Animal-Genome cDNA 20060611C-003258


Search to RefSeqSP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611C-003258
         (993 letters)

Database: RefSeqSP 
           1040 sequences; 434,620 total letters

Searching...done

 ***** No hits found ******

  Database: RefSeqSP
    Posted date:  Aug 1, 2006  7:14 PM
  Number of letters in database: 434,620
  Number of sequences in database:  1040
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 979,291
Number of Sequences: 1040
Number of extensions: 25551
Number of successful extensions: 93
Number of sequences better than 1.0e-05: 0
Number of HSP's better than  0.0 without gapping: 84
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 92
length of database: 434,620
effective HSP length: 77
effective length of database: 354,540
effective search space used: 89698620
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqBP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611C-003258
         (993 letters)

Database: RefSeqBP 
           33,508 sequences; 16,112,626 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|XP_612082.2| PREDICTED: similar to LanC-like protein 1 (40 k...   245   4e-65
Alignment   gi|XP_611101.2| PREDICTED: similar to LanC-like protein 2 (Test...   242   4e-64
Alignment   gi|XP_597454.2| PREDICTED: similar to LanC lantibiotic syntheta...   144   1e-34
Alignment   gi|XP_614740.2| PREDICTED: similar to LanC-like protein 2 (Test...    89   4e-18

>ref|XP_612082.2| PREDICTED: similar to LanC-like protein 1 (40 kDa erythrocyte
           membrane protein) (p40) [Bos taurus]
          Length = 399

 Score =  245 bits (625), Expect = 4e-65
 Identities = 107/145 (73%), Positives = 123/145 (84%)
 Frame = +2

Query: 14  RFRSGNYPSSLSNETDRLVHWCHGAPGVIHTLMQAYKVFKEEKYLRDAVECSDVIWQRGL 193
           +F SGNYP  + +  D L+HWCHGAPGVI+ L QAYKVFKEE+YL DA +C+DVIWQ GL
Sbjct: 255 KFPSGNYPPCVDDSRDLLIHWCHGAPGVIYMLTQAYKVFKEERYLNDAYQCADVIWQYGL 314

Query: 194 LRKGYGICHGTAGNGYSFLSLYRLTQDKKYLYRACKFAEWCLEYGAHGCRIPDRPYSLFE 373
           L+KGYG+CHGTAGN Y+FLSLY LTQD KYLYRACKFAEWCL+YG HGCR PD P+SLFE
Sbjct: 315 LKKGYGLCHGTAGNAYAFLSLYSLTQDAKYLYRACKFAEWCLDYGEHGCRTPDTPFSLFE 374

Query: 374 GMAGAIHFLSDILAPETARFPAFEL 448
           GMAG I+FL+D+L P  ARFPAFEL
Sbjct: 375 GMAGTIYFLADLLVPTKARFPAFEL 399


>ref|XP_611101.2| PREDICTED: similar to LanC-like protein 2 (Testis-specific
           adriamycin sensitivity protein), partial [Bos taurus]
          Length = 149

 Score =  242 bits (617), Expect = 4e-64
 Identities = 114/144 (79%), Positives = 121/144 (84%)
 Frame = +2

Query: 53  ETDRLVHWCHGAPGVIHTLMQAYKVFKEEKYLRDAVECSDVIWQRGLLRKGYGICHGTAG 232
           + D    W    P     + +   VFKEEKYL+DAVECSDVIWQRGLLRKGYGICHGTAG
Sbjct: 6   DVDGRAVWNLPLPSTRVGVSELQPVFKEEKYLKDAVECSDVIWQRGLLRKGYGICHGTAG 65

Query: 233 NGYSFLSLYRLTQDKKYLYRACKFAEWCLEYGAHGCRIPDRPYSLFEGMAGAIHFLSDIL 412
           NGYSFLSLY +TQDKKYLYRACKFAEWCLEYGAHGCRIPDRPYSLFEGMAG IHFLSDIL
Sbjct: 66  NGYSFLSLYHITQDKKYLYRACKFAEWCLEYGAHGCRIPDRPYSLFEGMAGTIHFLSDIL 125

Query: 413 APETARFPAFELGSSERDPKVQKD 484
           APE +RFPAFEL SS+RD KVQKD
Sbjct: 126 APEASRFPAFELSSSQRDTKVQKD 149


>ref|XP_597454.2| PREDICTED: similar to LanC lantibiotic synthetase component C-like
           3 [Bos taurus]
          Length = 244

 Score =  144 bits (362), Expect = 1e-34
 Identities = 69/144 (47%), Positives = 93/144 (64%), Gaps = 4/144 (2%)
 Frame = +2

Query: 29  NYPSSLSNETDR---LVHWCHGAPGVIHTLMQAYKVFKEEKYLRDAVECSDVIWQRGLLR 199
           N+P  L    +R   LVHWCHGAPG+ +   +AY V K+ +YL   + C ++ WQ+GLL+
Sbjct: 99  NWPPELGEAIERENELVHWCHGAPGIAYLFAKAYLVSKKPQYLDTCIRCGELTWQKGLLK 158

Query: 200 KGYGICHGTAGNGYSFLSLYRLTQDKKYLYRACKFAEWCL-EYGAHGCRIPDRPYSLFEG 376
           KG GICHG AG+ Y FL LYRLT + KY+YRA +FAE+   E    G R+ +  YSL+EG
Sbjct: 159 KGPGICHGVAGSAYVFLLLYRLTGNSKYIYRAQRFAEFLFTEEFKAGSRVLESIYSLYEG 218

Query: 377 MAGAIHFLSDILAPETARFPAFEL 448
            +G + FL D+L P  A FP F +
Sbjct: 219 FSGTVCFLIDLLQPNQAEFPLFSV 242


>ref|XP_614740.2| PREDICTED: similar to LanC-like protein 2 (Testis-specific
           adriamycin sensitivity protein), partial [Bos taurus]
          Length = 331

 Score = 89.4 bits (220), Expect = 4e-18
 Identities = 39/41 (95%), Positives = 40/41 (97%)
 Frame = +2

Query: 2   MRHKRFRSGNYPSSLSNETDRLVHWCHGAPGVIHTLMQAYK 124
           MRHKRFRSGNYPSSLSNETDRLVHWCHGAPGVIH LMQA+K
Sbjct: 291 MRHKRFRSGNYPSSLSNETDRLVHWCHGAPGVIHVLMQAHK 331


  Database: RefSeqBP
    Posted date:  Aug 1, 2006  7:14 PM
  Number of letters in database: 16,112,626
  Number of sequences in database:  33,508
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 36,927,985
Number of Sequences: 33508
Number of extensions: 993190
Number of successful extensions: 3827
Number of sequences better than 1.0e-05: 4
Number of HSP's better than  0.0 without gapping: 3318
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3818
length of database: 16,112,626
effective HSP length: 102
effective length of database: 12,694,810
effective search space used: 2894416680
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqCP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611C-003258
         (993 letters)

Database: RefSeqCP 
           33,732 sequences; 19,266,565 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|XP_540359.2| PREDICTED: similar to LanC-like protein 2 (Test...   318   4e-87
Alignment   gi|XP_536055.1| PREDICTED: similar to LanC-like protein 1 (40 k...   236   2e-62
Alignment   gi|XP_548943.2| PREDICTED: similar to LanC lantibiotic syntheta...   144   2e-34

>ref|XP_540359.2| PREDICTED: similar to LanC-like protein 2 (Testis-specific
           adriamycin sensitivity protein) [Canis familiaris]
          Length = 452

 Score =  318 bits (816), Expect = 4e-87
 Identities = 146/158 (92%), Positives = 152/158 (96%)
 Frame = +2

Query: 2   MRHKRFRSGNYPSSLSNETDRLVHWCHGAPGVIHTLMQAYKVFKEEKYLRDAVECSDVIW 181
           +RHKRFRSGNYPSSLSNETDRLVHWCHGAPGVIH LMQAYKVFKEEKYL+DA+ECSDVIW
Sbjct: 295 VRHKRFRSGNYPSSLSNETDRLVHWCHGAPGVIHMLMQAYKVFKEEKYLKDAMECSDVIW 354

Query: 182 QRGLLRKGYGICHGTAGNGYSFLSLYRLTQDKKYLYRACKFAEWCLEYGAHGCRIPDRPY 361
           QRGLLRKGYGICHGTAGNGYSFLSLY LTQDKKYLYRACKFAEWCLEYGAHGCRIPDRPY
Sbjct: 355 QRGLLRKGYGICHGTAGNGYSFLSLYHLTQDKKYLYRACKFAEWCLEYGAHGCRIPDRPY 414

Query: 362 SLFEGMAGAIHFLSDILAPETARFPAFELGSSERDPKV 475
           SLFEGMAGAIHFLSDILAPET+RFPAFEL   +RD K+
Sbjct: 415 SLFEGMAGAIHFLSDILAPETSRFPAFELAPPQRDRKI 452


>ref|XP_536055.1| PREDICTED: similar to LanC-like protein 1 (40 kDa erythrocyte
           membrane protein) (p40) [Canis familiaris]
          Length = 399

 Score =  236 bits (603), Expect = 2e-62
 Identities = 103/145 (71%), Positives = 121/145 (83%)
 Frame = +2

Query: 14  RFRSGNYPSSLSNETDRLVHWCHGAPGVIHTLMQAYKVFKEEKYLRDAVECSDVIWQRGL 193
           +F SGNYP  + +  D LVHWCHG+PGVI+ L+QAYK F+ E YL DA +C+DVIW+ GL
Sbjct: 255 KFPSGNYPPCVDDNRDLLVHWCHGSPGVIYMLIQAYKAFRGEHYLNDAHQCADVIWRYGL 314

Query: 194 LRKGYGICHGTAGNGYSFLSLYRLTQDKKYLYRACKFAEWCLEYGAHGCRIPDRPYSLFE 373
           LRKGYG+CHGTAGN Y+FL+LY LTQD KYLYRACKFAEWCL+YG HGCR PD P+SLFE
Sbjct: 315 LRKGYGLCHGTAGNAYAFLTLYNLTQDMKYLYRACKFAEWCLDYGEHGCRTPDTPFSLFE 374

Query: 374 GMAGAIHFLSDILAPETARFPAFEL 448
           GMAG I+FL+D+L P  ARFPAFEL
Sbjct: 375 GMAGTIYFLADLLVPTKARFPAFEL 399


>ref|XP_548943.2| PREDICTED: similar to LanC lantibiotic synthetase component C-like
           3 [Canis familiaris]
          Length = 420

 Score =  144 bits (362), Expect = 2e-34
 Identities = 69/144 (47%), Positives = 93/144 (64%), Gaps = 4/144 (2%)
 Frame = +2

Query: 29  NYPSSLSNETDR---LVHWCHGAPGVIHTLMQAYKVFKEEKYLRDAVECSDVIWQRGLLR 199
           N+P  L    +R   LVHWCHGAPG+ +   +AY V K+ +YL   + C ++ WQ+GLL+
Sbjct: 275 NWPPELGEAIERENELVHWCHGAPGIAYLFAKAYLVSKKPQYLDTCIRCGELTWQKGLLK 334

Query: 200 KGYGICHGTAGNGYSFLSLYRLTQDKKYLYRACKFAEWCL-EYGAHGCRIPDRPYSLFEG 376
           KG GICHG AG+ Y FL LYRLT + KY+YRA +FAE+   E    G R+ +  YSL+EG
Sbjct: 335 KGPGICHGVAGSAYVFLLLYRLTGNSKYIYRAQRFAEFLFTEEFKAGSRVLESIYSLYEG 394

Query: 377 MAGAIHFLSDILAPETARFPAFEL 448
            +G + FL D+L P  A FP F +
Sbjct: 395 FSGTVCFLIDLLQPNQAEFPLFSV 418


  Database: RefSeqCP
    Posted date:  Aug 1, 2006  9:25 PM
  Number of letters in database: 19,266,565
  Number of sequences in database:  33,732
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 43,202,988
Number of Sequences: 33732
Number of extensions: 1158484
Number of successful extensions: 4279
Number of sequences better than 1.0e-05: 3
Number of HSP's better than  0.0 without gapping: 3664
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4269
length of database: 19,266,565
effective HSP length: 103
effective length of database: 15,792,169
effective search space used: 3584822363
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqHP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611C-003258
         (993 letters)

Database: RefSeqHP 
           39,411 sequences; 17,774,539 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_061167.1| LanC lantibiotic synthetase component C-like 2 ...   315   3e-86
Alignment   gi|NP_006046.1| lanthionine synthetase C-like protein 1 [Homo s...   244   8e-65
Alignment   gi|NP_940913.1| LanC lantibiotic synthetase component C-like 3 ...   108   5e-24

>ref|NP_061167.1| LanC lantibiotic synthetase component C-like 2 [Homo sapiens]
          Length = 450

 Score =  315 bits (808), Expect = 3e-86
 Identities = 143/155 (92%), Positives = 152/155 (98%)
 Frame = +2

Query: 2   MRHKRFRSGNYPSSLSNETDRLVHWCHGAPGVIHTLMQAYKVFKEEKYLRDAVECSDVIW 181
           +RHK+FRSGNYPSSLSNETDRLVHWCHGAPGVIH LMQAYKVFKEEKYL++A+ECSDVIW
Sbjct: 296 VRHKKFRSGNYPSSLSNETDRLVHWCHGAPGVIHMLMQAYKVFKEEKYLKEAMECSDVIW 355

Query: 182 QRGLLRKGYGICHGTAGNGYSFLSLYRLTQDKKYLYRACKFAEWCLEYGAHGCRIPDRPY 361
           QRGLLRKGYGICHGTAGNGYSFLSLYRLTQDKKYLYRACKFAEWCL+YGAHGCRIPDRPY
Sbjct: 356 QRGLLRKGYGICHGTAGNGYSFLSLYRLTQDKKYLYRACKFAEWCLDYGAHGCRIPDRPY 415

Query: 362 SLFEGMAGAIHFLSDILAPETARFPAFELGSSERD 466
           SLFEGMAGAIHFLSD+L PET+RFPAFEL SS+RD
Sbjct: 416 SLFEGMAGAIHFLSDVLGPETSRFPAFELDSSKRD 450


>ref|NP_006046.1| lanthionine synthetase C-like protein 1 [Homo sapiens]
          Length = 399

 Score =  244 bits (623), Expect = 8e-65
 Identities = 107/145 (73%), Positives = 124/145 (85%)
 Frame = +2

Query: 14  RFRSGNYPSSLSNETDRLVHWCHGAPGVIHTLMQAYKVFKEEKYLRDAVECSDVIWQRGL 193
           +F SGNYP  + +  D LVHWCHGAPGVI+ L+QAYKVF+EEKYL DA +C+DVIWQ GL
Sbjct: 255 KFPSGNYPPCIGDNRDLLVHWCHGAPGVIYMLIQAYKVFREEKYLCDAYQCADVIWQYGL 314

Query: 194 LRKGYGICHGTAGNGYSFLSLYRLTQDKKYLYRACKFAEWCLEYGAHGCRIPDRPYSLFE 373
           L+KGYG+CHG+AGN Y+FL+LY LTQD KYLYRACKFAEWCLEYG HGCR PD P+SLFE
Sbjct: 315 LKKGYGLCHGSAGNAYAFLTLYNLTQDMKYLYRACKFAEWCLEYGEHGCRTPDTPFSLFE 374

Query: 374 GMAGAIHFLSDILAPETARFPAFEL 448
           GMAG I+FL+D+L P  ARFPAFEL
Sbjct: 375 GMAGTIYFLADLLVPTKARFPAFEL 399


>ref|NP_940913.1| LanC lantibiotic synthetase component C-like 3 [Homo sapiens]
          Length = 388

 Score =  108 bits (271), Expect = 5e-24
 Identities = 48/92 (52%), Positives = 63/92 (68%), Gaps = 3/92 (3%)
 Frame = +2

Query: 29  NYPSSLSNETDR---LVHWCHGAPGVIHTLMQAYKVFKEEKYLRDAVECSDVIWQRGLLR 199
           N+P  L    +R   LVHWCHGAPG+ +   +AY V K+ +YL   + C ++ WQ+GLL+
Sbjct: 275 NWPPELGETIERENELVHWCHGAPGIAYLFAKAYLVSKKPQYLDTCIRCGELTWQKGLLK 334

Query: 200 KGYGICHGTAGNGYSFLSLYRLTQDKKYLYRA 295
           KG GICHG AG+ Y FL LYRLT + KY+YRA
Sbjct: 335 KGPGICHGVAGSAYVFLLLYRLTGNSKYIYRA 366


  Database: RefSeqHP
    Posted date:  Aug 2, 2006 12:57 AM
  Number of letters in database: 17,774,539
  Number of sequences in database:  39,411
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 42,047,170
Number of Sequences: 39411
Number of extensions: 1167173
Number of successful extensions: 4511
Number of sequences better than 1.0e-05: 3
Number of HSP's better than  0.0 without gapping: 3781
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4484
length of database: 17,774,539
effective HSP length: 102
effective length of database: 13,754,617
effective search space used: 3136052676
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqMP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611C-003258
         (993 letters)

Database: RefSeqMP 
           45,328 sequences; 21,768,885 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_598498.1| LanC (bacterial lantibiotic synthetase componen...   310   1e-84
Alignment   gi|NP_067270.1| LanC (bacterial lantibiotic synthetase componen...   238   7e-63
Alignment   gi|NP_775590.1| LanC lantibiotic synthetase component C-like 3 ...   142   4e-34
Alignment   gi|XP_984245.1| PREDICTED: similar to LanC (bacterial lantibiot...    91   2e-18

>ref|NP_598498.1| LanC (bacterial lantibiotic synthetase component C)-like 2 [Mus
           musculus]
          Length = 450

 Score =  310 bits (795), Expect = 1e-84
 Identities = 139/155 (89%), Positives = 151/155 (97%)
 Frame = +2

Query: 2   MRHKRFRSGNYPSSLSNETDRLVHWCHGAPGVIHTLMQAYKVFKEEKYLRDAVECSDVIW 181
           +RHK+FRSGNYPSSLSNETDRLVHWCHGAPGVIH L+QAY+VFKEEKYL++A+ECSDVIW
Sbjct: 296 VRHKKFRSGNYPSSLSNETDRLVHWCHGAPGVIHVLLQAYQVFKEEKYLKEAMECSDVIW 355

Query: 182 QRGLLRKGYGICHGTAGNGYSFLSLYRLTQDKKYLYRACKFAEWCLEYGAHGCRIPDRPY 361
           QRGLLRKGYGICHGT+GNGYSFLSLYRLTQDKKYLYRACKFAEWCL+YGAHGCRIPDRPY
Sbjct: 356 QRGLLRKGYGICHGTSGNGYSFLSLYRLTQDKKYLYRACKFAEWCLDYGAHGCRIPDRPY 415

Query: 362 SLFEGMAGAIHFLSDILAPETARFPAFELGSSERD 466
           SLFEGMAGA+HFLSDIL PETARFPAFELG  ++D
Sbjct: 416 SLFEGMAGAVHFLSDILVPETARFPAFELGFLQKD 450


>ref|NP_067270.1| LanC (bacterial lantibiotic synthetase component C)-like 1 [Mus
           musculus]
          Length = 399

 Score =  238 bits (607), Expect = 7e-63
 Identities = 105/145 (72%), Positives = 122/145 (84%)
 Frame = +2

Query: 14  RFRSGNYPSSLSNETDRLVHWCHGAPGVIHTLMQAYKVFKEEKYLRDAVECSDVIWQRGL 193
           +F SGNYP  L +  D LVHWCHGAPGVI+ L+QAYKVFKEE+YL DA +C+DVIWQ GL
Sbjct: 255 KFPSGNYPPCLDDTRDLLVHWCHGAPGVIYMLIQAYKVFKEERYLCDAQQCADVIWQYGL 314

Query: 194 LRKGYGICHGTAGNGYSFLSLYRLTQDKKYLYRACKFAEWCLEYGAHGCRIPDRPYSLFE 373
           L+KGYG+CHG AGN Y+FL+LY LTQD KYLYRACKFAEWCL+YG HGCR  D P+SLFE
Sbjct: 315 LKKGYGLCHGAAGNAYAFLALYNLTQDLKYLYRACKFAEWCLDYGEHGCRTADTPFSLFE 374

Query: 374 GMAGAIHFLSDILAPETARFPAFEL 448
           GMAG I+FL+D+L P  A+FPAFEL
Sbjct: 375 GMAGTIYFLADLLVPTKAKFPAFEL 399


>ref|NP_775590.1| LanC lantibiotic synthetase component C-like 3 [Mus musculus]
          Length = 420

 Score =  142 bits (359), Expect = 4e-34
 Identities = 67/144 (46%), Positives = 93/144 (64%), Gaps = 4/144 (2%)
 Frame = +2

Query: 29  NYPSSLSNETDR---LVHWCHGAPGVIHTLMQAYKVFKEEKYLRDAVECSDVIWQRGLLR 199
           N+P  L    +R   LVHWCHGAPG+ +   +AY + K+ +YL   + C ++ WQ+GLL+
Sbjct: 275 NWPPELGETIERENELVHWCHGAPGIAYLFAKAYLISKKPQYLDTCIRCGELTWQKGLLK 334

Query: 200 KGYGICHGTAGNGYSFLSLYRLTQDKKYLYRACKFAEWCL-EYGAHGCRIPDRPYSLFEG 376
           KG GICHG AG+ Y FL LYRLT + KY+YRA +FA++   E    G R+ +  YSL+EG
Sbjct: 335 KGPGICHGVAGSAYVFLLLYRLTGNSKYIYRAQRFAQFLFTEEFKSGSRVLESIYSLYEG 394

Query: 377 MAGAIHFLSDILAPETARFPAFEL 448
            +G + FL D+L P  A FP F +
Sbjct: 395 FSGTVCFLIDLLQPNQAEFPLFSV 418


>ref|XP_984245.1| PREDICTED: similar to LanC (bacterial lantibiotic synthetase
           component C)-like 2 [Mus musculus]
          Length = 390

 Score = 90.5 bits (223), Expect = 2e-18
 Identities = 60/155 (38%), Positives = 69/155 (44%)
 Frame = +2

Query: 2   MRHKRFRSGNYPSSLSNETDRLVHWCHGAPGVIHTLMQAYKVFKEEKYLRDAVECSDVIW 181
           +RHK+FRSGNYPSSLSNETDRLVHW                                   
Sbjct: 296 VRHKKFRSGNYPSSLSNETDRLVHW----------------------------------- 320

Query: 182 QRGLLRKGYGICHGTAGNGYSFLSLYRLTQDKKYLYRACKFAEWCLEYGAHGCRIPDRPY 361
                      CHG  G  +  L  Y+   +   LY                C +P R  
Sbjct: 321 -----------CHGAPGVIHVLLQAYQRL-NITLLYSIT-------------CVVPKRCT 355

Query: 362 SLFEGMAGAIHFLSDILAPETARFPAFELGSSERD 466
             F GMAGA+HFLSDIL PETARFPAFELG  ++D
Sbjct: 356 FCFAGMAGAVHFLSDILVPETARFPAFELGFLQKD 390


  Database: RefSeqMP
    Posted date:  Aug 2, 2006 12:58 AM
  Number of letters in database: 21,768,885
  Number of sequences in database:  45,328
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 49,571,326
Number of Sequences: 45328
Number of extensions: 1328830
Number of successful extensions: 5233
Number of sequences better than 1.0e-05: 4
Number of HSP's better than  0.0 without gapping: 4364
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5194
length of database: 21,768,885
effective HSP length: 104
effective length of database: 17,054,773
effective search space used: 3854378698
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)