKEERKAERCPLLYQWHRKQYVGAAHGMAGIYYMLMQPAAKVDQE 1124
            IK +  AI+DSGK  + ++RK    PL+Y ++  +Y+GAAHG++ I  ML+     +   
Sbjct: 22   IKSICQAILDSGKQYAMKKRKP--FPLMYSYYGTEYLGAAHGLSSILQMLLSYHEHLKPS 79

Query: 1125 TLTEMVKPSIDYMRHKRFRSGNYPSSLSNETDR---LVHWCHGAPGVIHTLMQAYKVFKE 1295
               E+V  S+D++  +  ++ N+P  L    +R   LVHWCHGAPG+ +   +AY V K+
Sbjct: 80   D-QELVWQSVDFLMEQE-QNCNWPPELGEAIERENELVHWCHGAPGIAYLFAKAYLVSKK 137

Query: 1296 EKYLTDAVECSDVIWQRGLLRKGYGICHGTAGNGY 1400
             +YL   + C ++ WQ+GLL+KG GICHG AG+ Y
Sbjct: 138  PQYLDTCIRCGELTWQKGLLKKGPGICHGVAGSAY 172



 Score = 42.4 bits (98), Expect(2) = 5e-35
 Identities = 22/50 (44%), Positives = 31/50 (62%), Gaps = 1/50 (2%)
 Frame = +2

Query: 1424 TQDKKYLYRALQFAEWCL-EYXAHGCRISDRPYSLFEGMGGRIHFLSDIL 1570
            T + KY+YRA +FAE+   E    G R+ +  YSL+EG  G + FL D+L
Sbjct: 181  TGNSKYIYRAQRFAEFLFTEEFKAGSRVLESIYSLYEGFSGTVCFLIDLL 230


  Database: RefSeqBP
    Posted date:  Aug 1, 2006  7:14 PM
  Number of letters in database: 16,112,626
  Number of sequences in database:  33,508
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 55,994,459
Number of Sequences: 33508
Number of extensions: 1526891
Number of successful extensions: 9618
Number of sequences better than 1.0e-05: 4
Number of HSP's better than  0.0 without gapping: 6225
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 9524
length of database: 16,112,626
effective HSP length: 106
effective length of database: 12,560,778
effective search space used: 5250405204
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqHP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611C-001314
         (1574 letters)

Database: RefSeqHP 
           39,411 sequences; 17,774,539 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_061167.1| LanC lantibiotic synthetase component C-like 2 ...   649   0.0  
Alignment   gi|NP_006046.1| lanthionine synthetase C-like protein 1 [Homo s...   370   e-120
Alignment   gi|NP_940913.1| LanC lantibiotic synthetase component C-like 3 ...   152   6e-37

>ref|NP_061167.1| LanC lantibiotic synthetase component C-like 2 [Homo sapiens]
          Length = 450

 Score =  649 bits (1673), Expect(2) = 0.0
 Identities = 313/375 (83%), Positives = 335/375 (89%), Gaps = 5/375 (1%)
 Frame = +3

Query: 291  MGETISRRLWFQGDWDAEMEERAFPNPFPDYXXXXXXXXXXXXXXXXXL-----TPEELG 455
            MGET+S+RL      +AEMEERAF NPFPDY                       T +E G
Sbjct: 1    MGETMSKRLKLHLGGEAEMEERAFVNPFPDYEAAAGALLASGAAEETGCVRPPATTDEPG 60

Query: 456  LPFHSDGKIIHNFTRRIQSKIKDLLQQMEEGLKTADPHDCSAYTGWTGIALLYLQLYRVT 635
            LPFH DGKIIHNF RRIQ+KIKDLLQQMEEGLKTADPHDCSAYTGWTGIALLYLQLYRVT
Sbjct: 61   LPFHQDGKIIHNFIRRIQTKIKDLLQQMEEGLKTADPHDCSAYTGWTGIALLYLQLYRVT 120

Query: 636  CDQNYLLRSLDYVKRTLRNLNGRRVTFLCGDAGPLAVGAVVYHKLKSDGESQECITKLLQ 815
            CDQ YLLRSLDYVKRTLRNLNGRRVTFLCGDAGPLAVGAV+YHKL+SD ESQEC+TKLLQ
Sbjct: 121  CDQTYLLRSLDYVKRTLRNLNGRRVTFLCGDAGPLAVGAVIYHKLRSDCESQECVTKLLQ 180

Query: 816  LQRTIVCRDSDLPDELLFGRAGYLYALLYVNTEMGPGAVCESAIKEVVDAIIDSGKTLSK 995
            LQR++VC++SDLPDELL+GRAGYLYALLY+NTE+GPG VCESAIKEVV+AII+SGKTLS+
Sbjct: 181  LQRSVVCQESDLPDELLYGRAGYLYALLYLNTEIGPGTVCESAIKEVVNAIIESGKTLSR 240

Query: 996  EERKAERCPLLYQWHRKQYVGAAHGMAGIYYMLMQPAAKVDQETLTEMVKPSIDYMRHKR 1175
            EERK ERCPLLYQWHRKQYVGAAHGMAGIYYMLMQPAAKVDQETLTEMVKPSIDY+RHK+
Sbjct: 241  EERKTERCPLLYQWHRKQYVGAAHGMAGIYYMLMQPAAKVDQETLTEMVKPSIDYVRHKK 300

Query: 1176 FRSGNYPSSLSNETDRLVHWCHGAPGVIHTLMQAYKVFKEEKYLTDAVECSDVIWQRGLL 1355
            FRSGNYPSSLSNETDRLVHWCHGAPGVIH LMQAYKVFKEEKYL +A+ECSDVIWQRGLL
Sbjct: 301  FRSGNYPSSLSNETDRLVHWCHGAPGVIHMLMQAYKVFKEEKYLKEAMECSDVIWQRGLL 360

Query: 1356 RKGYGICHGTAGNGY 1400
            RKGYGICHGTAGNGY
Sbjct: 361  RKGYGICHGTAGNGY 375



 Score = 94.7 bits (234), Expect(2) = 0.0
 Identities = 41/49 (83%), Positives = 44/49 (89%)
 Frame = +2

Query: 1424 TQDKKYLYRALQFAEWCLEYXAHGCRISDRPYSLFEGMGGRIHFLSDIL 1570
            TQDKKYLYRA +FAEWCL+Y AHGCRI DRPYSLFEGM G IHFLSD+L
Sbjct: 384  TQDKKYLYRACKFAEWCLDYGAHGCRIPDRPYSLFEGMAGAIHFLSDVL 432


>ref|NP_006046.1| lanthionine synthetase C-like protein 1 [Homo sapiens]
          Length = 399

 Score =  370 bits (950), Expect(2) = e-120
 Identities = 175/352 (49%), Positives = 243/352 (69%)
 Frame = +3

Query: 345  MEERAFPNPFPDYXXXXXXXXXXXXXXXXXLTPEELGLPFHSDGKIIHNFTRRIQSKIKD 524
            M +RAFPNP+ DY                          F + G++   F++R+ +KI++
Sbjct: 1    MAQRAFPNPYADYNKSLAEGY------------------FDAAGRLTPEFSQRLTNKIRE 42

Query: 525  LLQQMEEGLKTADPHDCSAYTGWTGIALLYLQLYRVTCDQNYLLRSLDYVKRTLRNLNGR 704
            LLQQME GLK+ADP D + YTGW GIA+LYL LY V  D  YL  +  YVK++L  L  R
Sbjct: 43   LLQQMERGLKSADPRDGTGYTGWAGIAVLYLHLYDVFGDPAYLQLAHGYVKQSLNCLTKR 102

Query: 705  RVTFLCGDAGPLAVGAVVYHKLKSDGESQECITKLLQLQRTIVCRDSDLPDELLFGRAGY 884
             +TFLCGDAGPLAV AV+YHK+ ++ ++++CIT+L+ L +     D   P+E+L+GR GY
Sbjct: 103  SITFLCGDAGPLAVAAVLYHKMNNEKQAEDCITRLIHLNKI----DPHAPNEMLYGRIGY 158

Query: 885  LYALLYVNTEMGPGAVCESAIKEVVDAIIDSGKTLSKEERKAERCPLLYQWHRKQYVGAA 1064
            +YALL+VN   G   + +S I+++ + I+ SG+ L+++     + PL+Y+W+++ YVGAA
Sbjct: 159  IYALLFVNKNFGVEKIPQSHIQQICETILTSGENLARKRNFTAKSPLMYEWYQEYYVGAA 218

Query: 1065 HGMAGIYYMLMQPAAKVDQETLTEMVKPSIDYMRHKRFRSGNYPSSLSNETDRLVHWCHG 1244
            HG+AGIYY LMQP+ +V Q  L  +VKPS+DY+   +F SGNYP  + +  D LVHWCHG
Sbjct: 219  HGLAGIYYYLMQPSLQVSQGKLHSLVKPSVDYVCQLKFPSGNYPPCIGDNRDLLVHWCHG 278

Query: 1245 APGVIHTLMQAYKVFKEEKYLTDAVECSDVIWQRGLLRKGYGICHGTAGNGY 1400
            APGVI+ L+QAYKVF+EEKYL DA +C+DVIWQ GLL+KGYG+CHG+AGN Y
Sbjct: 279  APGVIYMLIQAYKVFREEKYLCDAYQCADVIWQYGLLKKGYGLCHGSAGNAY 330



 Score = 82.0 bits (201), Expect(2) = e-120
 Identities = 35/49 (71%), Positives = 40/49 (81%)
 Frame = +2

Query: 1424 TQDKKYLYRALQFAEWCLEYXAHGCRISDRPYSLFEGMGGRIHFLSDIL 1570
            TQD KYLYRA +FAEWCLEY  HGCR  D P+SLFEGM G I+FL+D+L
Sbjct: 339  TQDMKYLYRACKFAEWCLEYGEHGCRTPDTPFSLFEGMAGTIYFLADLL 387


>ref|NP_940913.1| LanC lantibiotic synthetase component C-like 3 [Homo sapiens]
          Length = 388

 Score =  152 bits (385), Expect = 6e-37
 Identities = 90/239 (37%), Positives = 131/239 (54%), Gaps = 7/239 (2%)
 Frame = +3

Query: 705  RVTFLCGDAGPLAVGAVVYHKLKSDGESQECITKLLQLQRTIVCRDSDL----PDELLFG 872
            R  FL G AG  AV  +VYH L      Q  + K   L    VC          DEL  G
Sbjct: 117  RAAFLLGGAGVYAVATLVYHALGRSDYVQP-LGKFRAL--CAVCAPVSFLECGSDELFVG 173

Query: 873  RAGYLYALLYVNTEMGPGAVCESAIKEVVDAIIDSGKTLSKEERKAERCPLLYQWHRKQY 1052
            RAGYL A L +  ++    +  + IK +  AI+DSGK  + ++RK    PL+Y ++  +Y
Sbjct: 174  RAGYLCAALVLKQKLAQEVLTPAQIKSICQAILDSGKQYAIKKRKP--FPLMYSYYGTEY 231

Query: 1053 VGAAHGMAGIYYMLMQPAAKVDQETLTEMVKPSIDYMRHKRFRSGNYPSSLSNETDR--- 1223
            +GAAHG++ I  ML+     +      E+V  S+D++  +  ++ N+P  L    +R   
Sbjct: 232  LGAAHGLSSILQMLLSYHEHLKPSD-RELVWQSVDFLMEQE-QNCNWPPELGETIERENE 289

Query: 1224 LVHWCHGAPGVIHTLMQAYKVFKEEKYLTDAVECSDVIWQRGLLRKGYGICHGTAGNGY 1400
            LVHWCHGAPG+ +   +AY V K+ +YL   + C ++ WQ+GLL+KG GICHG AG+ Y
Sbjct: 290  LVHWCHGAPGIAYLFAKAYLVSKKPQYLDTCIRCGELTWQKGLLKKGPGICHGVAGSAY 348


  Database: RefSeqHP
    Posted date:  Aug 2, 2006 12:57 AM
  Number of letters in database: 17,774,539
  Number of sequences in database:  39,411
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 64,048,078
Number of Sequences: 39411
Number of extensions: 1828044
Number of successful extensions: 11840
Number of sequences better than 1.0e-05: 3
Number of HSP's better than  0.0 without gapping: 7163
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 11707
length of database: 17,774,539
effective HSP length: 107
effective length of database: 13,557,562
effective search space used: 5653503354
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqCP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611C-001314
         (1574 letters)

Database: RefSeqCP 
           33,732 sequences; 19,266,565 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|XP_540359.2| PREDICTED: similar to LanC-like protein 2 (Test...   604   0.0  
Alignment   gi|XP_536055.1| PREDICTED: similar to LanC-like protein 1 (40 k...   368   e-119
Alignment   gi|XP_548943.2| PREDICTED: similar to LanC lantibiotic syntheta...   153   2e-43

>ref|XP_540359.2| PREDICTED: similar to LanC-like protein 2 (Testis-specific adriamycin
            sensitivity protein) [Canis familiaris]
          Length = 452

 Score =  604 bits (1558), Expect(2) = 0.0
 Identities = 290/308 (94%), Positives = 301/308 (97%)
 Frame = +3

Query: 477  KIIHNFTRRIQSKIKDLLQQMEEGLKTADPHDCSAYTGWTGIALLYLQLYRVTCDQNYLL 656
            +I+ NFT+RIQ+KIKDLLQQMEEGLKTADPHDCSAYTGWTGIALLYLQLYRVTCDQ YLL
Sbjct: 67   RIVQNFTKRIQTKIKDLLQQMEEGLKTADPHDCSAYTGWTGIALLYLQLYRVTCDQTYLL 126

Query: 657  RSLDYVKRTLRNLNGRRVTFLCGDAGPLAVGAVVYHKLKSDGESQECITKLLQLQRTIVC 836
            RSLDYVKRTLRNLNGRRVTFLCGDAGPLAVGAVVYHKLKSD ESQECITKLLQLQRTIVC
Sbjct: 127  RSLDYVKRTLRNLNGRRVTFLCGDAGPLAVGAVVYHKLKSDCESQECITKLLQLQRTIVC 186

Query: 837  RDSDLPDELLFGRAGYLYALLYVNTEMGPGAVCESAIKEVVDAIIDSGKTLSKEERKAER 1016
            RDSDLPDELL+GRAGYLYALLY+NTE+GPG VCESAIKEVV AII+SGKTLS+EERKAER
Sbjct: 187  RDSDLPDELLYGRAGYLYALLYLNTEIGPGTVCESAIKEVVCAIIESGKTLSREERKAER 246

Query: 1017 CPLLYQWHRKQYVGAAHGMAGIYYMLMQPAAKVDQETLTEMVKPSIDYMRHKRFRSGNYP 1196
            CPLLYQWHRKQYVGAAHGMAGIYYMLMQPAAKVDQETLTEMVKPSIDY+RHKRFRSGNYP
Sbjct: 247  CPLLYQWHRKQYVGAAHGMAGIYYMLMQPAAKVDQETLTEMVKPSIDYVRHKRFRSGNYP 306

Query: 1197 SSLSNETDRLVHWCHGAPGVIHTLMQAYKVFKEEKYLTDAVECSDVIWQRGLLRKGYGIC 1376
            SSLSNETDRLVHWCHGAPGVIH LMQAYKVFKEEKYL DA+ECSDVIWQRGLLRKGYGIC
Sbjct: 307  SSLSNETDRLVHWCHGAPGVIHMLMQAYKVFKEEKYLKDAMECSDVIWQRGLLRKGYGIC 366

Query: 1377 HGTAGNGY 1400
            HGTAGNGY
Sbjct: 367  HGTAGNGY 374



 Score = 97.8 bits (242), Expect(2) = 0.0
 Identities = 44/50 (88%), Positives = 45/50 (90%)
 Frame = +2

Query: 1424 TQDKKYLYRALQFAEWCLEYXAHGCRISDRPYSLFEGMGGRIHFLSDILA 1573
            TQDKKYLYRA +FAEWCLEY AHGCRI DRPYSLFEGM G IHFLSDILA
Sbjct: 383  TQDKKYLYRACKFAEWCLEYGAHGCRIPDRPYSLFEGMAGAIHFLSDILA 432


>ref|XP_536055.1| PREDICTED: similar to LanC-like protein 1 (40 kDa erythrocyte
            membrane protein) (p40) [Canis familiaris]
          Length = 399

 Score =  368 bits (944), Expect(2) = e-119
 Identities = 172/352 (48%), Positives = 242/352 (68%)
 Frame = +3

Query: 345  MEERAFPNPFPDYXXXXXXXXXXXXXXXXXLTPEELGLPFHSDGKIIHNFTRRIQSKIKD 524
            M +RAFPNP+ D+                          F   G++   F++R+ +KI++
Sbjct: 1    MAQRAFPNPYADFNKSLAESY------------------FDCAGRLTPEFSQRLNNKIRE 42

Query: 525  LLQQMEEGLKTADPHDCSAYTGWTGIALLYLQLYRVTCDQNYLLRSLDYVKRTLRNLNGR 704
            LLQQME GLK+ADP D + YTGW GIALLYL LY V  D  YL  +  YVK++L +L  R
Sbjct: 43   LLQQMERGLKSADPRDSTVYTGWAGIALLYLHLYDVFGDPAYLQMAHGYVKQSLNSLTKR 102

Query: 705  RVTFLCGDAGPLAVGAVVYHKLKSDGESQECITKLLQLQRTIVCRDSDLPDELLFGRAGY 884
             +TFLCGDAGPLA+GAVVYHK+ ++ ++++CIT+L+ L +     D   P+E+L+GR GY
Sbjct: 103  SITFLCGDAGPLAIGAVVYHKMNNEKQAEDCITRLIHLNKI----DHHAPNEMLYGRMGY 158

Query: 885  LYALLYVNTEMGPGAVCESAIKEVVDAIIDSGKTLSKEERKAERCPLLYQWHRKQYVGAA 1064
            +YALL+VN   G   + +S I+++ +A++ SG+ L+++     + PL+Y+W+++ YVGAA
Sbjct: 159  VYALLFVNKNFGVEKIPQSHIQQICEAVLTSGENLAQKRNFTAKTPLMYEWYQEYYVGAA 218

Query: 1065 HGMAGIYYMLMQPAAKVDQETLTEMVKPSIDYMRHKRFRSGNYPSSLSNETDRLVHWCHG 1244
            HG+AGIYY+LMQP+ +V    L  +VKPS+DY+   +F SGNYP  + +  D LVHWCHG
Sbjct: 219  HGLAGIYYLLMQPSLQVSHVKLHNLVKPSVDYVCQLKFPSGNYPPCVDDNRDLLVHWCHG 278

Query: 1245 APGVIHTLMQAYKVFKEEKYLTDAVECSDVIWQRGLLRKGYGICHGTAGNGY 1400
            +PGVI+ L+QAYK F+ E YL DA +C+DVIW+ GLLRKGYG+CHGTAGN Y
Sbjct: 279  SPGVIYMLIQAYKAFRGEHYLNDAHQCADVIWRYGLLRKGYGLCHGTAGNAY 330



 Score = 80.9 bits (198), Expect(2) = e-119
 Identities = 34/49 (69%), Positives = 40/49 (81%)
 Frame = +2

Query: 1424 TQDKKYLYRALQFAEWCLEYXAHGCRISDRPYSLFEGMGGRIHFLSDIL 1570
            TQD KYLYRA +FAEWCL+Y  HGCR  D P+SLFEGM G I+FL+D+L
Sbjct: 339  TQDMKYLYRACKFAEWCLDYGEHGCRTPDTPFSLFEGMAGTIYFLADLL 387


>ref|XP_548943.2| PREDICTED: similar to LanC lantibiotic synthetase component C-like 3
            [Canis familiaris]
          Length = 420

 Score =  153 bits (387), Expect(2) = 2e-43
 Identities = 90/239 (37%), Positives = 131/239 (54%), Gaps = 7/239 (2%)
 Frame = +3

Query: 705  RVTFLCGDAGPLAVGAVVYHKLKSDGESQECITKLLQLQRTIVCRDSDL----PDELLFG 872
            R  FL G AG  AV  +VYH L      Q  + K   L    VC          DEL  G
Sbjct: 117  RAAFLLGGAGVYAVATLVYHALGRSDYVQP-LGKFRAL--CAVCAPVSFLECGSDELFVG 173

Query: 873  RAGYLYALLYVNTEMGPGAVCESAIKEVVDAIIDSGKTLSKEERKAERCPLLYQWHRKQY 1052
            RAGYL A L +  ++    +  + IK +  AI+DSGK  + ++RK    PL+Y ++  +Y
Sbjct: 174  RAGYLCAALVLKQKLAQEVLTPAQIKSICQAILDSGKQYAMKKRKP--FPLMYSYYGTEY 231

Query: 1053 VGAAHGMAGIYYMLMQPAAKVDQETLTEMVKPSIDYMRHKRFRSGNYPSSLSNETDR--- 1223
            +GAAHG++ I  ML+     +      E+V  S+D++  +  ++ N+P  L    +R   
Sbjct: 232  LGAAHGLSSILQMLLSYHEHLKPSD-QELVWQSVDFLMEQE-QNCNWPPELGEAIERENE 289

Query: 1224 LVHWCHGAPGVIHTLMQAYKVFKEEKYLTDAVECSDVIWQRGLLRKGYGICHGTAGNGY 1400
            LVHWCHGAPG+ +   +AY V K+ +YL   + C ++ WQ+GLL+KG GICHG AG+ Y
Sbjct: 290  LVHWCHGAPGIAYLFAKAYLVSKKPQYLDTCIRCGELTWQKGLLKKGPGICHGVAGSAY 348



 Score = 42.4 bits (98), Expect(2) = 2e-43
 Identities = 22/50 (44%), Positives = 31/50 (62%), Gaps = 1/50 (2%)
 Frame = +2

Query: 1424 TQDKKYLYRALQFAEWCL-EYXAHGCRISDRPYSLFEGMGGRIHFLSDIL 1570
            T + KY+YRA +FAE+   E    G R+ +  YSL+EG  G + FL D+L
Sbjct: 357  TGNSKYIYRAQRFAEFLFTEEFKAGSRVLESIYSLYEGFSGTVCFLIDLL 406


  Database: RefSeqCP
    Posted date:  Aug 1, 2006  9:25 PM
  Number of letters in database: 19,266,565
  Number of sequences in database:  33,732
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 65,691,002
Number of Sequences: 33732
Number of extensions: 1800678
Number of successful extensions: 11733
Number of sequences better than 1.0e-05: 3
Number of HSP's better than  0.0 without gapping: 7166
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 11603
length of database: 19,266,565
effective HSP length: 108
effective length of database: 15,623,509
effective search space used: 6499379744
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqMP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611C-001314
         (1574 letters)

Database: RefSeqMP 
           45,328 sequences; 21,768,885 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_598498.1| LanC (bacterial lantibiotic synthetase componen...   620   0.0  
Alignment   gi|XP_984245.1| PREDICTED: similar to LanC (bacterial lantibiot...   542   e-154
Alignment   gi|NP_067270.1| LanC (bacterial lantibiotic synthetase componen...   374   e-121
Alignment   gi|NP_775590.1| LanC lantibiotic synthetase component C-like 3 ...   154   2e-43

>ref|NP_598498.1| LanC (bacterial lantibiotic synthetase component C)-like 2 [Mus
            musculus]
          Length = 450

 Score =  620 bits (1598), Expect(2) = 0.0
 Identities = 301/376 (80%), Positives = 332/376 (88%), Gaps = 6/376 (1%)
 Frame = +3

Query: 291  MGETISRRLWFQGDWDAEMEERAFPNPFPDYXXXXXXXXXXXXXXXXX------LTPEEL 452
            MGET+S+RL F    +AEMEER+FPNPFPDY                        T E+ 
Sbjct: 1    MGETMSKRLKFHLG-EAEMEERSFPNPFPDYEAAASAAGLAAGSAEETGRVCPLPTTEDP 59

Query: 453  GLPFHSDGKIIHNFTRRIQSKIKDLLQQMEEGLKTADPHDCSAYTGWTGIALLYLQLYRV 632
            GLPFH +GKI+ NF +RIQ+KIKDLLQQMEEGLKTADPHDCSAYTGWTGIALLYLQLYRV
Sbjct: 60   GLPFHPNGKIVPNFIKRIQTKIKDLLQQMEEGLKTADPHDCSAYTGWTGIALLYLQLYRV 119

Query: 633  TCDQNYLLRSLDYVKRTLRNLNGRRVTFLCGDAGPLAVGAVVYHKLKSDGESQECITKLL 812
            T DQ YLLRSLDYVKRTLRNL+GRRVTFLCGDAGPLAVGAV+YHKLKS+ ESQECITKLL
Sbjct: 120  TGDQTYLLRSLDYVKRTLRNLSGRRVTFLCGDAGPLAVGAVIYHKLKSECESQECITKLL 179

Query: 813  QLQRTIVCRDSDLPDELLFGRAGYLYALLYVNTEMGPGAVCESAIKEVVDAIIDSGKTLS 992
            Q+ RTIVC++S+LPDELL+GRAGYLYALLY+NTE+GPG V E+AIKEVV AII+SGK+LS
Sbjct: 180  QMHRTIVCQESELPDELLYGRAGYLYALLYLNTEIGPGTVGETAIKEVVSAIIESGKSLS 239

Query: 993  KEERKAERCPLLYQWHRKQYVGAAHGMAGIYYMLMQPAAKVDQETLTEMVKPSIDYMRHK 1172
            +EERK+ERCPLLYQWHRKQYVGAAHGMAGIYYMLMQP AKVDQETLTEMVKPSIDY+RHK
Sbjct: 240  REERKSERCPLLYQWHRKQYVGAAHGMAGIYYMLMQPEAKVDQETLTEMVKPSIDYVRHK 299

Query: 1173 RFRSGNYPSSLSNETDRLVHWCHGAPGVIHTLMQAYKVFKEEKYLTDAVECSDVIWQRGL 1352
            +FRSGNYPSSLSNETDRLVHWCHGAPGVIH L+QAY+VFKEEKYL +A+ECSDVIWQRGL
Sbjct: 300  KFRSGNYPSSLSNETDRLVHWCHGAPGVIHVLLQAYQVFKEEKYLKEAMECSDVIWQRGL 359

Query: 1353 LRKGYGICHGTAGNGY 1400
            LRKGYGICHGT+GNGY
Sbjct: 360  LRKGYGICHGTSGNGY 375



 Score = 94.7 bits (234), Expect(2) = 0.0
 Identities = 41/49 (83%), Positives = 44/49 (89%)
 Frame = +2

Query: 1424 TQDKKYLYRALQFAEWCLEYXAHGCRISDRPYSLFEGMGGRIHFLSDIL 1570
            TQDKKYLYRA +FAEWCL+Y AHGCRI DRPYSLFEGM G +HFLSDIL
Sbjct: 384  TQDKKYLYRACKFAEWCLDYGAHGCRIPDRPYSLFEGMAGAVHFLSDIL 432


>ref|XP_984245.1| PREDICTED: similar to LanC (bacterial lantibiotic synthetase
            component C)-like 2 [Mus musculus]
          Length = 390

 Score =  542 bits (1397), Expect = e-154
 Identities = 266/337 (78%), Positives = 294/337 (87%), Gaps = 6/337 (1%)
 Frame = +3

Query: 291  MGETISRRLWFQGDWDAEMEERAFPNPFPDYXXXXXXXXXXXXXXXXX------LTPEEL 452
            MGET+S+RL F    +AEMEER+FPNPFPDY                        T E+ 
Sbjct: 1    MGETMSKRLKFHLG-EAEMEERSFPNPFPDYEAAASAAGLAAGSAEETGRVCPLPTTEDP 59

Query: 453  GLPFHSDGKIIHNFTRRIQSKIKDLLQQMEEGLKTADPHDCSAYTGWTGIALLYLQLYRV 632
            GLPFH +GKI+ NF +RIQ+KIKDLLQQMEEGLKTADPHDCSAYTGWTGIALLYLQLYRV
Sbjct: 60   GLPFHPNGKIVPNFIKRIQTKIKDLLQQMEEGLKTADPHDCSAYTGWTGIALLYLQLYRV 119

Query: 633  TCDQNYLLRSLDYVKRTLRNLNGRRVTFLCGDAGPLAVGAVVYHKLKSDGESQECITKLL 812
            T DQ YLLRSLDYVKRTLRNL+GRRVTFLCGDAGPLAVGAV+YHKLKS+ ESQECITKLL
Sbjct: 120  TGDQTYLLRSLDYVKRTLRNLSGRRVTFLCGDAGPLAVGAVIYHKLKSECESQECITKLL 179

Query: 813  QLQRTIVCRDSDLPDELLFGRAGYLYALLYVNTEMGPGAVCESAIKEVVDAIIDSGKTLS 992
            Q+ RTIVC++S+LPDELL+GRAGYLYALLY+NTE+GPG V E+AIKEVV AII+SGK+LS
Sbjct: 180  QMHRTIVCQESELPDELLYGRAGYLYALLYLNTEIGPGTVGETAIKEVVSAIIESGKSLS 239

Query: 993  KEERKAERCPLLYQWHRKQYVGAAHGMAGIYYMLMQPAAKVDQETLTEMVKPSIDYMRHK 1172
            +EERK+ERCPLLYQWHRKQYVGAAHGMAGIYYMLMQP AKVDQETLTEMVKPSIDY+RHK
Sbjct: 240  REERKSERCPLLYQWHRKQYVGAAHGMAGIYYMLMQPEAKVDQETLTEMVKPSIDYVRHK 299

Query: 1173 RFRSGNYPSSLSNETDRLVHWCHGAPGVIHTLMQAYK 1283
            +FRSGNYPSSLSNETDRLVHWCHGAPGVIH L+QAY+
Sbjct: 300  KFRSGNYPSSLSNETDRLVHWCHGAPGVIHVLLQAYQ 336


>ref|NP_067270.1| LanC (bacterial lantibiotic synthetase component C)-like 1 [Mus
            musculus]
          Length = 399

 Score =  374 bits (960), Expect(2) = e-121
 Identities = 178/352 (50%), Positives = 245/352 (69%)
 Frame = +3

Query: 345  MEERAFPNPFPDYXXXXXXXXXXXXXXXXXLTPEELGLPFHSDGKIIHNFTRRIQSKIKD 524
            M +RAFPNP+ DY                          F S G++   F+ R+ +KI++
Sbjct: 1    MAQRAFPNPYADYNKSLAENY------------------FDSTGRLTPEFSHRLTNKIRE 42

Query: 525  LLQQMEEGLKTADPHDCSAYTGWTGIALLYLQLYRVTCDQNYLLRSLDYVKRTLRNLNGR 704
            LLQQME GLK+ADP D + YTGW GIA+LYL L+ V  D  YL  +  YVK++L  L+ R
Sbjct: 43   LLQQMERGLKSADPRDGTGYTGWAGIAVLYLHLHNVFGDPAYLQMAHSYVKQSLNCLSRR 102

Query: 705  RVTFLCGDAGPLAVGAVVYHKLKSDGESQECITKLLQLQRTIVCRDSDLPDELLFGRAGY 884
             +TFLCGDAGPLAV AV+YHK+ S+ +++ECIT+L+ L +     D  +P+E+L+GR GY
Sbjct: 103  SITFLCGDAGPLAVAAVLYHKMNSEKQAEECITRLIHLNKI----DPHVPNEMLYGRIGY 158

Query: 885  LYALLYVNTEMGPGAVCESAIKEVVDAIIDSGKTLSKEERKAERCPLLYQWHRKQYVGAA 1064
            ++ALL+VN   G   + +S I+++ + I+ SG+ LS++   A + PL+Y+W+++ YVGAA
Sbjct: 159  IFALLFVNKNFGEEKIPQSHIQQICENILTSGENLSRKRNLAAKSPLMYEWYQEYYVGAA 218

Query: 1065 HGMAGIYYMLMQPAAKVDQETLTEMVKPSIDYMRHKRFRSGNYPSSLSNETDRLVHWCHG 1244
            HG+AGIYY LMQP+ +V+Q  L  +VKPS+D++   +F SGNYP  L +  D LVHWCHG
Sbjct: 219  HGLAGIYYYLMQPSLQVNQGKLHSLVKPSVDFVCRLKFPSGNYPPCLDDTRDLLVHWCHG 278

Query: 1245 APGVIHTLMQAYKVFKEEKYLTDAVECSDVIWQRGLLRKGYGICHGTAGNGY 1400
            APGVI+ L+QAYKVFKEE+YL DA +C+DVIWQ GLL+KGYG+CHG AGN Y
Sbjct: 279  APGVIYMLIQAYKVFKEERYLCDAQQCADVIWQYGLLKKGYGLCHGAAGNAY 330



 Score = 81.3 bits (199), Expect(2) = e-121
 Identities = 34/49 (69%), Positives = 41/49 (83%)
 Frame = +2

Query: 1424 TQDKKYLYRALQFAEWCLEYXAHGCRISDRPYSLFEGMGGRIHFLSDIL 1570
            TQD KYLYRA +FAEWCL+Y  HGCR +D P+SLFEGM G I+FL+D+L
Sbjct: 339  TQDLKYLYRACKFAEWCLDYGEHGCRTADTPFSLFEGMAGTIYFLADLL 387


>ref|NP_775590.1| LanC lantibiotic synthetase component C-like 3 [Mus musculus]
          Length = 420

 Score =  154 bits (389), Expect(2) = 2e-43
 Identities = 89/239 (37%), Positives = 132/239 (55%), Gaps = 7/239 (2%)
 Frame = +3

Query: 705  RVTFLCGDAGPLAVGAVVYHKLKSDGESQECITKLLQLQRTIVCRDSDL----PDELLFG 872
            R  FL G AG  AV  +VYH L      Q  + K   L    VC          DEL  G
Sbjct: 117  RAAFLLGGAGVYAVATLVYHALGRPDYVQP-LGKFRAL--CAVCAPVSFLDCGSDELFVG 173

Query: 873  RAGYLYALLYVNTEMGPGAVCESAIKEVVDAIIDSGKTLSKEERKAERCPLLYQWHRKQY 1052
            RAGYL A L +  ++    +  + IK +  AI+DSGK  + ++RK    PL+Y ++  +Y
Sbjct: 174  RAGYLCAALVLKQKLAQEVLTPTQIKAICQAILDSGKQYALKKRKP--FPLMYSYYGTEY 231

Query: 1053 VGAAHGMAGIYYMLMQPAAKVDQETLTEMVKPSIDYMRHKRFRSGNYPSSLSNETDR--- 1223
            +GAAHG++ I  ML+     +      E+V+ S+D++  +  ++ N+P  L    +R   
Sbjct: 232  LGAAHGLSSILQMLLSYQEHLKPSD-RELVRQSVDFLMEQE-QNCNWPPELGETIERENE 289

Query: 1224 LVHWCHGAPGVIHTLMQAYKVFKEEKYLTDAVECSDVIWQRGLLRKGYGICHGTAGNGY 1400
            LVHWCHGAPG+ +   +AY + K+ +YL   + C ++ WQ+GLL+KG GICHG AG+ Y
Sbjct: 290  LVHWCHGAPGIAYLFAKAYLISKKPQYLDTCIRCGELTWQKGLLKKGPGICHGVAGSAY 348



 Score = 41.6 bits (96), Expect(2) = 2e-43
 Identities = 21/50 (42%), Positives = 31/50 (62%), Gaps = 1/50 (2%)
 Frame = +2

Query: 1424 TQDKKYLYRALQFAEWCL-EYXAHGCRISDRPYSLFEGMGGRIHFLSDIL 1570
            T + KY+YRA +FA++   E    G R+ +  YSL+EG  G + FL D+L
Sbjct: 357  TGNSKYIYRAQRFAQFLFTEEFKSGSRVLESIYSLYEGFSGTVCFLIDLL 406


  Database: RefSeqMP
    Posted date:  Aug 2, 2006 12:58 AM
  Number of letters in database: 21,768,885
  Number of sequences in database:  45,328
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 74,486,069
Number of Sequences: 45328
Number of extensions: 2011908
Number of successful extensions: 12264
Number of sequences better than 1.0e-05: 4
Number of HSP's better than  0.0 without gapping: 7633
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 12131
length of database: 21,768,885
effective HSP length: 108
effective length of database: 16,873,461
effective search space used: 7019359776
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)