Animal-Genome cDNA 20060611C-001748


Search to RefSeqSP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611C-001748
         (955 letters)

Database: RefSeqSP 
           1040 sequences; 434,620 total letters

Searching...done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_999238.1| 20-beta-hydroxysteroid dehydrogenase [Sus scrofa]     54   6e-09
Alignment   gi|NP_999471.1| 17beta-estradiol dehydrogenase [Sus scrofa]           54   7e-09

>ref|NP_999238.1| 20-beta-hydroxysteroid dehydrogenase [Sus scrofa]
          Length = 289

 Score = 53.9 bits (128), Expect = 6e-09
 Identities = 37/103 (35%), Positives = 51/103 (49%), Gaps = 1/103 (0%)
 Frame = +1

Query: 247 KTVLITGANSGLGRATAAELLR-LGARVIMGCRDRARAEEAAGQLRRELRQTEGPEEGPN 423
           +  L+TGAN G+G A   +L R     V++  RD AR + A  QL     Q EG      
Sbjct: 6   RVALVTGANKGIGFAIVRDLCRQFAGDVVLTARDVARGQAAVKQL-----QAEGLSPR-- 58

Query: 424 SGGAGELVVRELDLASLRSVRAFCQEMLQEEPRLDVLINNAGI 552
                     +LD+  L+S+RA C  + +E   LDVL+NNA I
Sbjct: 59  --------FHQLDIIDLQSIRALCDFLRKEYGGLDVLVNNAAI 93


>ref|NP_999471.1| 17beta-estradiol dehydrogenase [Sus scrofa]
          Length = 737

 Score = 53.5 bits (127), Expect = 7e-09
 Identities = 55/214 (25%), Positives = 87/214 (40%), Gaps = 8/214 (3%)
 Frame = +1

Query: 241 HGKTVLITGANSGLGRATAAELLRLGARVIMG-----CRDRARAEEAAGQLRRELRQTEG 405
           +G+ VL+TGA  GLGR  A      GA V++       +   +   AA ++  E+R+  G
Sbjct: 8   YGRVVLVTGAGGGLGRTYALAFAERGASVVVNDLGGDMKGVGKGSLAADKVVEEIRRKGG 67

Query: 406 PE-EGPNSGGAGELVVRELDLASLRSVRAFCQEMLQEEPRLDVLINNAGIFQCPYMK--T 576
                 +S  AGE +V+                 L    R+DV++NNAGI +       +
Sbjct: 68  KAVANYDSVEAGEKIVK---------------AALDAFGRIDVVVNNAGILRDRSFSRIS 112

Query: 577 EDGFEMQFAVXXXXXXXXXXXXXXXXKSSAPSRIVVVSSKLYKYGDINFEDLNSEQSYNK 756
           ++ ++M   V                K     RI++ SS    YG  NF   N       
Sbjct: 113 DEDWDMIQRVHLRGSFMVTRAAWDHMKKQNFGRIIMTSSAAGIYG--NFGQAN------- 163

Query: 757 SFCYSRSKLANILFTRELARPLRRHKCHCQRIAP 858
              YS +KL  +  +  LA   +++  HC  +AP
Sbjct: 164 ---YSAAKLGLLGLSNSLAVEGKKNNIHCNTVAP 194


  Database: RefSeqSP
    Posted date:  Aug 1, 2006  7:14 PM
  Number of letters in database: 434,620
  Number of sequences in database:  1040
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 764,512
Number of Sequences: 1040
Number of extensions: 17655
Number of successful extensions: 63
Number of sequences better than 1.0e-05: 2
Number of HSP's better than  0.0 without gapping: 55
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 60
length of database: 434,620
effective HSP length: 77
effective length of database: 354,540
effective search space used: 85089600
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqBP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611C-001748
         (955 letters)

Database: RefSeqBP 
           33,508 sequences; 16,112,626 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|XP_582319.2| PREDICTED: similar to retinol dehydrogenase 14 ...   376   e-122
Alignment   gi|NP_899207.1| double substrate-specificity short chain dehydr...   166   7e-46
Alignment   gi|XP_592820.2| PREDICTED: similar to retinol dehydrogenase 11 ...   137   1e-32
Alignment   gi|XP_870721.1| PREDICTED: similar to Retinol dehydrogenase 11 ...   112   6e-28
Alignment   gi|XP_582373.2| PREDICTED: similar to Retinol dehydrogenase 11 ...   108   8e-27
Alignment   gi|XP_584642.2| PREDICTED: similar to retinol dehydrogenase 11 ...   101   4e-25
Alignment   gi|XP_584629.2| PREDICTED: similar to Retinol dehydrogenase 13,...   104   1e-22
Alignment   gi|XP_583859.2| PREDICTED: similar to short chain dehydrogenase...    84   1e-16
Alignment   gi|XP_591168.2| PREDICTED: similar to dehydrogenase/reductase (...    80   2e-15
Alignment   gi|XP_876208.1| PREDICTED: similar to WW domain-containing oxid...    78   1e-14

>ref|XP_582319.2| PREDICTED: similar to retinol dehydrogenase 14 (all-trans and
           9-cis) [Bos taurus]
          Length = 420

 Score =  376 bits (966), Expect(2) = e-122
 Identities = 199/268 (74%), Positives = 205/268 (76%)
 Frame = +1

Query: 19  PRVLCVQVAALAPGARRLRKSCEGDGGPSXXXXXXXXXXXXXXXXXXXXXXXXXRRFVGP 198
           P VLCVQVA   PG  R RKS  G GGPS                         RRFVG 
Sbjct: 52  PSVLCVQVAGFGPGKPRPRKSRAGAGGPSAPVAMAVGTAAALLAALGGILWLAARRFVGS 111

Query: 199 SVQRLHRGGDSGLMHGKTVLITGANSGLGRATAAELLRLGARVIMGCRDRARAEEAAGQL 378
           SVQRLH+G DSGLM GKTVLITGANSGLGRATAAELLRLGARVIMGCRDR RAEEAAGQL
Sbjct: 112 SVQRLHQGRDSGLMRGKTVLITGANSGLGRATAAELLRLGARVIMGCRDRERAEEAAGQL 171

Query: 379 RRELRQTEGPEEGPNSGGAGELVVRELDLASLRSVRAFCQEMLQEEPRLDVLINNAGIFQ 558
           RRE+    GP+ GPNSGGAGELVV+ELDLASL SVR+FCQEMLQEEPRLDVLINNAG+FQ
Sbjct: 172 RREVCPAGGPDSGPNSGGAGELVVKELDLASLSSVRSFCQEMLQEEPRLDVLINNAGVFQ 231

Query: 559 CPYMKTEDGFEMQFAVXXXXXXXXXXXXXXXXKSSAPSRIVVVSSKLYKYGDINFEDLNS 738
           CPYMKTEDGFEMQF V                KSSAPSRIVVVSSKLYKYGDINFEDLNS
Sbjct: 232 CPYMKTEDGFEMQFGVNHLGHFLLTNLLLGLLKSSAPSRIVVVSSKLYKYGDINFEDLNS 291

Query: 739 EQSYNKSFCYSRSKLANILFTRELARPL 822
           EQSYNKSFCYSRSKLANILFTRELAR L
Sbjct: 292 EQSYNKSFCYSRSKLANILFTRELARRL 319



 Score = 82.0 bits (201), Expect(2) = e-122
 Identities = 39/43 (90%), Positives = 40/43 (93%)
 Frame = +2

Query: 818 RLEGTNVTVNVLHPGIVRTNLGRHIHIPLLVRPLFNLVVMGFF 946
           RLEGT+VTVNVLHPGIVRTNLGRHIHIPLLVRPLFNLV   FF
Sbjct: 318 RLEGTSVTVNVLHPGIVRTNLGRHIHIPLLVRPLFNLVSWAFF 360


>ref|NP_899207.1| double substrate-specificity short chain dehydrogenase/reductase 2
           [Bos taurus]
          Length = 316

 Score =  166 bits (419), Expect(2) = 7e-46
 Identities = 89/215 (41%), Positives = 126/215 (58%), Gaps = 3/215 (1%)
 Frame = +1

Query: 190 VGPSVQRLHRGG---DSGLMHGKTVLITGANSGLGRATAAELLRLGARVIMGCRDRARAE 360
           + PS+++   GG       + GK V+ITGAN+G+G+ TA EL R GARV + CRD  + E
Sbjct: 18  IAPSIRKFFAGGVCRTDVQLFGKVVVITGANTGIGKETARELARRGARVYIACRDVLKGE 77

Query: 361 EAAGQLRRELRQTEGPEEGPNSGGAGELVVRELDLASLRSVRAFCQEMLQEEPRLDVLIN 540
            AA +++ + + ++             ++VR+LDL+  +S+RAF +  L EE +L +LIN
Sbjct: 78  SAASEIQADTKNSQ-------------VLVRKLDLSDTKSIRAFAEGFLAEEKQLHILIN 124

Query: 541 NAGIFQCPYMKTEDGFEMQFAVXXXXXXXXXXXXXXXXKSSAPSRIVVVSSKLYKYGDIN 720
           NAG+  CPY KT DGFE   AV                K SAP+R+V +SS  +  G I 
Sbjct: 125 NAGVMLCPYSKTADGFETHLAVNHLGHFLLTHLLLGRLKESAPARVVNLSSVAHHLGKIR 184

Query: 721 FEDLNSEQSYNKSFCYSRSKLANILFTRELARPLR 825
           F DL  ++ YN  F Y  SKLAN+LFTRELA+ L+
Sbjct: 185 FHDLQGDKYYNLGFAYCHSKLANVLFTRELAKRLK 219



 Score = 37.0 bits (84), Expect(2) = 7e-46
 Identities = 18/36 (50%), Positives = 24/36 (66%)
 Frame = +2

Query: 818 RLEGTNVTVNVLHPGIVRTNLGRHIHIPLLVRPLFN 925
           RL+GT VT   +HPGIVR+ L RH  +  L+  LF+
Sbjct: 217 RLKGTGVTTYAVHPGIVRSKLVRHSFLLCLLWRLFS 252


>ref|XP_592820.2| PREDICTED: similar to retinol dehydrogenase 11 (predicted) [Bos
           taurus]
          Length = 377

 Score =  137 bits (345), Expect = 1e-32
 Identities = 86/209 (41%), Positives = 112/209 (53%), Gaps = 2/209 (0%)
 Frame = +1

Query: 238 MHGKTVLITGANSGLGRATAAELLRLGARVIMGCRDRARAEEAAGQLRRELRQTEGPEEG 417
           + G+T ++TGANSG+G+ TA EL R GARV++ CR R R E AA  LR+E          
Sbjct: 34  LRGRTAVVTGANSGIGKMTALELARRGARVVLACRSRERGEAAAFDLRQE---------- 83

Query: 418 PNSGGAGELVVRELDLASLRSVRAFCQEMLQEEPRLDVLINNAGIFQCPYMKTEDGFEMQ 597
               G  E++   LDLASL SVRAF    L  EPRLD+LI+NAGI  C   +T + F + 
Sbjct: 84  ---SGNNEVIFMALDLASLASVRAFATAFLSSEPRLDILIHNAGISSCG--RTREPFNLL 138

Query: 598 FAVXXXXXXXXXXXXXXXXKSSAPSRIVVVSSKLYKYGDINFEDLNSEQS--YNKSFCYS 771
             V                K+SAPSR+VVVSS  ++ G ++F  L+        +   Y+
Sbjct: 139 LRVNHIGPFLLTHLLLPRLKTSAPSRVVVVSSAAHRRGRLDFTRLDHPVVGWQQELRAYA 198

Query: 772 RSKLANILFTRELARPLRRHKCHCQRIAP 858
            SKLAN+LF RELA  L      C    P
Sbjct: 199 NSKLANVLFARELATQLEGTGVTCYAAHP 227


>ref|XP_870721.1| PREDICTED: similar to Retinol dehydrogenase 11 (Retinal reductase
           1) (RalR1) (Prostate short-chain dehydrogenase/reductase
           1) (Androgen-regulated short-chain
           dehydrogenase/reductase 1) (HCV core-binding protein
           HCBP12) isoform 2 [Bos taurus]
          Length = 314

 Score =  112 bits (281), Expect(2) = 6e-28
 Identities = 68/194 (35%), Positives = 102/194 (52%)
 Frame = +1

Query: 244 GKTVLITGANSGLGRATAAELLRLGARVIMGCRDRARAEEAAGQLRRELRQTEGPEEGPN 423
           GK  ++TGAN+G+G+ TA EL R GARV + CRD    E  A    RE++   G ++   
Sbjct: 15  GKVAVVTGANAGIGKETAKELARRGARVYLACRDVQNGELVA----REIQMMTGNQQ--- 67

Query: 424 SGGAGELVVRELDLASLRSVRAFCQEMLQEEPRLDVLINNAGIFQCPYMKTEDGFEMQFA 603
                 ++VR+LDLA  +S+RAF +  L++   + ++ ++     C +  +  G +    
Sbjct: 68  ------VLVRKLDLADTKSIRAFAKRFLEDHKYIHLINSSPHFLICGFPGSSAGKDSACN 121

Query: 604 VXXXXXXXXXXXXXXXXKSSAPSRIVVVSSKLYKYGDINFEDLNSEQSYNKSFCYSRSKL 783
                            + SAPSR+V VSS  +  G I+F +L  E+ Y     Y  SKL
Sbjct: 122 TGYLGHFLLTHLLLEKLEESAPSRVVNVSSLAHLLGRIHFHNLQGEKFYQSGLAYCHSKL 181

Query: 784 ANILFTRELARPLR 825
           ANILFT+ELAR L+
Sbjct: 182 ANILFTQELARRLK 195



 Score = 30.0 bits (66), Expect(2) = 6e-28
 Identities = 13/24 (54%), Positives = 17/24 (70%)
 Frame = +2

Query: 818 RLEGTNVTVNVLHPGIVRTNLGRH 889
           RL+G+ VTV  +HPG V + L RH
Sbjct: 193 RLKGSGVTVYSVHPGTVNSELVRH 216


>ref|XP_582373.2| PREDICTED: similar to Retinol dehydrogenase 11 (Retinal reductase
           1) (RalR1) (Prostate short-chain dehydrogenase/reductase
           1) (Androgen-regulated short-chain
           dehydrogenase/reductase 1) (HCV core-binding protein
           HCBP12) isoform 1 [Bos taurus]
          Length = 308

 Score =  108 bits (271), Expect(2) = 8e-27
 Identities = 71/194 (36%), Positives = 102/194 (52%)
 Frame = +1

Query: 244 GKTVLITGANSGLGRATAAELLRLGARVIMGCRDRARAEEAAGQLRRELRQTEGPEEGPN 423
           GK  ++TGAN+G+G+ TA EL R GARV + CRD    E  A    RE++   G ++   
Sbjct: 15  GKVAVVTGANAGIGKETAKELARRGARVYLACRDVQNGELVA----REIQMMTGNQQ--- 67

Query: 424 SGGAGELVVRELDLASLRSVRAFCQEMLQEEPRLDVLINNAGIFQCPYMKTEDGFEMQFA 603
                 ++VR+LDLA  +S+RAF +  L++   +  LIN+ G     +  +  G +    
Sbjct: 68  ------VLVRKLDLADTKSIRAFAKRFLEDHKYIH-LINSVG-----FPGSSAGKDSACN 115

Query: 604 VXXXXXXXXXXXXXXXXKSSAPSRIVVVSSKLYKYGDINFEDLNSEQSYNKSFCYSRSKL 783
                            + SAPSR+V VSS  +  G I+F +L  E+ Y     Y  SKL
Sbjct: 116 TGYLGHFLLTHLLLEKLEESAPSRVVNVSSLAHLLGRIHFHNLQGEKFYQSGLAYCHSKL 175

Query: 784 ANILFTRELARPLR 825
           ANILFT+ELAR L+
Sbjct: 176 ANILFTQELARRLK 189



 Score = 30.0 bits (66), Expect(2) = 8e-27
 Identities = 13/24 (54%), Positives = 17/24 (70%)
 Frame = +2

Query: 818 RLEGTNVTVNVLHPGIVRTNLGRH 889
           RL+G+ VTV  +HPG V + L RH
Sbjct: 187 RLKGSGVTVYSVHPGTVNSELVRH 210


>ref|XP_584642.2| PREDICTED: similar to retinol dehydrogenase 11 (predicted) [Bos
           taurus]
          Length = 330

 Score =  101 bits (251), Expect(2) = 4e-25
 Identities = 63/197 (31%), Positives = 105/197 (53%), Gaps = 3/197 (1%)
 Frame = +1

Query: 244 GKTVLITGANSGLGRATAAELLRLGARVIMGCRDRARAEEAAGQLRRELRQTEGPEEGPN 423
           GKT ++TGANSG+G+A + EL   GARVI+ CR R R ++A  +++   +          
Sbjct: 49  GKTAVVTGANSGIGKAVSQELAHRGARVILACRSRERGQQALAEIQATSK---------- 98

Query: 424 SGGAGELVVRELDLASLRSVRAFCQEMLQEEPRLDVLINNAGIFQCPYMKTEDGFEMQFA 603
              +  L++ E+DL+S+ S+R+F Q +LQE P + +L+NNA +   P   T +G ++ FA
Sbjct: 99  ---SNRLLLGEVDLSSMASIRSFAQRLLQECPEIHLLVNNAAVCGFPTTLTPEGLDLTFA 155

Query: 604 VXXXXXXXXXXXXXXXXKSSAPSRIVVVSSKLYKYGDINFEDL---NSEQSYNKSFCYSR 774
                            + +  +R+V VSS    +G I+ + L       ++N++  Y  
Sbjct: 156 TNYTGPFLLTNLLQGALQRAGSARVVNVSSFRQSHGYIDEDHLIGAGRPLTFNQN--YDC 213

Query: 775 SKLANILFTRELARPLR 825
           SKL    FT +LA+ L+
Sbjct: 214 SKLLLASFTGKLAQRLQ 230



 Score = 32.0 bits (71), Expect(2) = 4e-25
 Identities = 13/24 (54%), Positives = 18/24 (75%)
 Frame = +2

Query: 818 RLEGTNVTVNVLHPGIVRTNLGRH 889
           RL+GT VTVN + PG+V T + +H
Sbjct: 228 RLQGTGVTVNSVDPGVVYTKIMKH 251


>ref|XP_584629.2| PREDICTED: similar to Retinol dehydrogenase 13, partial [Bos
           taurus]
          Length = 148

 Score =  104 bits (259), Expect = 1e-22
 Identities = 52/121 (42%), Positives = 74/121 (61%)
 Frame = +1

Query: 244 GKTVLITGANSGLGRATAAELLRLGARVIMGCRDRARAEEAAGQLRRELRQTEGPEEGPN 423
           GKTV++TGAN+G+G+ TA EL + G  +I+ CRD  + E AA ++R E            
Sbjct: 38  GKTVIVTGANTGIGKQTALELAKRGGNIILACRDMEKCEAAAKEIRGETLNHR------- 90

Query: 424 SGGAGELVVRELDLASLRSVRAFCQEMLQEEPRLDVLINNAGIFQCPYMKTEDGFEMQFA 603
                 +  R LDLASL+S+R F  ++ +EE  + +LINNA + +CP+  TEDGFEMQ  
Sbjct: 91  ------VNARHLDLASLKSIREFAAKVTEEEEHVHILINNAAVMRCPHWTTEDGFEMQLG 144

Query: 604 V 606
           V
Sbjct: 145 V 145


>ref|XP_583859.2| PREDICTED: similar to short chain dehydrogenase/reductase [Bos
           taurus]
          Length = 317

 Score = 84.3 bits (207), Expect = 1e-16
 Identities = 58/192 (30%), Positives = 91/192 (47%), Gaps = 1/192 (0%)
 Frame = +1

Query: 244 GKTVLITGANSGLGRATAAELLRLGARVIMGCRDRARAEEAAGQLRRELRQTEGPEEGPN 423
           G+  ++TG NSG+G+ATA E+ + G  V + CRD +RAE A  ++ RE            
Sbjct: 40  GRAFMVTGGNSGIGKATAMEIAKRGGTVHLVCRDHSRAEGAKAEIIRE------------ 87

Query: 424 SGGAGELVVRELDLASLRSVRAFCQEMLQEEPRLDVLINNAGIFQCPYMKTEDGFEMQFA 603
             G   + +  +DL+  +SV  F +   QE   L+VLINNAG        TEDG E  FA
Sbjct: 88  -SGNQNIFLHIVDLSLPKSVWKFVENFKQEH-TLNVLINNAGCMVNKRELTEDGLEKNFA 145

Query: 604 VXXXXXXXXXXXXXXXXKSSAPSRIVVVSSKLYKYGDINFEDLNSEQ-SYNKSFCYSRSK 780
                            +     R++ VSS       +N +D  SE+ +++ +  Y+++K
Sbjct: 146 TNTLGVYVLTTALIPVLEKEHDPRVITVSSGGMLVQKLNTDDPQSERTAFDGTMVYAQNK 205

Query: 781 LANILFTRELAR 816
              ++ T   AR
Sbjct: 206 RQQVVLTERWAR 217


>ref|XP_591168.2| PREDICTED: similar to dehydrogenase/reductase (SDR family) X-linked
           [Bos taurus]
          Length = 251

 Score = 80.5 bits (197), Expect = 2e-15
 Identities = 48/121 (39%), Positives = 65/121 (53%), Gaps = 4/121 (3%)
 Frame = +1

Query: 460 DLASLRSVRAFCQEMLQEEPRLDVLINNAGIFQCPYMKTEDGFEMQFAV-XXXXXXXXXX 636
           DLAS+RS+R F Q    ++  L VL+NNAG+   P   TEDGFE  F V           
Sbjct: 11  DLASMRSIREFVQTFKMKKLPLHVLVNNAGVMMVPQRTTEDGFEEHFGVNYLGHFLLTNL 70

Query: 637 XXXXXXKSSAP---SRIVVVSSKLYKYGDINFEDLNSEQSYNKSFCYSRSKLANILFTRE 807
                 +S AP   +R+V VSS  +  G++N +DL S   Y+    Y++SKLA +LFT  
Sbjct: 71  LLDTLQESGAPGHSARVVTVSSATHYVGELNLDDLQSSTYYSAHAAYAQSKLALVLFTYH 130

Query: 808 L 810
           L
Sbjct: 131 L 131


>ref|XP_876208.1| PREDICTED: similar to WW domain-containing oxidoreductase isoform 1
           [Bos taurus]
          Length = 745

 Score = 77.8 bits (190), Expect = 1e-14
 Identities = 52/130 (40%), Positives = 68/130 (52%), Gaps = 8/130 (6%)
 Frame = +1

Query: 457 LDLASLRSVRAFCQEMLQEEPRLDVLINNAGIFQCPYMKTEDGFEMQFAVXXXXXXXXXX 636
           LDLA LRSV+ F Q    +   L VL+ NA +F  P+  T+DG E  F V          
Sbjct: 13  LDLALLRSVQHFAQAFKAKNVSLHVLVCNAAVFGLPWTLTKDGLETTFQVNHLGHFYLVQ 72

Query: 637 XXXXXXKSSAPSRIVVVSSKLYKYGDIN-------FEDLN-SEQSYNKSFCYSRSKLANI 792
                   SAP+R+VVVSS+ +++ DIN       F  L+ S+  Y     Y+RSKL NI
Sbjct: 73  LLQDVLCRSAPARVVVVSSESHRFTDINDSSGKLDFSRLSPSKNDYWAMLAYNRSKLCNI 132

Query: 793 LFTRELARPL 822
           LF+ EL R L
Sbjct: 133 LFSNELHRRL 142


  Database: RefSeqBP
    Posted date:  Aug 1, 2006  7:14 PM
  Number of letters in database: 16,112,626
  Number of sequences in database:  33,508
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 29,034,036
Number of Sequences: 33508
Number of extensions: 703134
Number of successful extensions: 2885
Number of sequences better than 1.0e-05: 10
Number of HSP's better than  0.0 without gapping: 2541
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2830
length of database: 16,112,626
effective HSP length: 101
effective length of database: 12,728,318
effective search space used: 2749316688
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqHP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611C-001748
         (955 letters)

Database: RefSeqHP 
           39,411 sequences; 17,774,539 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_065956.1| retinol dehydrogenase 14 (all-trans and 9-cis) ...   345   e-113
Alignment   gi|NP_689656.1| retinol dehydrogenase 12 (all-trans and 9-cis) ...   166   8e-46
Alignment   gi|NP_057110.2| androgen-regulated short-chain dehydrogenase/re...   158   6e-39
Alignment   gi|NP_612421.1| retinol dehydrogenase 13 (all-trans and 9-cis) ...   118   2e-33
Alignment   gi|NP_660160.1| dehydrogenase/reductase (SDR family) X-linked [...    99   2e-24
Alignment   gi|NP_057457.1| WW domain-containing oxidoreductase isoform 1 [...   108   7e-24
Alignment   gi|NP_653284.1| hypothetical protein LOC147015 [Homo sapiens]        107   1e-23
Alignment   gi|XP_371503.3| PREDICTED: similar to short-chain dehydrogenase...    79   7e-15
Alignment   gi|XP_947127.1| PREDICTED: similar to short-chain dehydrogenase...    79   7e-15
Alignment   gi|NP_055049.1| estradiol 17 beta-dehydrogenase 8 [Homo sapiens]      54   3e-07

>ref|NP_065956.1| retinol dehydrogenase 14 (all-trans and 9-cis) [Homo sapiens]
          Length = 336

 Score =  345 bits (884), Expect(2) = e-113
 Identities = 183/216 (84%), Positives = 185/216 (85%), Gaps = 2/216 (0%)
 Frame = +1

Query: 181 RRFVGPSVQRLHRGGDSGLMHGKTVLITGANSGLGRATAAELLRLGARVIMGCRDRARAE 360
           RRFVGP VQRL RGGD GLMHGKTVLITGANSGLGRATAAELLRLGARVIMGCRDRARAE
Sbjct: 22  RRFVGPRVQRLRRGGDPGLMHGKTVLITGANSGLGRATAAELLRLGARVIMGCRDRARAE 81

Query: 361 EAAGQLRRELRQTE--GPEEGPNSGGAGELVVRELDLASLRSVRAFCQEMLQEEPRLDVL 534
           EAAGQLRRELRQ    GPE  P   G GEL+VRELDLASLRSVRAFCQEMLQEEPRLDVL
Sbjct: 82  EAAGQLRRELRQAAECGPE--PGVSGVGELIVRELDLASLRSVRAFCQEMLQEEPRLDVL 139

Query: 535 INNAGIFQCPYMKTEDGFEMQFAVXXXXXXXXXXXXXXXXKSSAPSRIVVVSSKLYKYGD 714
           INNAGIFQCPYMKTEDGFEMQF V                KSSAPSRIVVVSSKLYKYGD
Sbjct: 140 INNAGIFQCPYMKTEDGFEMQFGVNHLGHFLLTNLLLGLLKSSAPSRIVVVSSKLYKYGD 199

Query: 715 INFEDLNSEQSYNKSFCYSRSKLANILFTRELARPL 822
           INF+DLNSEQSYNKSFCYSRSKLANILFTRELAR L
Sbjct: 200 INFDDLNSEQSYNKSFCYSRSKLANILFTRELARRL 235



 Score = 82.8 bits (203), Expect(2) = e-113
 Identities = 39/43 (90%), Positives = 40/43 (93%)
 Frame = +2

Query: 818 RLEGTNVTVNVLHPGIVRTNLGRHIHIPLLVRPLFNLVVMGFF 946
           RLEGTNVTVNVLHPGIVRTNLGRHIHIPLLV+PLFNLV   FF
Sbjct: 234 RLEGTNVTVNVLHPGIVRTNLGRHIHIPLLVKPLFNLVSWAFF 276


>ref|NP_689656.1| retinol dehydrogenase 12 (all-trans and 9-cis) [Homo sapiens]
          Length = 316

 Score =  166 bits (419), Expect(2) = 8e-46
 Identities = 91/215 (42%), Positives = 127/215 (59%), Gaps = 3/215 (1%)
 Frame = +1

Query: 190 VGPSVQRLHRGG---DSGLMHGKTVLITGANSGLGRATAAELLRLGARVIMGCRDRARAE 360
           V PS+++   GG    +  + GK V+ITGAN+G+G+ TA EL   GARV + CRD  + E
Sbjct: 18  VAPSIRKFFAGGVCRTNVQLPGKVVVITGANTGIGKETARELASRGARVYIACRDVLKGE 77

Query: 361 EAAGQLRRELRQTEGPEEGPNSGGAGELVVRELDLASLRSVRAFCQEMLQEEPRLDVLIN 540
            AA ++R + + ++             ++VR+LDL+  +S+RAF +  L EE +L +LIN
Sbjct: 78  SAASEIRVDTKNSQ-------------VLVRKLDLSDTKSIRAFAEGFLAEEKQLHILIN 124

Query: 541 NAGIFQCPYMKTEDGFEMQFAVXXXXXXXXXXXXXXXXKSSAPSRIVVVSSKLYKYGDIN 720
           NAG+  CPY KT DGFE    V                K SAP+R+V VSS  +  G I 
Sbjct: 125 NAGVMMCPYSKTADGFETHLGVNHLGHFLLTYLLLEQLKVSAPARVVNVSSVAHHIGKIP 184

Query: 721 FEDLNSEQSYNKSFCYSRSKLANILFTRELARPLR 825
           F DL SE+ Y++ F Y  SKLAN+LFTRELA+ L+
Sbjct: 185 FHDLQSEKRYSRGFAYCHSKLANVLFTRELAKRLQ 219



 Score = 37.0 bits (84), Expect(2) = 8e-46
 Identities = 17/36 (47%), Positives = 24/36 (66%)
 Frame = +2

Query: 818 RLEGTNVTVNVLHPGIVRTNLGRHIHIPLLVRPLFN 925
           RL+GT VT   +HPG+VR+ L RH  +  L+  LF+
Sbjct: 217 RLQGTGVTTYAVHPGVVRSELVRHSSLLCLLWRLFS 252


>ref|NP_057110.2| androgen-regulated short-chain dehydrogenase/reductase 1 [Homo
           sapiens]
          Length = 318

 Score =  158 bits (400), Expect = 6e-39
 Identities = 89/194 (45%), Positives = 116/194 (59%)
 Frame = +1

Query: 244 GKTVLITGANSGLGRATAAELLRLGARVIMGCRDRARAEEAAGQLRRELRQTEGPEEGPN 423
           GK V++TGAN+G+G+ TA EL + GARV + CRD  + E  A    +E++ T G ++   
Sbjct: 41  GKVVVVTGANTGIGKETAKELAQRGARVYLACRDVEKGELVA----KEIQTTTGNQQ--- 93

Query: 424 SGGAGELVVRELDLASLRSVRAFCQEMLQEEPRLDVLINNAGIFQCPYMKTEDGFEMQFA 603
                 ++VR+LDL+  +S+RAF +  L EE  L VLINNAG+  CPY KT DGFEM   
Sbjct: 94  ------VLVRKLDLSDTKSIRAFAKGFLAEEKHLHVLINNAGVMMCPYSKTADGFEMHIG 147

Query: 604 VXXXXXXXXXXXXXXXXKSSAPSRIVVVSSKLYKYGDINFEDLNSEQSYNKSFCYSRSKL 783
           V                K SAPSRIV VSS  +  G I+F +L  E+ YN    Y  SKL
Sbjct: 148 VNHLGHFLLTHLLLEKLKESAPSRIVNVSSLAHHLGRIHFHNLQGEKFYNAGLAYCHSKL 207

Query: 784 ANILFTRELARPLR 825
           ANILFT+ELAR L+
Sbjct: 208 ANILFTQELARRLK 221


>ref|NP_612421.1| retinol dehydrogenase 13 (all-trans and 9-cis) [Homo sapiens]
          Length = 260

 Score =  118 bits (296), Expect(2) = 2e-33
 Identities = 61/126 (48%), Positives = 84/126 (66%), Gaps = 1/126 (0%)
 Frame = +1

Query: 451 RELDLASLRSVRAFCQEMLQEEPRLDVLINNAGIFQCPYMKTEDGFEMQFAVXXXXXXXX 630
           R LDLASL+S+R F  ++++EE R+D+LINNAG+ +CP+  TEDGFEMQF V        
Sbjct: 23  RHLDLASLKSIREFAAKIIEEEERVDILINNAGVMRCPHWTTEDGFEMQFGVNHLGHFLL 82

Query: 631 XXXXXXXXKSSAPSRIVVVSSKLYKYGDINFEDLN-SEQSYNKSFCYSRSKLANILFTRE 807
                   K+SAPSRI+ +SS  +  G I+F+DLN   + YN    Y +SKLA +LFT+E
Sbjct: 83  TNLLLDKLKASAPSRIINLSSLAHVAGHIDFDDLNWQTRKYNTKAAYCQSKLAIVLFTKE 142

Query: 808 LARPLR 825
           L+R L+
Sbjct: 143 LSRRLQ 148



 Score = 42.7 bits (99), Expect(2) = 2e-33
 Identities = 18/27 (66%), Positives = 21/27 (77%)
 Frame = +2

Query: 818 RLEGTNVTVNVLHPGIVRTNLGRHIHI 898
           RL+G+ VTVN LHPG+ RT LGRH  I
Sbjct: 146 RLQGSGVTVNALHPGVARTELGRHTGI 172


>ref|NP_660160.1| dehydrogenase/reductase (SDR family) X-linked [Homo sapiens]
          Length = 330

 Score = 99.0 bits (245), Expect(2) = 2e-24
 Identities = 62/202 (30%), Positives = 95/202 (47%), Gaps = 4/202 (1%)
 Frame = +1

Query: 247 KTVLITGANSGLGRATAAELLRLGARVIMGCRDRARAEEAAGQLRRELRQTEGPEEGPNS 426
           +  ++TG   G+G +TA  L RLG  VI+   + ++A++   +++ E    +        
Sbjct: 44  RVAIVTGGTDGIGYSTAKHLARLGMHVIIAGNNDSKAKQVVSKIKEETLNDK-------- 95

Query: 427 GGAGELVVRELDLASLRSVRAFCQEMLQEEPRLDVLINNAGIFQCPYMKTEDGFEMQFAV 606
                +     DLAS+ S+R F Q+   ++  L VLINNAG+   P  KT DGFE  F +
Sbjct: 96  -----VEFLYCDLASMTSIRQFVQKFKMKKIPLHVLINNAGVMMVPQRKTRDGFEEHFGL 150

Query: 607 XXXXXXXXXXXXXXXXKSSA----PSRIVVVSSKLYKYGDINFEDLNSEQSYNKSFCYSR 774
                           K S      +R+V VSS  +   ++N +DL S   Y+    Y++
Sbjct: 151 NYLGHFLLTNLLLDTLKESGSPGHSARVVTVSSATHYVAELNMDDLQSSACYSPHAAYAQ 210

Query: 775 SKLANILFTRELARPLRRHKCH 840
           SKLA +LFT  L R L     H
Sbjct: 211 SKLALVLFTYHLQRLLAAEGSH 232



 Score = 32.3 bits (72), Expect(2) = 2e-24
 Identities = 12/23 (52%), Positives = 19/23 (82%)
 Frame = +2

Query: 824 EGTNVTVNVLHPGIVRTNLGRHI 892
           EG++VT NV+ PG+V T+L +H+
Sbjct: 229 EGSHVTANVVDPGVVNTDLYKHV 251


>ref|NP_057457.1| WW domain-containing oxidoreductase isoform 1 [Homo sapiens]
          Length = 414

 Score =  108 bits (270), Expect = 7e-24
 Identities = 73/201 (36%), Positives = 101/201 (50%), Gaps = 8/201 (3%)
 Frame = +1

Query: 244 GKTVLITGANSGLGRATAAELLRLGARVIMGCRDRARAEEAAGQLRRELRQTEGPEEGPN 423
           GK V++TGANSG+G  TA      GA VI+ CR+ ARA EA  ++  E  +         
Sbjct: 124 GKVVVVTGANSGIGFETAKSFALHGAHVILACRNMARASEAVSRILEEWHK--------- 174

Query: 424 SGGAGELVVRELDLASLRSVRAFCQEMLQEEPRLDVLINNAGIFQCPYMKTEDGFEMQFA 603
                ++    LDLA LRSV+ F +    +   L VL+ NA  F  P+  T+DG E  F 
Sbjct: 175 ----AKVEAMTLDLALLRSVQHFAEAFKAKNVPLHVLVCNAATFALPWSLTKDGLETTFQ 230

Query: 604 VXXXXXXXXXXXXXXXXKSSAPSRIVVVSSKLYKYGDIN-------FEDLN-SEQSYNKS 759
           V                  SAP+R++VVSS+ +++ DIN       F  L+ ++  Y   
Sbjct: 231 VNHLGHFYLVQLLQDVLCRSAPARVIVVSSESHRFTDINDSLGKLDFSRLSPTKNDYWAM 290

Query: 760 FCYSRSKLANILFTRELARPL 822
             Y+RSKL NILF+ EL R L
Sbjct: 291 LAYNRSKLCNILFSNELHRRL 311


>ref|NP_653284.1| hypothetical protein LOC147015 [Homo sapiens]
          Length = 327

 Score =  107 bits (268), Expect = 1e-23
 Identities = 73/191 (38%), Positives = 96/191 (50%), Gaps = 2/191 (1%)
 Frame = +1

Query: 292 TAAELLRLGARVIMGCRDRARAEEAAGQLRRELRQTEGPEEGPNSGGAGELVVRELDLAS 471
           TA EL R GARV++ CR + R E AA  LR+E              G  E++   LDLAS
Sbjct: 2   TALELARRGARVVLACRSQERGEAAAFDLRQE-------------SGNNEVIFMALDLAS 48

Query: 472 LRSVRAFCQEMLQEEPRLDVLINNAGIFQCPYMKTEDGFEMQFAVXXXXXXXXXXXXXXX 651
           L SVRAF    L  EPRLD+LI+NAGI  C   +T + F +   V               
Sbjct: 49  LASVRAFATAFLSSEPRLDILIHNAGISSCG--RTREAFNLLLRVNHIGPFLLTHLLLPC 106

Query: 652 XKSSAPSRIVVVSSKLYKYGDINFEDLNSEQS--YNKSFCYSRSKLANILFTRELARPLR 825
            K+ APSR+VVV+S  +  G ++F+ L+        +   Y+ +KLAN+LF RELA  L 
Sbjct: 107 LKACAPSRVVVVASAAHCRGRLDFKRLDRPVVGWRQELRAYADTKLANVLFARELANQLE 166

Query: 826 RHKCHCQRIAP 858
                C    P
Sbjct: 167 ATGVTCYAAHP 177


>ref|XP_371503.3| PREDICTED: similar to short-chain dehydrogenase/reductase 1 [Homo
           sapiens]
          Length = 891

 Score = 78.6 bits (192), Expect = 7e-15
 Identities = 39/120 (32%), Positives = 70/120 (58%), Gaps = 1/120 (0%)
 Frame = +1

Query: 244 GKTVLITGANSGLGRATAAELLRLGARVIMGCRDRARAEEAAGQLRRELRQTEGPEEGPN 423
           GK  ++TGANSG+G+  + +L R GA+VI+ C+ R   ++A  +++              
Sbjct: 602 GKIAIVTGANSGIGKVVSQDLARCGAQVILTCQSRECGQQALAEIQA------------- 648

Query: 424 SGGAGELVVRELDLASLRSVRAFCQEMLQEEPRLDVLINNAGIF-QCPYMKTEDGFEMQF 600
           +  +  L++ E+DL+S+ S+R+F + +LQE P + +L+NNAG+    P   T  G ++ F
Sbjct: 649 ASNSNRLLLGEVDLSSMTSIRSFARRLLQENPEIHLLVNNAGVSGMIPKTLTPGGLDLTF 708


>ref|XP_947127.1| PREDICTED: similar to short-chain dehydrogenase/reductase 1 [Homo
           sapiens]
          Length = 916

 Score = 78.6 bits (192), Expect = 7e-15
 Identities = 39/120 (32%), Positives = 70/120 (58%), Gaps = 1/120 (0%)
 Frame = +1

Query: 244 GKTVLITGANSGLGRATAAELLRLGARVIMGCRDRARAEEAAGQLRRELRQTEGPEEGPN 423
           GK  ++TGANSG+G+  + +L R GA+VI+ C+ R   ++A  +++              
Sbjct: 627 GKIAIVTGANSGIGKVVSQDLARCGAQVILTCQSRECGQQALAEIQA------------- 673

Query: 424 SGGAGELVVRELDLASLRSVRAFCQEMLQEEPRLDVLINNAGIF-QCPYMKTEDGFEMQF 600
           +  +  L++ E+DL+S+ S+R+F + +LQE P + +L+NNAG+    P   T  G ++ F
Sbjct: 674 ASNSNRLLLGEVDLSSMTSIRSFARRLLQENPEIHLLVNNAGVSGMIPKTLTPGGLDLTF 733


>ref|NP_055049.1| estradiol 17 beta-dehydrogenase 8 [Homo sapiens]
          Length = 261

 Score = 53.5 bits (127), Expect = 3e-07
 Identities = 55/205 (26%), Positives = 85/205 (41%), Gaps = 4/205 (1%)
 Frame = +1

Query: 256 LITGANSGLGRATAAELLRLGARVIMGCRDRARAEEAAGQLRRELRQTEGPEEGPNSGGA 435
           L+TGA SG+GRA +  L   GA V     DRA A+E        L    G +EGP  G  
Sbjct: 15  LVTGAGSGIGRAVSVRLAGEGATVAACDLDRAAAQETV-----RLLGGPGSKEGPPRGNH 69

Query: 436 GELVVRELDLASLRSVRAFCQEMLQEEPR-LDVLINNAGIFQCPYM--KTEDGFEMQFAV 606
                 + D++  R+ R   +++     R   V+++ AGI Q  ++   +ED ++   AV
Sbjct: 70  AAF---QADVSEARAARCLLEQVQACFSRPPSVVVSCAGITQDEFLLHMSEDDWDKVIAV 126

Query: 607 XXXXXXXXXXXXXXXXKSS-APSRIVVVSSKLYKYGDINFEDLNSEQSYNKSFCYSRSKL 783
                            S+     I+ +SS + K G++   +            Y+ SK 
Sbjct: 127 NLKGTFLVTQAAAQALVSNGCRGSIINISSIVGKVGNVGQTN------------YAASKA 174

Query: 784 ANILFTRELARPLRRHKCHCQRIAP 858
             I  T+  AR L RH   C  + P
Sbjct: 175 GVIGLTQTAARELGRHGIRCNSVLP 199


  Database: RefSeqHP
    Posted date:  Aug 2, 2006 12:57 AM
  Number of letters in database: 17,774,539
  Number of sequences in database:  39,411
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 33,126,324
Number of Sequences: 39411
Number of extensions: 830317
Number of successful extensions: 3720
Number of sequences better than 1.0e-05: 10
Number of HSP's better than  0.0 without gapping: 3126
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3669
length of database: 17,774,539
effective HSP length: 102
effective length of database: 13,754,617
effective search space used: 2957242655
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqCP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611C-001748
         (955 letters)

Database: RefSeqCP 
           33,732 sequences; 19,266,565 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|XP_540096.2| PREDICTED: similar to retinol dehydrogenase 14 ...   349   e-115
Alignment   gi|XP_857582.1| PREDICTED: similar to retinol dehydrogenase 14 ...   273   4e-92
Alignment   gi|XP_857503.1| PREDICTED: similar to retinol dehydrogenase 14 ...   187   1e-47
Alignment   gi|XP_547866.2| PREDICTED: similar to retinol dehydrogenase 12 ...   162   1e-43
Alignment   gi|XP_854127.1| PREDICTED: similar to Retinol dehydrogenase 13 ...   148   2e-42
Alignment   gi|XP_854354.1| PREDICTED: similar to Retinol dehydrogenase 11 ...   158   8e-39
Alignment   gi|XP_548293.2| PREDICTED: similar to retinol dehydrogenase 11 ...   134   2e-31
Alignment   gi|XP_852623.1| PREDICTED: similar to WW domain-containing oxid...   110   2e-24
Alignment   gi|XP_533000.2| PREDICTED: similar to Retinol dehydrogenase 12 ...    99   3e-24
Alignment   gi|XP_852222.1| PREDICTED: similar to dehydrogenase/reductase (...    97   3e-24

>ref|XP_540096.2| PREDICTED: similar to retinol dehydrogenase 14 (all-trans and
           9-cis) isoform 1 [Canis familiaris]
          Length = 336

 Score =  349 bits (896), Expect(2) = e-115
 Identities = 182/214 (85%), Positives = 186/214 (86%)
 Frame = +1

Query: 181 RRFVGPSVQRLHRGGDSGLMHGKTVLITGANSGLGRATAAELLRLGARVIMGCRDRARAE 360
           RRFVGP VQ+LH GGDSGLMHGKTVLITGANSGLGRATAA LLRLGARVIMGCRDRARAE
Sbjct: 22  RRFVGPGVQQLHGGGDSGLMHGKTVLITGANSGLGRATAAALLRLGARVIMGCRDRARAE 81

Query: 361 EAAGQLRRELRQTEGPEEGPNSGGAGELVVRELDLASLRSVRAFCQEMLQEEPRLDVLIN 540
           EAAGQLRRELRQ  G E G + G AGELVVRELDLASLRSVRAFCQE+LQEEPRLDVLIN
Sbjct: 82  EAAGQLRRELRQAGGREPGSDVGAAGELVVRELDLASLRSVRAFCQEVLQEEPRLDVLIN 141

Query: 541 NAGIFQCPYMKTEDGFEMQFAVXXXXXXXXXXXXXXXXKSSAPSRIVVVSSKLYKYGDIN 720
           NAGIFQCPYMKTEDGFEMQF V                K+SAPSRIVVVSSKLYKYGDIN
Sbjct: 142 NAGIFQCPYMKTEDGFEMQFGVNHLGHFLLTNLLLGLLKNSAPSRIVVVSSKLYKYGDIN 201

Query: 721 FEDLNSEQSYNKSFCYSRSKLANILFTRELARPL 822
           FEDLNSEQSYNKSFCYSRSKLANILFTRELAR L
Sbjct: 202 FEDLNSEQSYNKSFCYSRSKLANILFTRELARRL 235



 Score = 84.0 bits (206), Expect(2) = e-115
 Identities = 40/43 (93%), Positives = 40/43 (93%)
 Frame = +2

Query: 818 RLEGTNVTVNVLHPGIVRTNLGRHIHIPLLVRPLFNLVVMGFF 946
           RLEGTNVTVNVLHPGIVRTNLGRHIHIPLLVRPLFNLV   FF
Sbjct: 234 RLEGTNVTVNVLHPGIVRTNLGRHIHIPLLVRPLFNLVSWAFF 276


>ref|XP_857582.1| PREDICTED: similar to retinol dehydrogenase 14 (all-trans and
           9-cis) isoform 4 [Canis familiaris]
          Length = 307

 Score =  273 bits (699), Expect(2) = 4e-92
 Identities = 153/214 (71%), Positives = 157/214 (73%)
 Frame = +1

Query: 181 RRFVGPSVQRLHRGGDSGLMHGKTVLITGANSGLGRATAAELLRLGARVIMGCRDRARAE 360
           RRFVGP VQ+LH GGDSGLMHGKTVLITGANSGLGRATAA LLRLGARVIMGCRDRARAE
Sbjct: 22  RRFVGPGVQQLHGGGDSGLMHGKTVLITGANSGLGRATAAALLRLGARVIMGCRDRARAE 81

Query: 361 EAAGQLRRELRQTEGPEEGPNSGGAGELVVRELDLASLRSVRAFCQEMLQEEPRLDVLIN 540
           EAAGQLRRELRQ  G E G + G AGELVVRELDLASLRSVRAFCQE+L           
Sbjct: 82  EAAGQLRRELRQAGGREPGSDVGAAGELVVRELDLASLRSVRAFCQEVL----------- 130

Query: 541 NAGIFQCPYMKTEDGFEMQFAVXXXXXXXXXXXXXXXXKSSAPSRIVVVSSKLYKYGDIN 720
                             QF V                K+SAPSRIVVVSSKLYKYGDIN
Sbjct: 131 ------------------QFGVNHLGHFLLTNLLLGLLKNSAPSRIVVVSSKLYKYGDIN 172

Query: 721 FEDLNSEQSYNKSFCYSRSKLANILFTRELARPL 822
           FEDLNSEQSYNKSFCYSRSKLANILFTRELAR L
Sbjct: 173 FEDLNSEQSYNKSFCYSRSKLANILFTRELARRL 206



 Score = 84.0 bits (206), Expect(2) = 4e-92
 Identities = 40/43 (93%), Positives = 40/43 (93%)
 Frame = +2

Query: 818 RLEGTNVTVNVLHPGIVRTNLGRHIHIPLLVRPLFNLVVMGFF 946
           RLEGTNVTVNVLHPGIVRTNLGRHIHIPLLVRPLFNLV   FF
Sbjct: 205 RLEGTNVTVNVLHPGIVRTNLGRHIHIPLLVRPLFNLVSWAFF 247


>ref|XP_857503.1| PREDICTED: similar to retinol dehydrogenase 14 (all-trans and
           9-cis) isoform 3 [Canis familiaris]
          Length = 153

 Score =  187 bits (475), Expect = 1e-47
 Identities = 97/110 (88%), Positives = 100/110 (90%)
 Frame = +1

Query: 181 RRFVGPSVQRLHRGGDSGLMHGKTVLITGANSGLGRATAAELLRLGARVIMGCRDRARAE 360
           RRFVGP VQ+LH GGDSGLMHGKTVLITGANSGLGRATAA LLRLGARVIMGCRDRARAE
Sbjct: 22  RRFVGPGVQQLHGGGDSGLMHGKTVLITGANSGLGRATAAALLRLGARVIMGCRDRARAE 81

Query: 361 EAAGQLRRELRQTEGPEEGPNSGGAGELVVRELDLASLRSVRAFCQEMLQ 510
           EAAGQLRRELRQ  G E G + G AGELVVRELDLASLRSVRAFCQE+LQ
Sbjct: 82  EAAGQLRRELRQAGGREPGSDVGAAGELVVRELDLASLRSVRAFCQEVLQ 131


>ref|XP_547866.2| PREDICTED: similar to retinol dehydrogenase 12 (all-trans and
           9-cis) [Canis familiaris]
          Length = 303

 Score =  162 bits (409), Expect(2) = 1e-43
 Identities = 88/216 (40%), Positives = 126/216 (58%), Gaps = 3/216 (1%)
 Frame = +1

Query: 187 FVGPSVQRLHRGG---DSGLMHGKTVLITGANSGLGRATAAELLRLGARVIMGCRDRARA 357
           FV  + ++   GG    +  + GK V+ITGAN+G+G+ TA EL R GARV + CRD  + 
Sbjct: 4   FVSLAYRKFFAGGVCRSNVQLPGKVVVITGANTGIGKETARELARRGARVYIACRDVLKG 63

Query: 358 EEAAGQLRRELRQTEGPEEGPNSGGAGELVVRELDLASLRSVRAFCQEMLQEEPRLDVLI 537
           E AA ++R + + ++             ++VR+LDL+  +S+RAF +  L EE +L +LI
Sbjct: 64  ESAASEIRADTKNSQ-------------VLVRKLDLSDTKSIRAFAEGFLAEEKQLHILI 110

Query: 538 NNAGIFQCPYMKTEDGFEMQFAVXXXXXXXXXXXXXXXXKSSAPSRIVVVSSKLYKYGDI 717
           NNAG+  CPY KT DGFE    V                K S P+R+V +SS  +  G I
Sbjct: 111 NNAGVMMCPYSKTADGFETHLGVNHLGHFLLTHLLLERLKESTPARVVNLSSVAHHIGKI 170

Query: 718 NFEDLNSEQSYNKSFCYSRSKLANILFTRELARPLR 825
           +F DL  E+ Y++ F Y  SKLAN+LFTRELA+ L+
Sbjct: 171 HFHDLQGEKRYSRGFAYCHSKLANMLFTRELAKRLQ 206



 Score = 33.9 bits (76), Expect(2) = 1e-43
 Identities = 15/36 (41%), Positives = 23/36 (63%)
 Frame = +2

Query: 818 RLEGTNVTVNVLHPGIVRTNLGRHIHIPLLVRPLFN 925
           RL+GT VT   +HPG+V + L RH  +  L+  +F+
Sbjct: 204 RLQGTGVTTYAVHPGVVSSELVRHSFLLCLLWRIFS 239


>ref|XP_854127.1| PREDICTED: similar to Retinol dehydrogenase 13 [Canis familiaris]
          Length = 334

 Score =  148 bits (373), Expect(2) = 2e-42
 Identities = 81/195 (41%), Positives = 118/195 (60%), Gaps = 1/195 (0%)
 Frame = +1

Query: 244 GKTVLITGANSGLGRATAAELLRLGARVIMGCRDRARAEEAAGQLRRELRQTEGPEEGPN 423
           GKTV++TGAN+G+G+ TA EL R G  +I+ CRD  + E AA ++R E            
Sbjct: 38  GKTVIVTGANTGIGKQTALELARRGGNIILACRDMEKCEAAAKEIRGETLNHR------- 90

Query: 424 SGGAGELVVRELDLASLRSVRAFCQEMLQEEPRLDVLINNAGIFQCPYMKTEDGFEMQFA 603
                 +    LDLASL+S+R F  ++++EE ++ +L+NNA + +CP+  T+DGFEMQF 
Sbjct: 91  ------VSAWHLDLASLKSIREFAAKIIEEEEQVHILVNNAAVMRCPHWTTKDGFEMQFG 144

Query: 604 VXXXXXXXXXXXXXXXXKSSAPSRIVVVSSKLYKYGDINFEDLNSE-QSYNKSFCYSRSK 780
           V                K+SAPSRI+ +SS  +  G I+F+DLN E + Y+    Y +SK
Sbjct: 145 VNHLGHFLLTNLLLDKLKASAPSRIINLSSLAHVAGHIDFDDLNWEKRKYDTKAAYCQSK 204

Query: 781 LANILFTRELARPLR 825
           LA ILFT+EL+R L+
Sbjct: 205 LAVILFTKELSRRLQ 219



 Score = 43.9 bits (102), Expect(2) = 2e-42
 Identities = 18/24 (75%), Positives = 20/24 (83%)
 Frame = +2

Query: 818 RLEGTNVTVNVLHPGIVRTNLGRH 889
           RL+GT VTVN LHPG+ RT LGRH
Sbjct: 217 RLQGTGVTVNALHPGVARTELGRH 240


>ref|XP_854354.1| PREDICTED: similar to Retinol dehydrogenase 11 (Retinal reductase
           1) (RalR1) (Prostate short-chain dehydrogenase/reductase
           1) (Androgen-regulated short-chain
           dehydrogenase/reductase 1) (HCV core-binding protein
           HCBP12) [Canis familiaris]
          Length = 337

 Score =  158 bits (399), Expect = 8e-39
 Identities = 89/194 (45%), Positives = 114/194 (58%)
 Frame = +1

Query: 244 GKTVLITGANSGLGRATAAELLRLGARVIMGCRDRARAEEAAGQLRRELRQTEGPEEGPN 423
           GK  ++TGAN+G+G+ TA EL + GARV + CRD  + E  A    RE++   G ++   
Sbjct: 60  GKVAVVTGANTGIGKETAKELAQRGARVYLACRDVLKGELVA----REIQTMTGNKQ--- 112

Query: 424 SGGAGELVVRELDLASLRSVRAFCQEMLQEEPRLDVLINNAGIFQCPYMKTEDGFEMQFA 603
                 ++VR+LDLA  +S+RAF +  L EE  L +LINNAG+  CPY KT DGFEM   
Sbjct: 113 ------VLVRKLDLADTKSIRAFAKGFLAEEKHLHILINNAGVMMCPYTKTVDGFEMHMG 166

Query: 604 VXXXXXXXXXXXXXXXXKSSAPSRIVVVSSKLYKYGDINFEDLNSEQSYNKSFCYSRSKL 783
           V                K SAPSRIV VSS  +  G I+F DL  E+ YN    Y  SKL
Sbjct: 167 VNHLGHFLLTHLLLEKLKESAPSRIVNVSSLAHHLGRIHFHDLQGEKFYNSGLAYCHSKL 226

Query: 784 ANILFTRELARPLR 825
           ANILFT+ELAR L+
Sbjct: 227 ANILFTQELARRLK 240


>ref|XP_548293.2| PREDICTED: similar to retinol dehydrogenase 11 (predicted) [Canis
           familiaris]
          Length = 377

 Score =  134 bits (336), Expect = 2e-31
 Identities = 86/214 (40%), Positives = 111/214 (51%), Gaps = 2/214 (0%)
 Frame = +1

Query: 223 GDSGLMHGKTVLITGANSGLGRATAAELLRLGARVIMGCRDRARAEEAAGQLRRELRQTE 402
           G    + G+T ++TGANSG+G+ TA EL R GARV++ CR R R E AA  LR+E     
Sbjct: 29  GGIASLRGRTAVVTGANSGIGKMTALELARRGARVVLACRSRERGEAAAFDLRQE----- 83

Query: 403 GPEEGPNSGGAGELVVRELDLASLRSVRAFCQEMLQEEPRLDVLINNAGIFQCPYMKTED 582
                    G  E++   LDLASL SVRAF    L  EPRLD+LI+NAGI  C   +T  
Sbjct: 84  --------SGNNEVIFMALDLASLASVRAFATAFLSSEPRLDILIHNAGISSCG--RTHK 133

Query: 583 GFEMQFAVXXXXXXXXXXXXXXXXKSSAPSRIVVVSSKLYKYGDINFEDLNSEQS--YNK 756
            F +   V                K+ APSR+VVVSS  ++ G ++F  L+        +
Sbjct: 134 PFNLLLRVNHIGPFLLTHLLLPRLKTCAPSRVVVVSSAAHRRGRLDFTRLDRPVVGWQQE 193

Query: 757 SFCYSRSKLANILFTRELARPLRRHKCHCQRIAP 858
              Y+ SKLAN+LF RELA  L      C    P
Sbjct: 194 LRAYADSKLANVLFARELATQLEGTGVTCYAAHP 227


>ref|XP_852623.1| PREDICTED: similar to WW domain-containing oxidoreductase isoform 1
           [Canis familiaris]
          Length = 383

 Score =  110 bits (276), Expect = 2e-24
 Identities = 76/201 (37%), Positives = 100/201 (49%), Gaps = 8/201 (3%)
 Frame = +1

Query: 244 GKTVLITGANSGLGRATAAELLRLGARVIMGCRDRARAEEAAGQLRRELRQTEGPEEGPN 423
           GK V++TGANSG+G  TA      GA VI+ CR+  RA EA  Q+  E  +         
Sbjct: 124 GKVVVVTGANSGIGFETAKSFALHGAHVILACRNMTRANEAVSQILGEWHK--------- 174

Query: 424 SGGAGELVVRELDLASLRSVRAFCQEMLQEEPRLDVLINNAGIFQCPYMKTEDGFEMQFA 603
                ++    LDLA LRSV+ F Q    +   L VL+ NA  F  P+  T+DG E  F 
Sbjct: 175 ----AKVEAMTLDLALLRSVQHFAQAFKAKNVSLHVLVCNAAAFALPWSLTKDGLETTFQ 230

Query: 604 VXXXXXXXXXXXXXXXXKSSAPSRIVVVSSKLYKYGDIN-------FEDLN-SEQSYNKS 759
           V                  SAP+R+VVVSS+ +++ DIN       F  L+ S+  Y   
Sbjct: 231 VNHLGHFYLVQLLQDVLCRSAPARVVVVSSESHRFTDINDSSGKLDFSRLSPSKSDYWAM 290

Query: 760 FCYSRSKLANILFTRELARPL 822
             Y+RSKL NILF+ EL R L
Sbjct: 291 LAYNRSKLCNILFSNELHRRL 311


>ref|XP_533000.2| PREDICTED: similar to Retinol dehydrogenase 12 [Canis familiaris]
          Length = 596

 Score = 99.4 bits (246), Expect(2) = 3e-24
 Identities = 64/195 (32%), Positives = 104/195 (53%), Gaps = 1/195 (0%)
 Frame = +1

Query: 244 GKTVLITGANSGLGRATAAELLRLGARVIMGCRDRARAEEAAGQLRRELRQTEGPEEGPN 423
           GKT ++TGANSG+G+A   EL R GARVI+ CR+  R ++A  +++   + T        
Sbjct: 315 GKTAVVTGANSGIGKAVCQELARRGARVILACRNWERGQKALAEIQVASKGT-------- 366

Query: 424 SGGAGELVVRELDLASLRSVRAFCQEMLQEEPRLDVLINNAGIFQCPYMKTEDGFEMQFA 603
                 L++ ++DL+S+ S+R+F + +LQE P + +L+NNA I   P   T +G ++ FA
Sbjct: 367 -----CLLLGQVDLSSMASIRSFARWLLQEYPEIHLLVNNAAISGFPKTLTPEGLDLTFA 421

Query: 604 VXXXXXXXXXXXXXXXXKSSAPSRIVVVSSKLYKYGDINFEDL-NSEQSYNKSFCYSRSK 780
                            + +  +R+V VSS  + +G ++ + L  + +  N    Y  SK
Sbjct: 422 TNYVGPFLLTNLLQGALQRAGSARVVNVSSFRHAHGYVDEKHLTGAGKPLNLIQSYDCSK 481

Query: 781 LANILFTRELARPLR 825
           L    FT ELAR L+
Sbjct: 482 LLLTSFTGELARRLQ 496



 Score = 31.2 bits (69), Expect(2) = 3e-24
 Identities = 21/45 (46%), Positives = 26/45 (57%)
 Frame = +2

Query: 818 RLEGTNVTVNVLHPGIVRTNLGRHIHIPLLVRPLFNLVVMGFFSK 952
           RL+GT VTVN + PG+V T + +    P L R LF L    FF K
Sbjct: 494 RLQGTGVTVNSVDPGVVYTEIMK--PYPWLYRFLFWL--FSFFCK 534


>ref|XP_852222.1| PREDICTED: similar to dehydrogenase/reductase (SDR family) X-linked
           [Canis familiaris]
          Length = 387

 Score = 97.4 bits (241), Expect(2) = 3e-24
 Identities = 63/196 (32%), Positives = 97/196 (49%), Gaps = 4/196 (2%)
 Frame = +1

Query: 247 KTVLITGANSGLGRATAAELLRLGARVIMGCRDRARAEEAAGQLRRELRQTEGPEEGPNS 426
           +  ++TG   G+G +TA  L RLG  VI+   + + A +   +++ E    +        
Sbjct: 96  RVAIVTGGTDGIGYSTAKHLARLGMHVILAGNNDSSAPDVVRKIQEETLNDK-------- 147

Query: 427 GGAGELVVRELDLASLRSVRAFCQEMLQEEPRLDVLINNAGIFQCPYMKTEDGFEMQFAV 606
                +     DLASLRS+R F Q+  +++  L VL+NNAG+   P   TEDGFE  F +
Sbjct: 148 -----VEFLYCDLASLRSIRQFVQKFKKKKIPLHVLVNNAGVMMVPERTTEDGFEEHFGL 202

Query: 607 XXXXXXXXXXXXXXXXK-SSAP---SRIVVVSSKLYKYGDINFEDLNSEQSYNKSFCYSR 774
                           K S AP   +R+V VSS  +  G+++ +DL   + Y+    Y++
Sbjct: 203 NYLGHFLLTNLLLDTLKESGAPGRCARVVTVSSATHYIGELDMDDLQGSRCYSPHAAYAQ 262

Query: 775 SKLANILFTRELARPL 822
           SKLA +LFT  L R L
Sbjct: 263 SKLALVLFTYHLQRLL 278



 Score = 33.1 bits (74), Expect(2) = 3e-24
 Identities = 13/23 (56%), Positives = 18/23 (78%)
 Frame = +2

Query: 824 EGTNVTVNVLHPGIVRTNLGRHI 892
           +G+ VT NV+ PG+V TNL RH+
Sbjct: 281 QGSPVTANVVDPGVVNTNLYRHV 303


  Database: RefSeqCP
    Posted date:  Aug 1, 2006  9:25 PM
  Number of letters in database: 19,266,565
  Number of sequences in database:  33,732
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 34,073,489
Number of Sequences: 33732
Number of extensions: 819648
Number of successful extensions: 3649
Number of sequences better than 1.0e-05: 10
Number of HSP's better than  0.0 without gapping: 3085
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3596
length of database: 19,266,565
effective HSP length: 103
effective length of database: 15,792,169
effective search space used: 3379524166
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqMP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611C-001748
         (955 letters)

Database: RefSeqMP 
           45,328 sequences; 21,768,885 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_076186.1| alcohol dehydrogenase PAN2 [Mus musculus]            319   e-105
Alignment   gi|NP_084293.1| retinol dehydrogenase 12 [Mus musculus]              165   3e-44
Alignment   gi|NP_780581.1| retinol dehydrogenase 13 (all-trans and 9-cis) ...   152   3e-43
Alignment   gi|NP_067532.2| short-chain dehydrogenase/reductase 1 [Mus musc...   152   5e-37
Alignment   gi|NP_899109.1| hypothetical protein LOC70451 [Mus musculus]         137   2e-32
Alignment   gi|NP_062519.2| WW-domain oxidoreductase [Mus musculus]              107   2e-23
Alignment   gi|NP_001028498.1| dehydrogenase/reductase (SDR family) X chrom...   100   2e-22
Alignment   gi|NP_032318.2| hydroxysteroid (17-beta) dehydrogenase 4 [Mus m...    53   5e-07
Alignment   gi|NP_598593.1| retinol dehydrogenase 10 [Mus musculus]               50   3e-06
Alignment   gi|NP_663403.1| hypothetical protein LOC216820 [Mus musculus]         50   3e-06

>ref|NP_076186.1| alcohol dehydrogenase PAN2 [Mus musculus]
          Length = 334

 Score =  319 bits (817), Expect(2) = e-105
 Identities = 171/214 (79%), Positives = 178/214 (83%)
 Frame = +1

Query: 181 RRFVGPSVQRLHRGGDSGLMHGKTVLITGANSGLGRATAAELLRLGARVIMGCRDRARAE 360
           RRF GP  QR   GGD GLMHGKTVLITGANSGLGRATAAELLRLGARVIMGCRDRARAE
Sbjct: 23  RRFSGPRNQRQQGGGDPGLMHGKTVLITGANSGLGRATAAELLRLGARVIMGCRDRARAE 82

Query: 361 EAAGQLRRELRQTEGPEEGPNSGGAGELVVRELDLASLRSVRAFCQEMLQEEPRLDVLIN 540
           EAAGQLR+EL Q  G   GP+ G  G+LVV+ELDLASLRSVRAFCQE+LQEEPRLDVLIN
Sbjct: 83  EAAGQLRQELCQAGGA--GPD-GTDGQLVVKELDLASLRSVRAFCQELLQEEPRLDVLIN 139

Query: 541 NAGIFQCPYMKTEDGFEMQFAVXXXXXXXXXXXXXXXXKSSAPSRIVVVSSKLYKYGDIN 720
           NAG+F CPY KTEDGFEMQF V                KSSAPSRIVVVSSKLYKYG+IN
Sbjct: 140 NAGVFHCPYTKTEDGFEMQFGVNHLGHFLLTNLLLGLLKSSAPSRIVVVSSKLYKYGEIN 199

Query: 721 FEDLNSEQSYNKSFCYSRSKLANILFTRELARPL 822
           FEDLNSEQSYNKSFCYSRSKLANILFTRELAR L
Sbjct: 200 FEDLNSEQSYNKSFCYSRSKLANILFTRELARRL 233



 Score = 82.4 bits (202), Expect(2) = e-105
 Identities = 39/43 (90%), Positives = 39/43 (90%)
 Frame = +2

Query: 818 RLEGTNVTVNVLHPGIVRTNLGRHIHIPLLVRPLFNLVVMGFF 946
           RLEGTNVTVNVLHPGIVRTNLGRHIHIPLL RPLFNLV   FF
Sbjct: 232 RLEGTNVTVNVLHPGIVRTNLGRHIHIPLLARPLFNLVSWAFF 274


>ref|NP_084293.1| retinol dehydrogenase 12 [Mus musculus]
          Length = 316

 Score =  165 bits (418), Expect(2) = 3e-44
 Identities = 89/213 (41%), Positives = 126/213 (59%), Gaps = 3/213 (1%)
 Frame = +1

Query: 196 PSVQRLHRGG---DSGLMHGKTVLITGANSGLGRATAAELLRLGARVIMGCRDRARAEEA 366
           PS+++   GG    +  + GK V+ITGAN+G+G+ TA EL R GARV + CRD  + E A
Sbjct: 20  PSIRKFFAGGVCTTNVQIPGKVVVITGANTGIGKETARELARRGARVYIACRDVLKGESA 79

Query: 367 AGQLRRELRQTEGPEEGPNSGGAGELVVRELDLASLRSVRAFCQEMLQEEPRLDVLINNA 546
           A ++R + + ++             ++VR+LDL+  +S+RAF +  L EE +L +LINNA
Sbjct: 80  ASEIRADTKNSQ-------------VLVRKLDLSDTKSIRAFAERFLAEEKKLHILINNA 126

Query: 547 GIFQCPYMKTEDGFEMQFAVXXXXXXXXXXXXXXXXKSSAPSRIVVVSSKLYKYGDINFE 726
           G+  CPY KT DGFE  F V                K SAP+R+V +SS  +  G I F 
Sbjct: 127 GVMMCPYSKTTDGFETHFGVNHLGHFLLTYLLLERLKESAPARVVNLSSIAHLIGKIRFH 186

Query: 727 DLNSEQSYNKSFCYSRSKLANILFTRELARPLR 825
           DL  ++ Y  +F Y  SKLAN+LFTRELA+ L+
Sbjct: 187 DLQGQKRYCSAFAYGHSKLANLLFTRELAKRLQ 219



 Score = 32.3 bits (72), Expect(2) = 3e-44
 Identities = 14/36 (38%), Positives = 24/36 (66%)
 Frame = +2

Query: 818 RLEGTNVTVNVLHPGIVRTNLGRHIHIPLLVRPLFN 925
           RL+GT VT   +HPG+V + + R+ ++  L+  LF+
Sbjct: 217 RLQGTGVTAYAVHPGVVLSEITRNSYLLCLLWRLFS 252


>ref|NP_780581.1| retinol dehydrogenase 13 (all-trans and 9-cis) [Mus musculus]
          Length = 334

 Score =  152 bits (383), Expect(2) = 3e-43
 Identities = 84/195 (43%), Positives = 120/195 (61%), Gaps = 1/195 (0%)
 Frame = +1

Query: 244 GKTVLITGANSGLGRATAAELLRLGARVIMGCRDRARAEEAAGQLRRELRQTEGPEEGPN 423
           GKTV++TGAN+G+G+ TA EL + G  VI+ CRD  + E AA  +R E   T  P     
Sbjct: 38  GKTVIVTGANTGIGKQTALELAKRGGNVILACRDMEKCEVAAKDIRGE---TLNPR---- 90

Query: 424 SGGAGELVVRELDLASLRSVRAFCQEMLQEEPRLDVLINNAGIFQCPYMKTEDGFEMQFA 603
                 +    LDLASL+S+R F +++++EE R+D+L+NNA + +CP+  TEDGFEMQF 
Sbjct: 91  ------VRAERLDLASLKSIREFARKVIKEEERVDILVNNAAVMRCPHWTTEDGFEMQFG 144

Query: 604 VXXXXXXXXXXXXXXXXKSSAPSRIVVVSSKLYKYGDINFEDLNSE-QSYNKSFCYSRSK 780
           V                K+SAPSRI+ +SS  +  G I+FEDLN + + Y+    Y +SK
Sbjct: 145 VNYLGHFLLTNLLLDKLKASAPSRIINLSSLAHVAGHIDFEDLNWQMKKYDTKAAYCQSK 204

Query: 781 LANILFTRELARPLR 825
           LA +LFT+EL+  L+
Sbjct: 205 LAVVLFTKELSHRLQ 219



 Score = 42.4 bits (98), Expect(2) = 3e-43
 Identities = 17/24 (70%), Positives = 20/24 (83%)
 Frame = +2

Query: 818 RLEGTNVTVNVLHPGIVRTNLGRH 889
           RL+G+ VTVN LHPG+ RT LGRH
Sbjct: 217 RLQGSGVTVNALHPGVARTELGRH 240


>ref|NP_067532.2| short-chain dehydrogenase/reductase 1 [Mus musculus]
          Length = 316

 Score =  152 bits (384), Expect = 5e-37
 Identities = 90/215 (41%), Positives = 125/215 (58%), Gaps = 3/215 (1%)
 Frame = +1

Query: 190 VGPSVQRLHRGG---DSGLMHGKTVLITGANSGLGRATAAELLRLGARVIMGCRDRARAE 360
           V P ++++   G    +  + GK  ++TGAN+G+G+ TA +L + GARV + CRD  + E
Sbjct: 17  VTPKIRKMLSSGVCTSNVQLPGKVAIVTGANTGIGKETAKDLAQRGARVYLACRDVDKGE 76

Query: 361 EAAGQLRRELRQTEGPEEGPNSGGAGELVVRELDLASLRSVRAFCQEMLQEEPRLDVLIN 540
            AA    RE++   G     NS    ++ VR+LDLA  +S+RAF ++ L EE  L +LIN
Sbjct: 77  LAA----REIQAVTG-----NS----QVFVRKLDLADTKSIRAFAKDFLAEEKHLHLLIN 123

Query: 541 NAGIFQCPYMKTEDGFEMQFAVXXXXXXXXXXXXXXXXKSSAPSRIVVVSSKLYKYGDIN 720
           NAG+  CPY KT DGFEM   V                K SAPSRIV +SS  +  G I+
Sbjct: 124 NAGVMMCPYSKTADGFEMHIGVNHLGHFLLTHLLLEKLKESAPSRIVNLSSLGHHLGRIH 183

Query: 721 FEDLNSEQSYNKSFCYSRSKLANILFTRELARPLR 825
           F +L  E+ Y+    Y  SKLANILFT+ELA+ L+
Sbjct: 184 FHNLQGEKFYSAGLAYCHSKLANILFTKELAKRLK 218


>ref|NP_899109.1| hypothetical protein LOC70451 [Mus musculus]
          Length = 260

 Score =  137 bits (345), Expect = 2e-32
 Identities = 87/214 (40%), Positives = 114/214 (53%), Gaps = 2/214 (0%)
 Frame = +1

Query: 223 GDSGLMHGKTVLITGANSGLGRATAAELLRLGARVIMGCRDRARAEEAAGQLRRELRQTE 402
           G  G + G+TV++TGANSG+G+ TA EL R GARV++ CR R R E AA  LR+E     
Sbjct: 29  GGIGSLRGRTVVVTGANSGIGKMTALELARRGARVVLACRSRERGEAAAFDLRQE----- 83

Query: 403 GPEEGPNSGGAGELVVRELDLASLRSVRAFCQEMLQEEPRLDVLINNAGIFQCPYMKTED 582
                    G  E++   LDLASL SV+AF    L  EPRLDVLI+NAGI  C   +T +
Sbjct: 84  --------SGNNEVIFMALDLASLASVQAFATAFLSSEPRLDVLIHNAGISSCG--RTRE 133

Query: 583 GFEMQFAVXXXXXXXXXXXXXXXXKSSAPSRIVVVSSKLYKYGDINFEDLNSEQS--YNK 756
            F +   V                +S APSR+V+VSS  ++ G ++F  L+        +
Sbjct: 134 TFNLLLRVNHVGPFLLTHLLLPRLRSCAPSRVVIVSSAAHRRGRLDFTRLDCPVVGWQQE 193

Query: 757 SFCYSRSKLANILFTRELARPLRRHKCHCQRIAP 858
              Y+ SKLAN+LF RELA  L      C    P
Sbjct: 194 LRAYADSKLANVLFARELATQLEGTGVTCYAAHP 227


>ref|NP_062519.2| WW-domain oxidoreductase [Mus musculus]
          Length = 414

 Score =  107 bits (267), Expect = 2e-23
 Identities = 73/201 (36%), Positives = 100/201 (49%), Gaps = 8/201 (3%)
 Frame = +1

Query: 244 GKTVLITGANSGLGRATAAELLRLGARVIMGCRDRARAEEAAGQLRRELRQTEGPEEGPN 423
           GK VL+TGANSG+G  TA      GA VI+ CR+ +RA EA  ++  E  +         
Sbjct: 124 GKVVLVTGANSGIGFETAKSFALHGAHVILACRNLSRASEAVSRILEEWHK--------- 174

Query: 424 SGGAGELVVRELDLASLRSVRAFCQEMLQEEPRLDVLINNAGIFQCPYMKTEDGFEMQFA 603
                ++    LDLA LRSV+ F +    +   L VL+ NAG F  P+  T+DG E  F 
Sbjct: 175 ----AKVEAMTLDLAVLRSVQHFAEAFKAKNVSLHVLVCNAGTFALPWGLTKDGLETTFQ 230

Query: 604 VXXXXXXXXXXXXXXXXKSSAPSRIVVVSSKLYKYGDINFE----DLN----SEQSYNKS 759
           V                  S+P+R++VVSS+ +++ DIN      DL+        Y   
Sbjct: 231 VNHLGHFYLVQLLQDVLCRSSPARVIVVSSESHRFTDINDSSGKLDLSRLSPPRSDYWAM 290

Query: 760 FCYSRSKLANILFTRELARPL 822
             Y+RSKL NILF+ EL R L
Sbjct: 291 LAYNRSKLCNILFSNELHRRL 311


>ref|NP_001028498.1| dehydrogenase/reductase (SDR family) X chromosome [Mus musculus]
          Length = 335

 Score = 99.8 bits (247), Expect(2) = 2e-22
 Identities = 64/197 (32%), Positives = 95/197 (48%), Gaps = 4/197 (2%)
 Frame = +1

Query: 244 GKTVLITGANSGLGRATAAELLRLGARVIMGCRDRARAEEAAGQLRRELRQTEGPEEGPN 423
           G+  ++TGA +G+GR+TA +L RLG  V++   D  R +E    +R E+           
Sbjct: 43  GRVAIVTGATAGIGRSTARQLARLGMCVVVAGNDEHRGQEVVSSIRAEM----------- 91

Query: 424 SGGAGELVVRELDLASLRSVRAFCQEMLQEEPRLDVLINNAGIFQCPYMKTEDGFEMQFA 603
             G+       LDLASL SVR F ++       L +L+NNAG+   P  +TEDGFE    
Sbjct: 92  --GSDRAHFLPLDLASLASVRGFARDFQALGLPLHLLVNNAGVMLEPRAETEDGFERHLG 149

Query: 604 VXXXXXXXXXXXXXXXXKSSAP----SRIVVVSSKLYKYGDINFEDLNSEQSYNKSFCYS 771
           V                ++S      SR+V V S  +  G ++  DL+   +Y+    Y+
Sbjct: 150 VNFLGHFLLTLLLLPALRASGAEGRGSRVVTVGSATHYVGTVDMADLHGRHAYSPYAAYA 209

Query: 772 RSKLANILFTRELARPL 822
           +SKLA  LF  +L R L
Sbjct: 210 QSKLALALFALQLQRIL 226



 Score = 24.6 bits (52), Expect(2) = 2e-22
 Identities = 11/21 (52%), Positives = 13/21 (61%)
 Frame = +2

Query: 827 GTNVTVNVLHPGIVRTNLGRH 889
           G  VT N+  PG+V T L RH
Sbjct: 230 GDPVTSNMADPGVVDTELYRH 250


>ref|NP_032318.2| hydroxysteroid (17-beta) dehydrogenase 4 [Mus musculus]
          Length = 735

 Score = 52.8 bits (125), Expect = 5e-07
 Identities = 58/213 (27%), Positives = 86/213 (40%), Gaps = 8/213 (3%)
 Frame = +1

Query: 244 GKTVLITGANSGLGRATAAELLRLGARVIMG-----CRDRARAEEAAGQLRRELRQTEGP 408
           G+ VL+TGA  GLGRA A      GA VI+       +   +   AA ++  E+R+  G 
Sbjct: 9   GRVVLVTGAGGGLGRAYALAFAERGALVIVNDLGGDFKGIGKGSSAADKVVAEIRRKGGK 68

Query: 409 E-EGPNSGGAGELVVRELDLASLRSVRAFCQEMLQEEPRLDVLINNAGIFQCPYMK--TE 579
                +S  AGE +V+                 L    R+DV++NNAGI +       ++
Sbjct: 69  AVANYDSVEAGEKLVK---------------TALDTFGRIDVVVNNAGILRDRSFSRISD 113

Query: 580 DGFEMQFAVXXXXXXXXXXXXXXXXKSSAPSRIVVVSSKLYKYGDINFEDLNSEQSYNKS 759
           + +++   V                K     RI++ SS    YG  NF   N        
Sbjct: 114 EDWDIIHRVHLRGSFQVTRAAWDHMKKQNYGRILMTSSASGIYG--NFGQAN-------- 163

Query: 760 FCYSRSKLANILFTRELARPLRRHKCHCQRIAP 858
             YS +KL  +     LA   R++  HC  IAP
Sbjct: 164 --YSAAKLGILGLCNTLAIEGRKNNIHCNTIAP 194


>ref|NP_598593.1| retinol dehydrogenase 10 [Mus musculus]
          Length = 341

 Score = 50.4 bits (119), Expect = 3e-06
 Identities = 36/123 (29%), Positives = 53/123 (43%), Gaps = 16/123 (13%)
 Frame = +1

Query: 244 GKTVLITGANSGLGRATAAELLRLGARVIMGCRDRARAEEAAGQLRRELRQTEGPEEGPN 423
           G+  LITGA SGLGR  A E  R  A +++   +    EE AG +R   R  E  +    
Sbjct: 36  GQVCLITGAGSGLGRLFALEFARRRALLVLWDINTQSNEETAGMVRHIYRDLEAADAAAL 95

Query: 424 SGGAGE----------LVVRELDLASLRSVRAFCQEMLQEEPRLDVLINNAGI------F 555
             G GE          +     D+    +V    + + +E   + VL+NNAG+       
Sbjct: 96  QAGKGEEEILPPCNLQVFTYTCDVGKRENVYLTAERVRKEVGEVSVLVNNAGVVSGHHLL 155

Query: 556 QCP 564
           +CP
Sbjct: 156 ECP 158


>ref|NP_663403.1| hypothetical protein LOC216820 [Mus musculus]
          Length = 323

 Score = 50.1 bits (118), Expect = 3e-06
 Identities = 40/114 (35%), Positives = 55/114 (48%)
 Frame = +1

Query: 211 LHRGGDSGLMHGKTVLITGANSGLGRATAAELLRLGARVIMGCRDRARAEEAAGQLRREL 390
           L R      +    V++TGA SGLGR  A      GA++++ C    +A E   +L REL
Sbjct: 41  LQRIRSKAYLRNAVVVVTGATSGLGRECAKVFHAAGAKLVL-CGRNVKALE---ELSREL 96

Query: 391 RQTEGPEEGPNSGGAGELVVRELDLASLRSVRAFCQEMLQEEPRLDVLINNAGI 552
                   G + G   +  V   DLA   ++ A   E+LQ    +DVLINNAGI
Sbjct: 97  -------AGSSQGQTHQPFVVTFDLADPGTIAAAAAEILQCFGYVDVLINNAGI 143


  Database: RefSeqMP
    Posted date:  Aug 2, 2006 12:58 AM
  Number of letters in database: 21,768,885
  Number of sequences in database:  45,328
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 38,848,331
Number of Sequences: 45328
Number of extensions: 932839
Number of successful extensions: 3950
Number of sequences better than 1.0e-05: 10
Number of HSP's better than  0.0 without gapping: 3372
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3897
length of database: 21,768,885
effective HSP length: 103
effective length of database: 17,100,101
effective search space used: 3659421614
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)