Animal-Genome cDNA 20060611C-002330


Search to RefSeqSP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611C-002330
         (1133 letters)

Database: RefSeqSP 
           1040 sequences; 434,620 total letters

Searching...done

 ***** No hits found ******

  Database: RefSeqSP
    Posted date:  Aug 1, 2006  7:14 PM
  Number of letters in database: 434,620
  Number of sequences in database:  1040
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,014,740
Number of Sequences: 1040
Number of extensions: 25000
Number of successful extensions: 106
Number of sequences better than 1.0e-05: 0
Number of HSP's better than  0.0 without gapping: 81
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 106
length of database: 434,620
effective HSP length: 78
effective length of database: 353,500
effective search space used: 105696500
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqBP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611C-002330
         (1133 letters)

Database: RefSeqBP 
           33,508 sequences; 16,112,626 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|XP_584500.2| PREDICTED: similar to NAD-dependent malic enzym...   554   e-158
Alignment   gi|XP_604169.2| PREDICTED: similar to malic enzyme 3, NADP(+)-d...   315   3e-86
Alignment   gi|XP_596455.2| PREDICTED: similar to NADP-dependent malic enzy...   126   3e-29
Alignment   gi|XP_613987.2| PREDICTED: similar to NADP-dependent malic enzy...   122   7e-28

>ref|XP_584500.2| PREDICTED: similar to NAD-dependent malic enzyme, mitochondrial
            precursor (NAD-ME) (Malic enzyme 2), partial [Bos taurus]
          Length = 513

 Score =  554 bits (1427), Expect = e-158
 Identities = 269/286 (94%), Positives = 273/286 (95%)
 Frame = +1

Query: 178  RGARLVVREMMLSRFKIVATPCTLACRHLHIKEKGKPLMLNPRTNKGMAFTLQERQMLGL 357
            +G    VR+ MLSRFKIVATPCTLACRHLH KEKGKPLMLNPRTNKGMAFTLQERQMLGL
Sbjct: 66   KGPVASVRKKMLSRFKIVATPCTLACRHLHTKEKGKPLMLNPRTNKGMAFTLQERQMLGL 125

Query: 358  QGLLPPKIETQDIQALRFHRNVKKLNGPLEKYIYIMGIQERNEKLFYRILQDDIETLMPI 537
            QGLLPPKIETQDIQALRFHRN+KKLNGPLEKYIYIMGIQERNEKLFYRILQDDIETLMPI
Sbjct: 126  QGLLPPKIETQDIQALRFHRNLKKLNGPLEKYIYIMGIQERNEKLFYRILQDDIETLMPI 185

Query: 538  VYTPTVGLACSQYGHIFRRPKGLFISISDRGHVRSIVDNWPENHVKAVVVTDGERILGLG 717
            VYTPTVGLACSQYGHIFRRPKGLFISISDRGHVRSIVDNWPENHVKAVVVTDGERILGLG
Sbjct: 186  VYTPTVGLACSQYGHIFRRPKGLFISISDRGHVRSIVDNWPENHVKAVVVTDGERILGLG 245

Query: 718  DLGVYGMGIPVGKLCLYTACAGIRPDRCLPVCIDVGTDNPALLKDPFYMGLYQKRDRSQR 897
            DLGVYGMGIPVGKLCLYTACAGIRPDRCLPVCIDVGTDNPALLKDPFYMGLYQKRDRSQR
Sbjct: 246  DLGVYGMGIPVGKLCLYTACAGIRPDRCLPVCIDVGTDNPALLKDPFYMGLYQKRDRSQR 305

Query: 898  YDDLIDEFMKAITDRYGRNILIQFEDFGNHNVFRFLRKIRENIVPF 1035
            YDDLIDEFMKAITDRYG+N LIQFEDFGNHN FRFLRK RE    F
Sbjct: 306  YDDLIDEFMKAITDRYGQNTLIQFEDFGNHNAFRFLRKYREKYCTF 351


>ref|XP_604169.2| PREDICTED: similar to malic enzyme 3, NADP(+)-dependent,
            mitochondrial [Bos taurus]
          Length = 564

 Score =  315 bits (808), Expect = 3e-86
 Identities = 146/239 (61%), Positives = 184/239 (76%)
 Frame = +1

Query: 319  MAFTLQERQMLGLQGLLPPKIETQDIQALRFHRNVKKLNGPLEKYIYIMGIQERNEKLFY 498
            MAFTL+ER  LG+ GL+PP   +QD+Q LR  R  ++    L+KYI +M +Q+RNEKLFY
Sbjct: 1    MAFTLEERLQLGIHGLIPPCFLSQDVQLLRVMRYYERQQSDLDKYIILMTLQDRNEKLFY 60

Query: 499  RILQDDIETLMPIVYTPTVGLACSQYGHIFRRPKGLFISISDRGHVRSIVDNWPENHVKA 678
            R+L  D+E  +PIVYTPTVGLAC  YG  FRRP+GLFI++ D+GH+ +++++WPE+ +KA
Sbjct: 61   RVLTSDVEKFLPIVYTPTVGLACQHYGLTFRRPRGLFITVHDKGHLATMLNSWPEDDIKA 120

Query: 679  VVVTDGERILGLGDLGVYGMGIPVGKLCLYTACAGIRPDRCLPVCIDVGTDNPALLKDPF 858
            VVVTDGERILGLGDLG YGMGIPVGKL LYTAC G+ P +CLPV +DVGT+N  LL+DP 
Sbjct: 121  VVVTDGERILGLGDLGCYGMGIPVGKLALYTACGGVNPRQCLPVLLDVGTNNEELLRDPL 180

Query: 859  YMGLYQKRDRSQRYDDLIDEFMKAITDRYGRNILIQFEDFGNHNVFRFLRKIRENIVPF 1035
            Y+GL  +R R Q YDDL+DEFM+A+TD++G N LIQFEDF N N FR L K R     F
Sbjct: 181  YIGLKHRRVRGQEYDDLLDEFMQAVTDKFGINCLIQFEDFANANAFRLLNKYRNKYCMF 239


>ref|XP_596455.2| PREDICTED: similar to NADP-dependent malic enzyme (NADP-ME) (Malic
           enzyme 1) [Bos taurus]
          Length = 157

 Score =  126 bits (317), Expect = 3e-29
 Identities = 62/125 (49%), Positives = 84/125 (67%)
 Frame = +1

Query: 460 IMGIQERNEKLFYRILQDDIETLMPIVYTPTVGLACSQYGHIFRRPKGLFISISDRGHVR 639
           ++ I E  E+L+         +L  I+    +    + +    +  +GLFISI DRGH+ 
Sbjct: 31  VLPIPENRERLYPGAC-----SLWEIILVNIIDKDGNMFNGFDKNYRGLFISIHDRGHIS 85

Query: 640 SIVDNWPENHVKAVVVTDGERILGLGDLGVYGMGIPVGKLCLYTACAGIRPDRCLPVCID 819
           S+++ WPE+ +KA+VVTDGERILGLGDLG  GMGIPVGKL LYTAC G+ P +CLPV +D
Sbjct: 86  SVLNAWPEDVIKAIVVTDGERILGLGDLGCNGMGIPVGKLALYTACGGMNPQQCLPVMLD 145

Query: 820 VGTDN 834
           VGT+N
Sbjct: 146 VGTEN 150


>ref|XP_613987.2| PREDICTED: similar to NADP-dependent malic enzyme (NADP-ME) (Malic
           enzyme 1) [Bos taurus]
          Length = 472

 Score =  122 bits (305), Expect = 7e-28
 Identities = 56/108 (51%), Positives = 77/108 (71%), Gaps = 8/108 (7%)
 Frame = +1

Query: 319 MAFTLQERQMLGLQGLLPPKIETQDIQALRFHRNVKKLNGPLEKYIYIMGIQERNEKLFY 498
           +AFTL+ERQ L + GLLPP   +QD+Q LR  +N ++LN   ++Y+ +M +Q+RNEKLFY
Sbjct: 15  LAFTLEERQQLNIHGLLPPSFISQDVQVLRVLKNFERLNSDFDRYLLLMDLQDRNEKLFY 74

Query: 499 RILQDDIETLMPIVYTPTVGLACSQYGHIFRRPK--------GLFISI 618
           ++L  DIE  MPIVYTPTVGLAC QY   FR+P+        GLF+++
Sbjct: 75  KVLMSDIEKFMPIVYTPTVGLACQQYSLAFRKPRFNVLVTSYGLFLNV 122


  Database: RefSeqBP
    Posted date:  Aug 1, 2006  7:14 PM
  Number of letters in database: 16,112,626
  Number of sequences in database:  33,508
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 36,758,197
Number of Sequences: 33508
Number of extensions: 920804
Number of successful extensions: 3839
Number of sequences better than 1.0e-05: 4
Number of HSP's better than  0.0 without gapping: 3131
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3826
length of database: 16,112,626
effective HSP length: 103
effective length of database: 12,661,302
effective search space used: 3469196748
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqHP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611C-002330
         (1133 letters)

Database: RefSeqHP 
           39,411 sequences; 17,774,539 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_002387.1| malic enzyme 2, NAD(+)-dependent, mitochondrial...   532   e-151
Alignment   gi|XP_934770.1| PREDICTED: similar to NAD-dependent malic enzym...   333   1e-91
Alignment   gi|XP_944182.1| PREDICTED: similar to NAD-dependent malic enzym...   333   1e-91
Alignment   gi|NP_002386.1| cytosolic malic enzyme 1 [Homo sapiens]              332   5e-91
Alignment   gi|NP_001014811.1| malic enzyme 3, NADP(+)-dependent, mitochond...   331   8e-91
Alignment   gi|NP_006671.2| malic enzyme 3, NADP(+)-dependent, mitochondria...   331   8e-91
Alignment   gi|XP_948952.1| PREDICTED: hypothetical protein XP_948952 [Homo...    34   9e-06
Alignment   gi|XP_939453.1| PREDICTED: hypothetical protein XP_939453 [Homo...    34   9e-06

>ref|NP_002387.1| malic enzyme 2, NAD(+)-dependent, mitochondrial [Homo sapiens]
          Length = 584

 Score =  532 bits (1370), Expect = e-151
 Identities = 256/276 (92%), Positives = 264/276 (95%)
 Frame = +1

Query: 208  MLSRFKIVATPCTLACRHLHIKEKGKPLMLNPRTNKGMAFTLQERQMLGLQGLLPPKIET 387
            MLSR ++V+T CTLACRHLHIKEKGKPLMLNPRTNKGMAFTLQERQMLGLQGLLPPKIET
Sbjct: 1    MLSRLRVVSTTCTLACRHLHIKEKGKPLMLNPRTNKGMAFTLQERQMLGLQGLLPPKIET 60

Query: 388  QDIQALRFHRNVKKLNGPLEKYIYIMGIQERNEKLFYRILQDDIETLMPIVYTPTVGLAC 567
            QDIQALRFHRN+KK+  PLEKYIYIMGIQERNEKLFYRILQDDIE+LMPIVYTPTVGLAC
Sbjct: 61   QDIQALRFHRNLKKMTSPLEKYIYIMGIQERNEKLFYRILQDDIESLMPIVYTPTVGLAC 120

Query: 568  SQYGHIFRRPKGLFISISDRGHVRSIVDNWPENHVKAVVVTDGERILGLGDLGVYGMGIP 747
            SQYGHIFRRPKGLFISISDRGHVRSIVDNWPENHVKAVVVTDGERILGLGDLGVYGMGIP
Sbjct: 121  SQYGHIFRRPKGLFISISDRGHVRSIVDNWPENHVKAVVVTDGERILGLGDLGVYGMGIP 180

Query: 748  VGKLCLYTACAGIRPDRCLPVCIDVGTDNPALLKDPFYMGLYQKRDRSQRYDDLIDEFMK 927
            VGKLCLYTACAGIRPDRCLPVCIDVGTDN ALLKDPFYMGLYQKRDR+Q+YDDLIDEFMK
Sbjct: 181  VGKLCLYTACAGIRPDRCLPVCIDVGTDNIALLKDPFYMGLYQKRDRTQQYDDLIDEFMK 240

Query: 928  AITDRYGRNILIQFEDFGNHNVFRFLRKIRENIVPF 1035
            AITDRYGRN LIQFEDFGNHN FRFLRK RE    F
Sbjct: 241  AITDRYGRNTLIQFEDFGNHNAFRFLRKYREKYCTF 276


>ref|XP_934770.1| PREDICTED: similar to NAD-dependent malic enzyme, mitochondrial
            precursor (NAD-ME) (Malic enzyme 2) [Homo sapiens]
          Length = 196

 Score =  333 bits (855), Expect = 1e-91
 Identities = 160/194 (82%), Positives = 170/194 (87%)
 Frame = +1

Query: 430  LNGPLEKYIYIMGIQERNEKLFYRILQDDIETLMPIVYTPTVGLACSQYGHIFRRPKGLF 609
            +  P E YIYIMGIQERN+KLFYRILQDD E+LMPI YTPTVGL CSQ GH+FRRPKGLF
Sbjct: 1    MTSPSENYIYIMGIQERNDKLFYRILQDDTESLMPIAYTPTVGLVCSQCGHLFRRPKGLF 60

Query: 610  ISISDRGHVRSIVDNWPENHVKAVVVTDGERILGLGDLGVYGMGIPVGKLCLYTACAGIR 789
            ISISDRGHVRSIVD WPENHVKAV+VTDGERILG GDLGVYGMGIPVGK+CLYT C GI 
Sbjct: 61   ISISDRGHVRSIVDKWPENHVKAVLVTDGERILGHGDLGVYGMGIPVGKICLYTVCPGIW 120

Query: 790  PDRCLPVCIDVGTDNPALLKDPFYMGLYQKRDRSQRYDDLIDEFMKAITDRYGRNILIQF 969
            PDRCL VCIDVG DN ALLK  FYMGLYQKRDR+Q+ DD IDEFMKAITDRYG N L+QF
Sbjct: 121  PDRCLLVCIDVGADNIALLKGTFYMGLYQKRDRTQQSDDPIDEFMKAITDRYGWNTLLQF 180

Query: 970  EDFGNHNVFRFLRK 1011
            E FG+HN FRFLRK
Sbjct: 181  EGFGHHNAFRFLRK 194


>ref|XP_944182.1| PREDICTED: similar to NAD-dependent malic enzyme, mitochondrial
            precursor (NAD-ME) (Malic enzyme 2) [Homo sapiens]
          Length = 196

 Score =  333 bits (855), Expect = 1e-91
 Identities = 160/194 (82%), Positives = 170/194 (87%)
 Frame = +1

Query: 430  LNGPLEKYIYIMGIQERNEKLFYRILQDDIETLMPIVYTPTVGLACSQYGHIFRRPKGLF 609
            +  P E YIYIMGIQERN+KLFYRILQDD E+LMPI YTPTVGL CSQ GH+FRRPKGLF
Sbjct: 1    MTSPSENYIYIMGIQERNDKLFYRILQDDTESLMPIAYTPTVGLVCSQCGHLFRRPKGLF 60

Query: 610  ISISDRGHVRSIVDNWPENHVKAVVVTDGERILGLGDLGVYGMGIPVGKLCLYTACAGIR 789
            ISISDRGHVRSIVD WPENHVKAV+VTDGERILG GDLGVYGMGIPVGK+CLYT C GI 
Sbjct: 61   ISISDRGHVRSIVDKWPENHVKAVLVTDGERILGHGDLGVYGMGIPVGKICLYTVCPGIW 120

Query: 790  PDRCLPVCIDVGTDNPALLKDPFYMGLYQKRDRSQRYDDLIDEFMKAITDRYGRNILIQF 969
            PDRCL VCIDVG DN ALLK  FYMGLYQKRDR+Q+ DD IDEFMKAITDRYG N L+QF
Sbjct: 121  PDRCLLVCIDVGADNIALLKGTFYMGLYQKRDRTQQSDDPIDEFMKAITDRYGWNTLLQF 180

Query: 970  EDFGNHNVFRFLRK 1011
            E FG+HN FRFLRK
Sbjct: 181  EGFGHHNAFRFLRK 194


>ref|NP_002386.1| cytosolic malic enzyme 1 [Homo sapiens]
          Length = 572

 Score =  332 bits (850), Expect = 5e-91
 Identities = 155/262 (59%), Positives = 192/262 (73%)
 Frame = +1

Query: 250  ACRHLHIKEKGKPLMLNPRTNKGMAFTLQERQMLGLQGLLPPKIETQDIQALRFHRNVKK 429
            A R  H  ++G  L  NP  NK +AFTL+ERQ L + GLLPP   +Q+IQ LR  +N + 
Sbjct: 5    APRRRHTHQRGYLLTRNPHLNKDLAFTLEERQQLNIHGLLPPSFNSQEIQVLRVVKNFEH 64

Query: 430  LNGPLEKYIYIMGIQERNEKLFYRILQDDIETLMPIVYTPTVGLACSQYGHIFRRPKGLF 609
            LN   ++Y+ +M +Q+RNEKLFYR+L  DIE  MPIVYTPTVGLAC QY  +FR+P+GLF
Sbjct: 65   LNSDFDRYLLLMDLQDRNEKLFYRVLTSDIEKFMPIVYTPTVGLACQQYSLVFRKPRGLF 124

Query: 610  ISISDRGHVRSIVDNWPENHVKAVVVTDGERILGLGDLGVYGMGIPVGKLCLYTACAGIR 789
            I+I DRGH+ S+++ WPE+ +KA+VVTDGERILGLGDLG  GMGIPVGKL LYTAC G+ 
Sbjct: 125  ITIHDRGHIASVLNAWPEDVIKAIVVTDGERILGLGDLGCNGMGIPVGKLALYTACGGMN 184

Query: 790  PDRCLPVCIDVGTDNPALLKDPFYMGLYQKRDRSQRYDDLIDEFMKAITDRYGRNILIQF 969
            P  CLPV +DVGT+N  LLKDP Y+GL Q+R R   YDD +DEFM+A++ +YG N LIQF
Sbjct: 185  PQECLPVILDVGTENEELLKDPLYIGLRQRRVRGSEYDDFLDEFMEAVSSKYGMNCLIQF 244

Query: 970  EDFGNHNVFRFLRKIRENIVPF 1035
            EDF N N FR L K R     F
Sbjct: 245  EDFANVNAFRLLNKYRNQYCTF 266


>ref|NP_001014811.1| malic enzyme 3, NADP(+)-dependent, mitochondrial [Homo sapiens]
          Length = 604

 Score =  331 bits (848), Expect = 8e-91
 Identities = 154/260 (59%), Positives = 197/260 (75%)
 Frame = +1

Query: 256  RHLHIKEKGKPLMLNPRTNKGMAFTLQERQMLGLQGLLPPKIETQDIQALRFHRNVKKLN 435
            R + +K++G  +  NP  NKGMAFTL+ER  LG+ GL+PP   +QD+Q LR  R  ++  
Sbjct: 42   RPVPLKKRGYDVTRNPHLNKGMAFTLEERLQLGIHGLIPPCFLSQDVQLLRIMRYYERQQ 101

Query: 436  GPLEKYIYIMGIQERNEKLFYRILQDDIETLMPIVYTPTVGLACSQYGHIFRRPKGLFIS 615
              L+KYI +M +Q+RNEKLFYR+L  D+E  MPIVYTPTVGLAC  YG  FRRP+GLFI+
Sbjct: 102  SDLDKYIILMTLQDRNEKLFYRVLTSDVEKFMPIVYTPTVGLACQHYGLTFRRPRGLFIT 161

Query: 616  ISDRGHVRSIVDNWPENHVKAVVVTDGERILGLGDLGVYGMGIPVGKLCLYTACAGIRPD 795
            I D+GH+ +++++WPE+++KAVVVTDGERILGLGDLG YGMGIPVGKL LYTAC G+ P 
Sbjct: 162  IHDKGHLATMLNSWPEDNIKAVVVTDGERILGLGDLGCYGMGIPVGKLALYTACGGVNPQ 221

Query: 796  RCLPVCIDVGTDNPALLKDPFYMGLYQKRDRSQRYDDLIDEFMKAITDRYGRNILIQFED 975
            +CLPV +DVGT+N  LL+DP Y+GL  +R   + YDDL+DEFM+A+TD++G N LIQFED
Sbjct: 222  QCLPVLLDVGTNNEELLRDPLYIGLKHQRVHGKAYDDLLDEFMQAVTDKFGINCLIQFED 281

Query: 976  FGNHNVFRFLRKIRENIVPF 1035
            F N N FR L K R     F
Sbjct: 282  FANANAFRLLNKYRNKYCMF 301


>ref|NP_006671.2| malic enzyme 3, NADP(+)-dependent, mitochondrial [Homo sapiens]
          Length = 604

 Score =  331 bits (848), Expect = 8e-91
 Identities = 154/260 (59%), Positives = 197/260 (75%)
 Frame = +1

Query: 256  RHLHIKEKGKPLMLNPRTNKGMAFTLQERQMLGLQGLLPPKIETQDIQALRFHRNVKKLN 435
            R + +K++G  +  NP  NKGMAFTL+ER  LG+ GL+PP   +QD+Q LR  R  ++  
Sbjct: 42   RPVPLKKRGYDVTRNPHLNKGMAFTLEERLQLGIHGLIPPCFLSQDVQLLRIMRYYERQQ 101

Query: 436  GPLEKYIYIMGIQERNEKLFYRILQDDIETLMPIVYTPTVGLACSQYGHIFRRPKGLFIS 615
              L+KYI +M +Q+RNEKLFYR+L  D+E  MPIVYTPTVGLAC  YG  FRRP+GLFI+
Sbjct: 102  SDLDKYIILMTLQDRNEKLFYRVLTSDVEKFMPIVYTPTVGLACQHYGLTFRRPRGLFIT 161

Query: 616  ISDRGHVRSIVDNWPENHVKAVVVTDGERILGLGDLGVYGMGIPVGKLCLYTACAGIRPD 795
            I D+GH+ +++++WPE+++KAVVVTDGERILGLGDLG YGMGIPVGKL LYTAC G+ P 
Sbjct: 162  IHDKGHLATMLNSWPEDNIKAVVVTDGERILGLGDLGCYGMGIPVGKLALYTACGGVNPQ 221

Query: 796  RCLPVCIDVGTDNPALLKDPFYMGLYQKRDRSQRYDDLIDEFMKAITDRYGRNILIQFED 975
            +CLPV +DVGT+N  LL+DP Y+GL  +R   + YDDL+DEFM+A+TD++G N LIQFED
Sbjct: 222  QCLPVLLDVGTNNEELLRDPLYIGLKHQRVHGKAYDDLLDEFMQAVTDKFGINCLIQFED 281

Query: 976  FGNHNVFRFLRKIRENIVPF 1035
            F N N FR L K R     F
Sbjct: 282  FANANAFRLLNKYRNKYCMF 301


>ref|XP_948952.1| PREDICTED: hypothetical protein XP_948952 [Homo sapiens]
          Length = 250

 Score = 34.3 bits (77), Expect(2) = 9e-06
 Identities = 19/37 (51%), Positives = 20/37 (54%)
 Frame = -2

Query: 142 SAHPDDAQLQLSPPLPFSRLPGAGAS*GSTRPGRLDT 32
           +A P DAQL   P LPF   PGA  S GS   GR  T
Sbjct: 129 AARPGDAQLPRRPALPFCEPPGAAVSSGSHWRGRPHT 165



 Score = 33.9 bits (76), Expect(2) = 9e-06
 Identities = 16/24 (66%), Positives = 17/24 (70%)
 Frame = -1

Query: 200 LTTSLAPRQVVLRTERPRPLSPPG 129
           LT  LAPRQVV   ERPRP + PG
Sbjct: 110 LTRGLAPRQVVHPAERPRPAARPG 133


>ref|XP_939453.1| PREDICTED: hypothetical protein XP_939453 [Homo sapiens]
          Length = 250

 Score = 34.3 bits (77), Expect(2) = 9e-06
 Identities = 19/37 (51%), Positives = 20/37 (54%)
 Frame = -2

Query: 142 SAHPDDAQLQLSPPLPFSRLPGAGAS*GSTRPGRLDT 32
           +A P DAQL   P LPF   PGA  S GS   GR  T
Sbjct: 129 AARPGDAQLPRRPALPFCEPPGAAVSSGSHWRGRPHT 165



 Score = 33.9 bits (76), Expect(2) = 9e-06
 Identities = 16/24 (66%), Positives = 17/24 (70%)
 Frame = -1

Query: 200 LTTSLAPRQVVLRTERPRPLSPPG 129
           LT  LAPRQVV   ERPRP + PG
Sbjct: 110 LTRGLAPRQVVHPAERPRPAARPG 133


  Database: RefSeqHP
    Posted date:  Aug 2, 2006 12:57 AM
  Number of letters in database: 17,774,539
  Number of sequences in database:  39,411
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 41,133,850
Number of Sequences: 39411
Number of extensions: 1042940
Number of successful extensions: 4467
Number of sequences better than 1.0e-05: 8
Number of HSP's better than  0.0 without gapping: 3521
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4446
length of database: 17,774,539
effective HSP length: 104
effective length of database: 13,675,795
effective search space used: 3733492035
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqCP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611C-002330
         (1133 letters)

Database: RefSeqCP 
           33,732 sequences; 19,266,565 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|XP_849530.1| PREDICTED: similar to NAD-dependent malic enzym...   540   e-154
Alignment   gi|XP_533402.2| PREDICTED: similar to NAD-dependent malic enzym...   380   e-106
Alignment   gi|XP_848770.1| PREDICTED: similar to malic enzyme 3, NADP(+)-d...   334   1e-91
Alignment   gi|XP_857227.1| PREDICTED: similar to malic enzyme 3, NADP(+)-d...   318   8e-87
Alignment   gi|XP_857177.1| PREDICTED: similar to malic enzyme 3, NADP(+)-d...   318   8e-87
Alignment   gi|XP_857135.1| PREDICTED: similar to malic enzyme 3, NADP(+)-d...   318   8e-87
Alignment   gi|XP_857051.1| PREDICTED: similar to malic enzyme 3, NADP(+)-d...   318   8e-87
Alignment   gi|XP_532217.2| PREDICTED: similar to NADP-dependent malic enzy...   313   2e-85
Alignment   gi|XP_542269.2| PREDICTED: similar to malic enzyme 3, NADP(+)-d...   303   2e-82

>ref|XP_849530.1| PREDICTED: similar to NAD-dependent malic enzyme, mitochondrial
            precursor (NAD-ME) (Malic enzyme 2) isoform 2 [Canis
            familiaris]
          Length = 584

 Score =  540 bits (1390), Expect(2) = e-154
 Identities = 260/276 (94%), Positives = 266/276 (96%)
 Frame = +1

Query: 208  MLSRFKIVATPCTLACRHLHIKEKGKPLMLNPRTNKGMAFTLQERQMLGLQGLLPPKIET 387
            MLSR +IVA P TLACRH+HIKEKGKPLMLNPRTNKGMAFTLQERQMLGLQGLLPPKIET
Sbjct: 1    MLSRLRIVAVPSTLACRHIHIKEKGKPLMLNPRTNKGMAFTLQERQMLGLQGLLPPKIET 60

Query: 388  QDIQALRFHRNVKKLNGPLEKYIYIMGIQERNEKLFYRILQDDIETLMPIVYTPTVGLAC 567
            QDIQALRFH+NVKK+NGPLEKYIYIMGIQERNEKLFYRILQDDIE+LMPIVYTPTVGLAC
Sbjct: 61   QDIQALRFHKNVKKMNGPLEKYIYIMGIQERNEKLFYRILQDDIESLMPIVYTPTVGLAC 120

Query: 568  SQYGHIFRRPKGLFISISDRGHVRSIVDNWPENHVKAVVVTDGERILGLGDLGVYGMGIP 747
            SQYGHIFRRPKGLFISISDRGHVRSIVDNWPENHVKAVVVTDGERILGLGDLGVYGMGIP
Sbjct: 121  SQYGHIFRRPKGLFISISDRGHVRSIVDNWPENHVKAVVVTDGERILGLGDLGVYGMGIP 180

Query: 748  VGKLCLYTACAGIRPDRCLPVCIDVGTDNPALLKDPFYMGLYQKRDRSQRYDDLIDEFMK 927
            VGKLCLYTACAGIRPDRCLPVCIDVGTDNPALLKDPFYMGLYQKRDRSQRYDDLIDEFMK
Sbjct: 181  VGKLCLYTACAGIRPDRCLPVCIDVGTDNPALLKDPFYMGLYQKRDRSQRYDDLIDEFMK 240

Query: 928  AITDRYGRNILIQFEDFGNHNVFRFLRKIRENIVPF 1035
            AITDRYG+N LIQFEDFGNHN FRFLRK RE    F
Sbjct: 241  AITDRYGQNTLIQFEDFGNHNAFRFLRKYREKYCTF 276



 Score = 24.3 bits (51), Expect(2) = e-154
 Identities = 10/11 (90%), Positives = 10/11 (90%)
 Frame = +2

Query: 1100 GKSISEHKILF 1132
            GKS SEHKILF
Sbjct: 299  GKSFSEHKILF 309


>ref|XP_533402.2| PREDICTED: similar to NAD-dependent malic enzyme, mitochondrial
            precursor (NAD-ME) (Malic enzyme 2) isoform 1 [Canis
            familiaris]
          Length = 499

 Score =  380 bits (976), Expect(2) = e-106
 Identities = 182/191 (95%), Positives = 184/191 (96%)
 Frame = +1

Query: 463  MGIQERNEKLFYRILQDDIETLMPIVYTPTVGLACSQYGHIFRRPKGLFISISDRGHVRS 642
            MGIQERNEKLFYRILQDDIE+LMPIVYTPTVGLACSQYGHIFRRPKGLFISISDRGHVRS
Sbjct: 1    MGIQERNEKLFYRILQDDIESLMPIVYTPTVGLACSQYGHIFRRPKGLFISISDRGHVRS 60

Query: 643  IVDNWPENHVKAVVVTDGERILGLGDLGVYGMGIPVGKLCLYTACAGIRPDRCLPVCIDV 822
            IVDNWPENHVKAVVVTDGERILGLGDLGVYGMGIPVGKLCLYTACAGIRPDRCLPVCIDV
Sbjct: 61   IVDNWPENHVKAVVVTDGERILGLGDLGVYGMGIPVGKLCLYTACAGIRPDRCLPVCIDV 120

Query: 823  GTDNPALLKDPFYMGLYQKRDRSQRYDDLIDEFMKAITDRYGRNILIQFEDFGNHNVFRF 1002
            GTDNPALLKDPFYMGLYQKRDRSQRYDDLIDEFMKAITDRYG+N LIQFEDFGNHN FRF
Sbjct: 121  GTDNPALLKDPFYMGLYQKRDRSQRYDDLIDEFMKAITDRYGQNTLIQFEDFGNHNAFRF 180

Query: 1003 LRKIRENIVPF 1035
            LRK RE    F
Sbjct: 181  LRKYREKYCTF 191



 Score = 24.3 bits (51), Expect(2) = e-106
 Identities = 10/11 (90%), Positives = 10/11 (90%)
 Frame = +2

Query: 1100 GKSISEHKILF 1132
            GKS SEHKILF
Sbjct: 214  GKSFSEHKILF 224


>ref|XP_848770.1| PREDICTED: similar to malic enzyme 3, NADP(+)-dependent,
            mitochondrial isoform 2 [Canis familiaris]
          Length = 604

 Score =  334 bits (856), Expect = 1e-91
 Identities = 156/260 (60%), Positives = 198/260 (76%)
 Frame = +1

Query: 256  RHLHIKEKGKPLMLNPRTNKGMAFTLQERQMLGLQGLLPPKIETQDIQALRFHRNVKKLN 435
            R + +K++G  +  NP  NKGMAFTL+ER  LG+ GL+PP   +QD+Q LR  R  ++  
Sbjct: 42   RPVPLKKRGYDVTRNPHLNKGMAFTLEERLQLGIHGLIPPCFLSQDVQLLRIMRYYERQQ 101

Query: 436  GPLEKYIYIMGIQERNEKLFYRILQDDIETLMPIVYTPTVGLACSQYGHIFRRPKGLFIS 615
              L+KYI +M +Q+RNEKLFYR+L  D+E  MPIVYTPTVGLAC QYG  FRRP+GLFI+
Sbjct: 102  SDLDKYIILMTLQDRNEKLFYRVLTSDVEKFMPIVYTPTVGLACQQYGLTFRRPRGLFIT 161

Query: 616  ISDRGHVRSIVDNWPENHVKAVVVTDGERILGLGDLGVYGMGIPVGKLCLYTACAGIRPD 795
            I D+GH+ +++++WPE+ +KAVVVTDGERILGLGDLG YGMGIPVGKL LYTAC G+ P 
Sbjct: 162  IHDKGHLATMLNSWPEDDIKAVVVTDGERILGLGDLGCYGMGIPVGKLALYTACGGVSPQ 221

Query: 796  RCLPVCIDVGTDNPALLKDPFYMGLYQKRDRSQRYDDLIDEFMKAITDRYGRNILIQFED 975
            +CLPV +DVGT+N  LL+DP Y+GL  +R R + YDDL+DEFM+A+TD++G N LIQFED
Sbjct: 222  QCLPVLLDVGTNNEELLRDPLYIGLKHQRVRGKEYDDLLDEFMQAVTDKFGINCLIQFED 281

Query: 976  FGNHNVFRFLRKIRENIVPF 1035
            F N N FR L K R     F
Sbjct: 282  FANANAFRLLNKYRNKYCMF 301


>ref|XP_857227.1| PREDICTED: similar to malic enzyme 3, NADP(+)-dependent,
            mitochondrial isoform 7 [Canis familiaris]
          Length = 562

 Score =  318 bits (814), Expect = 8e-87
 Identities = 148/239 (61%), Positives = 185/239 (77%)
 Frame = +1

Query: 319  MAFTLQERQMLGLQGLLPPKIETQDIQALRFHRNVKKLNGPLEKYIYIMGIQERNEKLFY 498
            MAFTL+ER  LG+ GL+PP   +QD+Q LR  R  ++    L+KYI +M +Q+RNEKLFY
Sbjct: 1    MAFTLEERLQLGIHGLIPPCFLSQDVQLLRIMRYYERQQSDLDKYIILMTLQDRNEKLFY 60

Query: 499  RILQDDIETLMPIVYTPTVGLACSQYGHIFRRPKGLFISISDRGHVRSIVDNWPENHVKA 678
            R+L  D+E  MPIVYTPTVGLAC QYG  FRRP+GLFI+I D+GH+ +++++WPE+ +KA
Sbjct: 61   RVLTSDVEKFMPIVYTPTVGLACQQYGLTFRRPRGLFITIHDKGHLATMLNSWPEDDIKA 120

Query: 679  VVVTDGERILGLGDLGVYGMGIPVGKLCLYTACAGIRPDRCLPVCIDVGTDNPALLKDPF 858
            VVVTDGERILGLGDLG YGMGIPVGKL LYTAC G+ P +CLPV +DVGT+N  LL+DP 
Sbjct: 121  VVVTDGERILGLGDLGCYGMGIPVGKLALYTACGGVSPQQCLPVLLDVGTNNEELLRDPL 180

Query: 859  YMGLYQKRDRSQRYDDLIDEFMKAITDRYGRNILIQFEDFGNHNVFRFLRKIRENIVPF 1035
            Y+GL  +R R + YDDL+DEFM+A+TD++G N LIQFEDF N N FR L K R     F
Sbjct: 181  YIGLKHQRVRGKEYDDLLDEFMQAVTDKFGINCLIQFEDFANANAFRLLNKYRNKYCMF 239


>ref|XP_857177.1| PREDICTED: similar to malic enzyme 3, NADP(+)-dependent,
            mitochondrial isoform 6 [Canis familiaris]
          Length = 513

 Score =  318 bits (814), Expect = 8e-87
 Identities = 148/239 (61%), Positives = 185/239 (77%)
 Frame = +1

Query: 319  MAFTLQERQMLGLQGLLPPKIETQDIQALRFHRNVKKLNGPLEKYIYIMGIQERNEKLFY 498
            MAFTL+ER  LG+ GL+PP   +QD+Q LR  R  ++    L+KYI +M +Q+RNEKLFY
Sbjct: 1    MAFTLEERLQLGIHGLIPPCFLSQDVQLLRIMRYYERQQSDLDKYIILMTLQDRNEKLFY 60

Query: 499  RILQDDIETLMPIVYTPTVGLACSQYGHIFRRPKGLFISISDRGHVRSIVDNWPENHVKA 678
            R+L  D+E  MPIVYTPTVGLAC QYG  FRRP+GLFI+I D+GH+ +++++WPE+ +KA
Sbjct: 61   RVLTSDVEKFMPIVYTPTVGLACQQYGLTFRRPRGLFITIHDKGHLATMLNSWPEDDIKA 120

Query: 679  VVVTDGERILGLGDLGVYGMGIPVGKLCLYTACAGIRPDRCLPVCIDVGTDNPALLKDPF 858
            VVVTDGERILGLGDLG YGMGIPVGKL LYTAC G+ P +CLPV +DVGT+N  LL+DP 
Sbjct: 121  VVVTDGERILGLGDLGCYGMGIPVGKLALYTACGGVSPQQCLPVLLDVGTNNEELLRDPL 180

Query: 859  YMGLYQKRDRSQRYDDLIDEFMKAITDRYGRNILIQFEDFGNHNVFRFLRKIRENIVPF 1035
            Y+GL  +R R + YDDL+DEFM+A+TD++G N LIQFEDF N N FR L K R     F
Sbjct: 181  YIGLKHQRVRGKEYDDLLDEFMQAVTDKFGINCLIQFEDFANANAFRLLNKYRNKYCMF 239


>ref|XP_857135.1| PREDICTED: similar to malic enzyme 3, NADP(+)-dependent,
            mitochondrial isoform 5 [Canis familiaris]
          Length = 573

 Score =  318 bits (814), Expect = 8e-87
 Identities = 148/239 (61%), Positives = 185/239 (77%)
 Frame = +1

Query: 319  MAFTLQERQMLGLQGLLPPKIETQDIQALRFHRNVKKLNGPLEKYIYIMGIQERNEKLFY 498
            MAFTL+ER  LG+ GL+PP   +QD+Q LR  R  ++    L+KYI +M +Q+RNEKLFY
Sbjct: 1    MAFTLEERLQLGIHGLIPPCFLSQDVQLLRIMRYYERQQSDLDKYIILMTLQDRNEKLFY 60

Query: 499  RILQDDIETLMPIVYTPTVGLACSQYGHIFRRPKGLFISISDRGHVRSIVDNWPENHVKA 678
            R+L  D+E  MPIVYTPTVGLAC QYG  FRRP+GLFI+I D+GH+ +++++WPE+ +KA
Sbjct: 61   RVLTSDVEKFMPIVYTPTVGLACQQYGLTFRRPRGLFITIHDKGHLATMLNSWPEDDIKA 120

Query: 679  VVVTDGERILGLGDLGVYGMGIPVGKLCLYTACAGIRPDRCLPVCIDVGTDNPALLKDPF 858
            VVVTDGERILGLGDLG YGMGIPVGKL LYTAC G+ P +CLPV +DVGT+N  LL+DP 
Sbjct: 121  VVVTDGERILGLGDLGCYGMGIPVGKLALYTACGGVSPQQCLPVLLDVGTNNEELLRDPL 180

Query: 859  YMGLYQKRDRSQRYDDLIDEFMKAITDRYGRNILIQFEDFGNHNVFRFLRKIRENIVPF 1035
            Y+GL  +R R + YDDL+DEFM+A+TD++G N LIQFEDF N N FR L K R     F
Sbjct: 181  YIGLKHQRVRGKEYDDLLDEFMQAVTDKFGINCLIQFEDFANANAFRLLNKYRNKYCMF 239


>ref|XP_857051.1| PREDICTED: similar to malic enzyme 3, NADP(+)-dependent,
            mitochondrial isoform 3 [Canis familiaris]
          Length = 361

 Score =  318 bits (814), Expect = 8e-87
 Identities = 148/239 (61%), Positives = 185/239 (77%)
 Frame = +1

Query: 319  MAFTLQERQMLGLQGLLPPKIETQDIQALRFHRNVKKLNGPLEKYIYIMGIQERNEKLFY 498
            MAFTL+ER  LG+ GL+PP   +QD+Q LR  R  ++    L+KYI +M +Q+RNEKLFY
Sbjct: 1    MAFTLEERLQLGIHGLIPPCFLSQDVQLLRIMRYYERQQSDLDKYIILMTLQDRNEKLFY 60

Query: 499  RILQDDIETLMPIVYTPTVGLACSQYGHIFRRPKGLFISISDRGHVRSIVDNWPENHVKA 678
            R+L  D+E  MPIVYTPTVGLAC QYG  FRRP+GLFI+I D+GH+ +++++WPE+ +KA
Sbjct: 61   RVLTSDVEKFMPIVYTPTVGLACQQYGLTFRRPRGLFITIHDKGHLATMLNSWPEDDIKA 120

Query: 679  VVVTDGERILGLGDLGVYGMGIPVGKLCLYTACAGIRPDRCLPVCIDVGTDNPALLKDPF 858
            VVVTDGERILGLGDLG YGMGIPVGKL LYTAC G+ P +CLPV +DVGT+N  LL+DP 
Sbjct: 121  VVVTDGERILGLGDLGCYGMGIPVGKLALYTACGGVSPQQCLPVLLDVGTNNEELLRDPL 180

Query: 859  YMGLYQKRDRSQRYDDLIDEFMKAITDRYGRNILIQFEDFGNHNVFRFLRKIRENIVPF 1035
            Y+GL  +R R + YDDL+DEFM+A+TD++G N LIQFEDF N N FR L K R     F
Sbjct: 181  YIGLKHQRVRGKEYDDLLDEFMQAVTDKFGINCLIQFEDFANANAFRLLNKYRNKYCMF 239


>ref|XP_532217.2| PREDICTED: similar to NADP-dependent malic enzyme (NADP-ME) (Malic
            enzyme 1) [Canis familiaris]
          Length = 634

 Score =  313 bits (802), Expect = 2e-85
 Identities = 145/239 (60%), Positives = 181/239 (75%)
 Frame = +1

Query: 319  MAFTLQERQMLGLQGLLPPKIETQDIQALRFHRNVKKLNGPLEKYIYIMGIQERNEKLFY 498
            +AFTL+ERQ L + GLLPP   +QDIQ LR  +N ++L    ++Y+ +M +Q+RNEKLFY
Sbjct: 90   LAFTLEERQQLNIHGLLPPCFISQDIQVLRIIKNFERLTSDFDRYLLLMDLQDRNEKLFY 149

Query: 499  RILQDDIETLMPIVYTPTVGLACSQYGHIFRRPKGLFISISDRGHVRSIVDNWPENHVKA 678
             +L  D+E  MPIVYTPTVGLAC QY   FR+P+GLFISI DRGH+ S+++ WPE+ +KA
Sbjct: 150  SVLMSDLEKFMPIVYTPTVGLACQQYSLAFRKPRGLFISIHDRGHIASVLNAWPEDVIKA 209

Query: 679  VVVTDGERILGLGDLGVYGMGIPVGKLCLYTACAGIRPDRCLPVCIDVGTDNPALLKDPF 858
            +VVTDGERILGLGDLG  GMGIPVGKL LYTAC G+ P  CLPV +DVGT+N ALLKDP 
Sbjct: 210  IVVTDGERILGLGDLGCNGMGIPVGKLALYTACGGMNPQECLPVILDVGTENEALLKDPL 269

Query: 859  YMGLYQKRDRSQRYDDLIDEFMKAITDRYGRNILIQFEDFGNHNVFRFLRKIRENIVPF 1035
            Y+GL Q+R R   YDD +DEFM+A++ +YG N LIQFEDF N N FR L+K +     F
Sbjct: 270  YIGLRQRRVRGPEYDDFLDEFMEAVSSKYGMNCLIQFEDFANINAFRLLKKYQNRYCTF 328


>ref|XP_542269.2| PREDICTED: similar to malic enzyme 3, NADP(+)-dependent,
            mitochondrial isoform 1 [Canis familiaris]
          Length = 569

 Score =  303 bits (776), Expect = 2e-82
 Identities = 148/266 (55%), Positives = 185/266 (69%), Gaps = 27/266 (10%)
 Frame = +1

Query: 319  MAFTLQERQMLGLQGLLPPKIETQDIQALRFHRNVKKLNGPLEKYIYIMGIQERNEKLFY 498
            MAFTL+ER  LG+ GL+PP   +QD+Q LR  R  ++    L+KYI +M +Q+RNEKLFY
Sbjct: 1    MAFTLEERLQLGIHGLIPPCFLSQDVQLLRIMRYYERQQSDLDKYIILMTLQDRNEKLFY 60

Query: 499  RILQDDIETLMPIVYTPTVGLACSQYGHIFRRPK-------------------------- 600
            R+L  D+E  MPIVYTPTVGLAC QYG  FRRP+                          
Sbjct: 61   RVLTSDVEKFMPIVYTPTVGLACQQYGLTFRRPRSAKEGLRGESHYGVDSLSSEGLSCSA 120

Query: 601  -GLFISISDRGHVRSIVDNWPENHVKAVVVTDGERILGLGDLGVYGMGIPVGKLCLYTAC 777
             GLFI+I D+GH+ +++++WPE+ +KAVVVTDGERILGLGDLG YGMGIPVGKL LYTAC
Sbjct: 121  RGLFITIHDKGHLATMLNSWPEDDIKAVVVTDGERILGLGDLGCYGMGIPVGKLALYTAC 180

Query: 778  AGIRPDRCLPVCIDVGTDNPALLKDPFYMGLYQKRDRSQRYDDLIDEFMKAITDRYGRNI 957
             G+ P +CLPV +DVGT+N  LL+DP Y+GL  +R R + YDDL+DEFM+A+TD++G N 
Sbjct: 181  GGVSPQQCLPVLLDVGTNNEELLRDPLYIGLKHQRVRGKEYDDLLDEFMQAVTDKFGINC 240

Query: 958  LIQFEDFGNHNVFRFLRKIRENIVPF 1035
            LIQFEDF N N FR L K R     F
Sbjct: 241  LIQFEDFANANAFRLLNKYRNKYCMF 266


  Database: RefSeqCP
    Posted date:  Aug 1, 2006  9:25 PM
  Number of letters in database: 19,266,565
  Number of sequences in database:  33,732
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 43,256,471
Number of Sequences: 33732
Number of extensions: 1083981
Number of successful extensions: 4444
Number of sequences better than 1.0e-05: 9
Number of HSP's better than  0.0 without gapping: 3602
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4422
length of database: 19,266,565
effective HSP length: 105
effective length of database: 15,724,705
effective search space used: 4277119760
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqMP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611C-002330
         (1133 letters)

Database: RefSeqMP 
           45,328 sequences; 21,768,885 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_663469.1| malic enzyme 2, NAD(+)-dependent, mitochondrial...   515   e-146
Alignment   gi|NP_852072.1| malic enzyme 3, NADP(+)-dependent, mitochondria...   332   6e-91
Alignment   gi|NP_032641.1| malic enzyme, supernatant [Mus musculus]             321   8e-88
Alignment   gi|XP_001004679.1| PREDICTED: similar to NADP-dependent malic e...   308   5e-84
Alignment   gi|XP_001004685.1| PREDICTED: similar to NADP-dependent malic e...   308   5e-84
Alignment   gi|XP_001004683.1| PREDICTED: similar to NADP-dependent malic e...   128   1e-29

>ref|NP_663469.1| malic enzyme 2, NAD(+)-dependent, mitochondrial [Mus musculus]
          Length = 589

 Score =  515 bits (1327), Expect = e-146
 Identities = 246/276 (89%), Positives = 258/276 (93%)
 Frame = +1

Query: 208  MLSRFKIVATPCTLACRHLHIKEKGKPLMLNPRTNKGMAFTLQERQMLGLQGLLPPKIET 387
            M SR + V TPCTL CR +H+KEKGKPLMLNPRTNKGMAFTLQERQMLGLQGLLPPKIET
Sbjct: 1    MFSRLRAVTTPCTLTCRRVHLKEKGKPLMLNPRTNKGMAFTLQERQMLGLQGLLPPKIET 60

Query: 388  QDIQALRFHRNVKKLNGPLEKYIYIMGIQERNEKLFYRILQDDIETLMPIVYTPTVGLAC 567
            QDIQALRFHRN+KK+  PLEKYIYIMGIQERNEKLFYRILQDDIE+LMPIVYTPTVGLAC
Sbjct: 61   QDIQALRFHRNLKKMTSPLEKYIYIMGIQERNEKLFYRILQDDIESLMPIVYTPTVGLAC 120

Query: 568  SQYGHIFRRPKGLFISISDRGHVRSIVDNWPENHVKAVVVTDGERILGLGDLGVYGMGIP 747
             QYGHIFRRPKGLFISISDRGHVRSIVDNWPENHVKAVVVTDGERILGLGDLGVYGMGIP
Sbjct: 121  CQYGHIFRRPKGLFISISDRGHVRSIVDNWPENHVKAVVVTDGERILGLGDLGVYGMGIP 180

Query: 748  VGKLCLYTACAGIRPDRCLPVCIDVGTDNPALLKDPFYMGLYQKRDRSQRYDDLIDEFMK 927
            VGKLCLYTACAGI+P++CLPVCIDVGTDN ALLKDPFYMGLYQKRDRSQ YDDL+DEFMK
Sbjct: 181  VGKLCLYTACAGIQPEKCLPVCIDVGTDNMALLKDPFYMGLYQKRDRSQLYDDLMDEFMK 240

Query: 928  AITDRYGRNILIQFEDFGNHNVFRFLRKIRENIVPF 1035
            AITDRYGRN LIQFEDFGNHN FRFLRK ++    F
Sbjct: 241  AITDRYGRNTLIQFEDFGNHNAFRFLRKYQQKYCTF 276


>ref|NP_852072.1| malic enzyme 3, NADP(+)-dependent, mitochondrial [Mus musculus]
          Length = 604

 Score =  332 bits (850), Expect = 6e-91
 Identities = 155/260 (59%), Positives = 196/260 (75%)
 Frame = +1

Query: 256  RHLHIKEKGKPLMLNPRTNKGMAFTLQERQMLGLQGLLPPKIETQDIQALRFHRNVKKLN 435
            R + +K++G  +  NP  NKGMAFTL+ER  LG+ GL+PP   +QD+Q LR  R  +   
Sbjct: 42   RPVPLKKRGYDVTRNPHLNKGMAFTLEERLQLGIHGLIPPCFLSQDVQLLRIMRYYENQQ 101

Query: 436  GPLEKYIYIMGIQERNEKLFYRILQDDIETLMPIVYTPTVGLACSQYGHIFRRPKGLFIS 615
              L+KYI +M  Q+RNEKLFYR+L  D+E  MPIVYTPTVGLAC  YG  FRRP+GLFI+
Sbjct: 102  SDLDKYIILMTHQDRNEKLFYRVLTSDVEKFMPIVYTPTVGLACQHYGLTFRRPRGLFIT 161

Query: 616  ISDRGHVRSIVDNWPENHVKAVVVTDGERILGLGDLGVYGMGIPVGKLCLYTACAGIRPD 795
            I D+GH+ +++++WPE+++KAVVVTDGERILGLGDLG YGMGIPVGKL LYTAC G+ P 
Sbjct: 162  IHDKGHIATMLNSWPEDNIKAVVVTDGERILGLGDLGCYGMGIPVGKLALYTACGGVNPQ 221

Query: 796  RCLPVCIDVGTDNPALLKDPFYMGLYQKRDRSQRYDDLIDEFMKAITDRYGRNILIQFED 975
            +CLPV +DVGT+N  LL+DP Y+GL  +R R + YDDL+DEFM+A+TD++G N LIQFED
Sbjct: 222  QCLPVLLDVGTNNEELLRDPLYIGLKHQRVRGEEYDDLLDEFMQAVTDKFGINCLIQFED 281

Query: 976  FGNHNVFRFLRKIRENIVPF 1035
            F N N FR L K R     F
Sbjct: 282  FANANAFRLLNKYRNKYCMF 301


>ref|NP_032641.1| malic enzyme, supernatant [Mus musculus]
          Length = 572

 Score =  321 bits (823), Expect = 8e-88
 Identities = 150/262 (57%), Positives = 190/262 (72%)
 Frame = +1

Query: 250  ACRHLHIKEKGKPLMLNPRTNKGMAFTLQERQMLGLQGLLPPKIETQDIQALRFHRNVKK 429
            A R  H  ++G  L  +P  NK +AFTL+ERQ L + GLLPP I +Q++Q LR  +N ++
Sbjct: 5    APRRRHTHQRGYLLTRDPHLNKDLAFTLEERQQLNIHGLLPPCIISQELQVLRIIKNFER 64

Query: 430  LNGPLEKYIYIMGIQERNEKLFYRILQDDIETLMPIVYTPTVGLACSQYGHIFRRPKGLF 609
            LN   ++Y+ +M +Q+RNEKLFY +L  D+E  MPIVYTPTVGLAC QY   FR+P+GLF
Sbjct: 65   LNSDFDRYLLLMDLQDRNEKLFYSVLMSDVEKFMPIVYTPTVGLACQQYSLAFRKPRGLF 124

Query: 610  ISISDRGHVRSIVDNWPENHVKAVVVTDGERILGLGDLGVYGMGIPVGKLCLYTACAGIR 789
            ISI D+GH+ S+++ WPE+ VKA+VVTDGERILGLGDLG  GMGIPVGKL LYTAC G+ 
Sbjct: 125  ISIHDKGHIASVLNAWPEDVVKAIVVTDGERILGLGDLGCNGMGIPVGKLALYTACGGVN 184

Query: 790  PDRCLPVCIDVGTDNPALLKDPFYMGLYQKRDRSQRYDDLIDEFMKAITDRYGRNILIQF 969
            P +CLP+ +DVGT+N  LLKDP Y+GL  +R R   YD  +DEFM+A + +YG N LIQF
Sbjct: 185  PQQCLPITLDVGTENEELLKDPLYIGLRHRRVRGPEYDAFLDEFMEAASSKYGMNCLIQF 244

Query: 970  EDFGNHNVFRFLRKIRENIVPF 1035
            EDF N N FR L K R     F
Sbjct: 245  EDFANRNAFRLLNKYRNKYCTF 266


>ref|XP_001004679.1| PREDICTED: similar to NADP-dependent malic enzyme (NADP-ME) (Malic
            enzyme 1) isoform 1 [Mus musculus]
          Length = 554

 Score =  308 bits (790), Expect = 5e-84
 Identities = 142/239 (59%), Positives = 179/239 (74%)
 Frame = +1

Query: 319  MAFTLQERQMLGLQGLLPPKIETQDIQALRFHRNVKKLNGPLEKYIYIMGIQERNEKLFY 498
            +AFTL+ERQ L + GLLPP I +Q++Q LR  +N ++LN   ++Y+ +M +Q+RNEKLFY
Sbjct: 8    LAFTLEERQQLNIHGLLPPCIISQELQVLRIIKNFERLNSDFDRYLLLMDLQDRNEKLFY 67

Query: 499  RILQDDIETLMPIVYTPTVGLACSQYGHIFRRPKGLFISISDRGHVRSIVDNWPENHVKA 678
             +L  D+E  MPIVYTPTVGLAC QY   FR+P+GLFISI D+GH+ S+++ WPE+ VKA
Sbjct: 68   SVLMSDVEKFMPIVYTPTVGLACQQYSLAFRKPRGLFISIHDKGHIASVLNAWPEDVVKA 127

Query: 679  VVVTDGERILGLGDLGVYGMGIPVGKLCLYTACAGIRPDRCLPVCIDVGTDNPALLKDPF 858
            +VVTDGERILGLGDLG  GMGIPVGKL LYTAC G+ P +CLP+ +DVGT+N  LLKDP 
Sbjct: 128  IVVTDGERILGLGDLGCNGMGIPVGKLALYTACGGVNPQQCLPITLDVGTENEELLKDPL 187

Query: 859  YMGLYQKRDRSQRYDDLIDEFMKAITDRYGRNILIQFEDFGNHNVFRFLRKIRENIVPF 1035
            Y+GL  +R R   YD  +DEFM+A + +YG N LIQFEDF N N FR L K R     F
Sbjct: 188  YIGLRHRRVRGPEYDAFLDEFMEAASSKYGMNCLIQFEDFANRNAFRLLNKYRNKYCTF 246


>ref|XP_001004685.1| PREDICTED: similar to NADP-dependent malic enzyme (NADP-ME) (Malic
            enzyme 1) isoform 4 [Mus musculus]
          Length = 552

 Score =  308 bits (790), Expect = 5e-84
 Identities = 142/239 (59%), Positives = 179/239 (74%)
 Frame = +1

Query: 319  MAFTLQERQMLGLQGLLPPKIETQDIQALRFHRNVKKLNGPLEKYIYIMGIQERNEKLFY 498
            +AFTL+ERQ L + GLLPP I +Q++Q LR  +N ++LN   ++Y+ +M +Q+RNEKLFY
Sbjct: 8    LAFTLEERQQLNIHGLLPPCIISQELQVLRIIKNFERLNSDFDRYLLLMDLQDRNEKLFY 67

Query: 499  RILQDDIETLMPIVYTPTVGLACSQYGHIFRRPKGLFISISDRGHVRSIVDNWPENHVKA 678
             +L  D+E  MPIVYTPTVGLAC QY   FR+P+GLFISI D+GH+ S+++ WPE+ VKA
Sbjct: 68   SVLMSDVEKFMPIVYTPTVGLACQQYSLAFRKPRGLFISIHDKGHIASVLNAWPEDVVKA 127

Query: 679  VVVTDGERILGLGDLGVYGMGIPVGKLCLYTACAGIRPDRCLPVCIDVGTDNPALLKDPF 858
            +VVTDGERILGLGDLG  GMGIPVGKL LYTAC G+ P +CLP+ +DVGT+N  LLKDP 
Sbjct: 128  IVVTDGERILGLGDLGCNGMGIPVGKLALYTACGGVNPQQCLPITLDVGTENEELLKDPL 187

Query: 859  YMGLYQKRDRSQRYDDLIDEFMKAITDRYGRNILIQFEDFGNHNVFRFLRKIRENIVPF 1035
            Y+GL  +R R   YD  +DEFM+A + +YG N LIQFEDF N N FR L K R     F
Sbjct: 188  YIGLRHRRVRGPEYDAFLDEFMEAASSKYGMNCLIQFEDFANRNAFRLLNKYRNKYCTF 246


>ref|XP_001004683.1| PREDICTED: similar to NADP-dependent malic enzyme (NADP-ME) (Malic
            enzyme 1) isoform 3 [Mus musculus]
          Length = 406

 Score =  128 bits (322), Expect = 1e-29
 Identities = 58/100 (58%), Positives = 69/100 (69%)
 Frame = +1

Query: 736  MGIPVGKLCLYTACAGIRPDRCLPVCIDVGTDNPALLKDPFYMGLYQKRDRSQRYDDLID 915
            MGIPVGKL LYTAC G+ P +CLP+ +DVGT+N  LLKDP Y+GL  +R R   YD  +D
Sbjct: 1    MGIPVGKLALYTACGGVNPQQCLPITLDVGTENEELLKDPLYIGLRHRRVRGPEYDAFLD 60

Query: 916  EFMKAITDRYGRNILIQFEDFGNHNVFRFLRKIRENIVPF 1035
            EFM+A + +YG N LIQFEDF N N FR L K R     F
Sbjct: 61   EFMEAASSKYGMNCLIQFEDFANRNAFRLLNKYRNKYCTF 100


  Database: RefSeqMP
    Posted date:  Aug 2, 2006 12:58 AM
  Number of letters in database: 21,768,885
  Number of sequences in database:  45,328
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 49,584,124
Number of Sequences: 45328
Number of extensions: 1230763
Number of successful extensions: 4902
Number of sequences better than 1.0e-05: 6
Number of HSP's better than  0.0 without gapping: 4002
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4879
length of database: 21,768,885
effective HSP length: 105
effective length of database: 17,009,445
effective search space used: 4626569040
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)