Animal-Genome cDNA 20060611C-003420


Search to RefSeqSP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611C-003420
         (1560 letters)

Database: RefSeqSP 
           1040 sequences; 434,620 total letters

Searching...done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_999238.1| 20-beta-hydroxysteroid dehydrogenase [Sus scrofa]     59   3e-10
Alignment   gi|NP_999078.1| hydroxysteroid 11-beta dehydrogenase 2 [Sus scr...    52   3e-08
Alignment   gi|NP_998992.1| carbonyl reductase [Sus scrofa]                       50   2e-07
Alignment   gi|NP_999413.1| 11-beta hydroxysteroid dehydrogenase isoform 1 ...    46   3e-06

>ref|NP_999238.1| 20-beta-hydroxysteroid dehydrogenase [Sus scrofa]
          Length = 289

 Score = 58.9 bits (141), Expect = 3e-10
 Identities = 68/273 (24%), Positives = 117/273 (42%), Gaps = 35/273 (12%)
 Frame = +3

Query: 804  KTVIVTGANTGIGKQTALELAKR-GGNIILACRDLEKCEAAAKDIRGETLNHRVSARHLD 980
            +  +VTGAN GIG     +L ++  G+++L  RD+ + +AA K ++ E L+ R     LD
Sbjct: 6    RVALVTGANKGIGFAIVRDLCRQFAGDVVLTARDVARGQAAVKQLQAEGLSPRF--HQLD 63

Query: 981  LASLTSVREFAAKINEEEEHLHVLINNAAVMRCPHWTTEDGF--EMQLGVNYLGHFXXXX 1154
            +  L S+R     + +E   L VL+NNAA+       T      E+ +  N++G      
Sbjct: 64   IIDLQSIRALCDFLRKEYGGLDVLVNNAAIAFQLDNPTPFHIQAELTMKTNFMGTRNVCT 123

Query: 1155 XXXXXXKASAPSRIINLSSLAHV---------------AGHIDFDDLNWEKRKY--DTK- 1280
                  K     R++N+SS   V               +  I  ++L     K+  DTK 
Sbjct: 124  ELLPLIKPQ--GRVVNVSSTEGVRALNECSPELQQKFKSETITEEELVGLMNKFVEDTKN 181

Query: 1281 ----------AAYCQSKLALV----LFSMELSQRLQGTGVTVNALHPGVARTELGRHTGM 1418
                      + Y  +K+ +     +++ +L ++  G  + +NA  PG  RT++G     
Sbjct: 182  GVHRKEGWSDSTYGVTKIGVSVLSRIYARKLREQRAGDKILLNACCPGWVRTDMG----- 236

Query: 1419 HNSAFSSFTLGPIFWLLVKSPQLAAQPSTYLAV 1517
                      GP      KSP++ A+   YLA+
Sbjct: 237  ----------GP---KAPKSPEVGAETPVYLAL 256


>ref|NP_999078.1| hydroxysteroid 11-beta dehydrogenase 2 [Sus scrofa]
          Length = 400

 Score = 52.4 bits (124), Expect = 3e-08
 Identities = 56/214 (26%), Positives = 94/214 (43%), Gaps = 6/214 (2%)
 Frame = +3

Query: 774  ACPSKATIPGKTVIVTGANTGIGKQTALELAKRGGNIILACRDLEKCEAAAKDIRGETLN 953
            A P +  +  + V++TG ++G GK TA +L   G  ++    +L+     A+++R    +
Sbjct: 73   ARPQRLPVATRAVLITGCDSGFGKATAKKLDAMGFTVLATVLELD--SPGAQELRA-CCS 129

Query: 954  HRVSARHLDL---ASLTSVREFAAKINEEEEHLHVLINNAA---VMRCPHWTTEDGFEMQ 1115
             R+    +DL   A ++ V EF  K++     L  L+NNA    ++     +    +   
Sbjct: 130  PRLKLLQMDLTKPADISRVLEF-TKVHTASTGLWGLVNNAGHNILVADAELSPVATYRSC 188

Query: 1116 LGVNYLGHFXXXXXXXXXXKASAPSRIINLSSLAHVAGHIDFDDLNWEKRKYDTKAAYCQ 1295
            + VN+ G            + S+  RI+ +SS    AG + F  L          +AY  
Sbjct: 189  MEVNFFGTLEMTKALLPLLRRSS-GRIVTVSS---PAGDMPFPCL----------SAYGT 234

Query: 1296 SKLALVLFSMELSQRLQGTGVTVNALHPGVARTE 1397
            SK A+ L     S  LQ  GV V+ + P   RTE
Sbjct: 235  SKAAVALLMDSFSCELQPWGVKVSVIQPACFRTE 268


>ref|NP_998992.1| carbonyl reductase [Sus scrofa]
          Length = 244

 Score = 49.7 bits (117), Expect = 2e-07
 Identities = 47/205 (22%), Positives = 83/205 (40%), Gaps = 3/205 (1%)
 Frame = +3

Query: 801  GKTVIVTGANTGIGKQTALELAKRGGNIILACRDLEKCEAAAKDIRGETLNHRVSARHLD 980
            G   +VTGA  GIG+ T   L   G  ++   R      + +++  G      +    +D
Sbjct: 7    GLRALVTGAGKGIGRDTVKALHVSGARVVAVTRTNGDLVSLSQECPG------IEPVCVD 60

Query: 981  LASLTSVREFAAKINEEEEHLHVLINNAAVMRCPHW--TTEDGFEMQLGVNYLGHFXXXX 1154
            L    +       +   +    +L+NNAAV     +  TT++ F+    VN    F    
Sbjct: 61   LGDWEATERALGGVGPVD----LLVNNAAVALMQPFLDTTKEVFDRSFNVNLRSVFQVSQ 116

Query: 1155 XXXXXX-KASAPSRIINLSSLAHVAGHIDFDDLNWEKRKYDTKAAYCQSKLALVLFSMEL 1331
                   +   P  I+N+SS+     H+ +  L          AAY  +K A+ + +  +
Sbjct: 117  IVARSMIERGVPGSIVNVSSMV---SHVTYPGL----------AAYSSTKGAMTMLTKSM 163

Query: 1332 SQRLQGTGVTVNALHPGVARTELGR 1406
            +  L    + VN+++P V  T +GR
Sbjct: 164  AMELGPHKIRVNSVNPTVVLTAMGR 188


>ref|NP_999413.1| 11-beta hydroxysteroid dehydrogenase isoform 1 [Sus scrofa]
          Length = 292

 Score = 45.8 bits (107), Expect = 3e-06
 Identities = 54/231 (23%), Positives = 88/231 (38%), Gaps = 5/231 (2%)
 Frame = +3

Query: 690  MNRYILPLSVLGTAVGGAVLLKDFVAGGACPSKATIPGKTVIVTGANTGIGKQTALELAK 869
            M +Y+LP+        G  L   + +         + GK VIVTGA+ GIG++ A  LA+
Sbjct: 4    MKKYLLPIL-------GIFLAYYYYSANEEFRPEMLRGKKVIVTGASKGIGREMAYHLAR 56

Query: 870  RGGNIILACRDLEKCEAAAKDIRGETLNHRVSARHL---DLASLTSVREFAAKINEEEEH 1040
             G ++++  R     E   K +   +L    S+ H     +  +T   +F AK  +    
Sbjct: 57   MGAHVVVTARS----EETLKKVVSHSLELGASSAHYVAGTMEDMTFAEQFVAKAGKLLGG 112

Query: 1041 LHVLINNAAVMRCPHWTTED--GFEMQLGVNYLGHFXXXXXXXXXXKASAPSRIINLSSL 1214
            L +LI N           +D       + VN+L +           K S  S ++  S  
Sbjct: 113  LDMLILNHITQAFMTSVYDDIHLVRRSMEVNFLSYVVLSVAALPMLKQSNGSIVVVSSQA 172

Query: 1215 AHVAGHIDFDDLNWEKRKYDTKAAYCQSKLALVLFSMELSQRLQGTGVTVN 1367
              +A  +               A Y  SK AL  F   +++    T V V+
Sbjct: 173  GKMANPL--------------VAPYSASKFALDGFFSSITKEYSVTKVNVS 209


  Database: RefSeqSP
    Posted date:  Aug 1, 2006  7:14 PM
  Number of letters in database: 434,620
  Number of sequences in database:  1040
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,547,827
Number of Sequences: 1040
Number of extensions: 43730
Number of successful extensions: 158
Number of sequences better than 1.0e-05: 4
Number of HSP's better than  0.0 without gapping: 121
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 154
length of database: 434,620
effective HSP length: 81
effective length of database: 350,380
effective search space used: 153466440
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqBP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611C-003420
         (1560 letters)

Database: RefSeqBP 
           33,508 sequences; 16,112,626 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|XP_584629.2| PREDICTED: similar to Retinol dehydrogenase 13,...   284   2e-76
Alignment   gi|NP_899207.1| double substrate-specificity short chain dehydr...   241   9e-64
Alignment   gi|XP_584810.2| PREDICTED: similar to retinol dehydrogenase 13 ...   241   9e-64
Alignment   gi|XP_582319.2| PREDICTED: similar to retinol dehydrogenase 14 ...   225   7e-59
Alignment   gi|XP_870721.1| PREDICTED: similar to Retinol dehydrogenase 11 ...   205   9e-53
Alignment   gi|XP_582373.2| PREDICTED: similar to Retinol dehydrogenase 11 ...   199   5e-51
Alignment   gi|XP_592820.2| PREDICTED: similar to retinol dehydrogenase 11 ...   195   7e-50
Alignment   gi|XP_584642.2| PREDICTED: similar to retinol dehydrogenase 11 ...   174   2e-43
Alignment   gi|XP_591168.2| PREDICTED: similar to dehydrogenase/reductase (...   129   8e-30
Alignment   gi|XP_583859.2| PREDICTED: similar to short chain dehydrogenase...   107   3e-23

>ref|XP_584629.2| PREDICTED: similar to Retinol dehydrogenase 13, partial [Bos taurus]
          Length = 148

 Score =  284 bits (726), Expect = 2e-76
 Identities = 137/148 (92%), Positives = 146/148 (98%)
 Frame = +3

Query: 690  MNRYILPLSVLGTAVGGAVLLKDFVAGGACPSKATIPGKTVIVTGANTGIGKQTALELAK 869
            M+RY+LPLSVLGTAVGGAVLLKDFVAGGACPSKATIPGKTVIVTGANTGIGKQTALELAK
Sbjct: 1    MSRYVLPLSVLGTAVGGAVLLKDFVAGGACPSKATIPGKTVIVTGANTGIGKQTALELAK 60

Query: 870  RGGNIILACRDLEKCEAAAKDIRGETLNHRVSARHLDLASLTSVREFAAKINEEEEHLHV 1049
            RGGNIILACRD+EKCEAAAK+IRGETLNHRV+ARHLDLASL S+REFAAK+ EEEEH+H+
Sbjct: 61   RGGNIILACRDMEKCEAAAKEIRGETLNHRVNARHLDLASLKSIREFAAKVTEEEEHVHI 120

Query: 1050 LINNAAVMRCPHWTTEDGFEMQLGVNYL 1133
            LINNAAVMRCPHWTTEDGFEMQLGVNYL
Sbjct: 121  LINNAAVMRCPHWTTEDGFEMQLGVNYL 148


>ref|NP_899207.1| double substrate-specificity short chain dehydrogenase/reductase 2
            [Bos taurus]
          Length = 316

 Score =  241 bits (616), Expect = 9e-64
 Identities = 131/268 (48%), Positives = 174/268 (64%)
 Frame = +3

Query: 750  LKDFVAGGACPSKATIPGKTVIVTGANTGIGKQTALELAKRGGNIILACRDLEKCEAAAK 929
            ++ F AGG C +   + GK V++TGANTGIGK+TA ELA+RG  + +ACRD+ K E+AA 
Sbjct: 22   IRKFFAGGVCRTDVQLFGKVVVITGANTGIGKETARELARRGARVYIACRDVLKGESAAS 81

Query: 930  DIRGETLNHRVSARHLDLASLTSVREFAAKINEEEEHLHVLINNAAVMRCPHWTTEDGFE 1109
            +I+ +T N +V  R LDL+   S+R FA     EE+ LH+LINNA VM CP+  T DGFE
Sbjct: 82   EIQADTKNSQVLVRKLDLSDTKSIRAFAEGFLAEEKQLHILINNAGVMLCPYSKTADGFE 141

Query: 1110 MQLGVNYLGHFXXXXXXXXXXKASAPSRIINLSSLAHVAGHIDFDDLNWEKRKYDTKAAY 1289
              L VN+LGHF          K SAP+R++NLSS+AH  G I F DL  +K  Y+   AY
Sbjct: 142  THLAVNHLGHFLLTHLLLGRLKESAPARVVNLSSVAHHLGKIRFHDLQGDK-YYNLGFAY 200

Query: 1290 CQSKLALVLFSMELSQRLQGTGVTVNALHPGVARTELGRHTGMHNSAFSSFTLGPIFWLL 1469
            C SKLA VLF+ EL++RL+GTGVT  A+HPG+ R++L RH      +F    L  +F   
Sbjct: 201  CHSKLANVLFTRELAKRLKGTGVTTYAVHPGIVRSKLVRH------SFLLCLLWRLFSPF 254

Query: 1470 VKSPQLAAQPSTYLAVAEELESVSGKYF 1553
            +K+    AQ S + A+AE LE +SGKYF
Sbjct: 255  LKTTWEGAQTSLHCALAEGLEPLSGKYF 282


>ref|XP_584810.2| PREDICTED: similar to retinol dehydrogenase 13 (all-trans and 9-cis)
            [Bos taurus]
          Length = 223

 Score =  241 bits (616), Expect = 9e-64
 Identities = 119/141 (84%), Positives = 127/141 (90%)
 Frame = +3

Query: 1134 GHFXXXXXXXXXXKASAPSRIINLSSLAHVAGHIDFDDLNWEKRKYDTKAAYCQSKLALV 1313
            GHF          KASAPSRIIN+SSLAHVAGHIDF+DLNWEKRKYDTKAAYCQSKLA+V
Sbjct: 37   GHFLLTNLLLDKLKASAPSRIINVSSLAHVAGHIDFEDLNWEKRKYDTKAAYCQSKLAVV 96

Query: 1314 LFSMELSQRLQGTGVTVNALHPGVARTELGRHTGMHNSAFSSFTLGPIFWLLVKSPQLAA 1493
            + + ELS+RLQGTGVTVNALHPGVARTELGRHTGMH+SAFSSFTLGPIFWLLVKSP+LAA
Sbjct: 97   VSTKELSRRLQGTGVTVNALHPGVARTELGRHTGMHSSAFSSFTLGPIFWLLVKSPELAA 156

Query: 1494 QPSTYLAVAEELESVSGKYFD 1556
            QPS YLAVAEELE VSGKYFD
Sbjct: 157  QPSVYLAVAEELEGVSGKYFD 177


>ref|XP_582319.2| PREDICTED: similar to retinol dehydrogenase 14 (all-trans and 9-cis)
            [Bos taurus]
          Length = 420

 Score =  225 bits (574), Expect = 7e-59
 Identities = 123/264 (46%), Positives = 165/264 (62%), Gaps = 13/264 (4%)
 Frame = +3

Query: 801  GKTVIVTGANTGIGKQTALELAKRGGNIILACRDLEKCEAAAKDIRGETLNH-------- 956
            GKTV++TGAN+G+G+ TA EL + G  +I+ CRD E+ E AA  +R E            
Sbjct: 127  GKTVLITGANSGLGRATAAELLRLGARVIMGCRDRERAEEAAGQLRREVCPAGGPDSGPN 186

Query: 957  -----RVSARHLDLASLTSVREFAAKINEEEEHLHVLINNAAVMRCPHWTTEDGFEMQLG 1121
                  +  + LDLASL+SVR F  ++ +EE  L VLINNA V +CP+  TEDGFEMQ G
Sbjct: 187  SGGAGELVVKELDLASLSSVRSFCQEMLQEEPRLDVLINNAGVFQCPYMKTEDGFEMQFG 246

Query: 1122 VNYLGHFXXXXXXXXXXKASAPSRIINLSSLAHVAGHIDFDDLNWEKRKYDTKAAYCQSK 1301
            VN+LGHF          K+SAPSRI+ +SS  +  G I+F+DLN E + Y+    Y +SK
Sbjct: 247  VNHLGHFLLTNLLLGLLKSSAPSRIVVVSSKLYKYGDINFEDLNSE-QSYNKSFCYSRSK 305

Query: 1302 LALVLFSMELSQRLQGTGVTVNALHPGVARTELGRHTGMHNSAFSSFTLGPIFWLLVKSP 1481
            LA +LF+ EL++RL+GT VTVN LHPG+ RT LGRH  +       F L  + W   K+P
Sbjct: 306  LANILFTRELARRLEGTSVTVNVLHPGIVRTNLGRHIHIPLLVRPLFNL--VSWAFFKTP 363

Query: 1482 QLAAQPSTYLAVAEELESVSGKYF 1553
            +  AQ + YLA + E+E VSG+YF
Sbjct: 364  EEGAQTAVYLASSPEVEGVSGRYF 387


>ref|XP_870721.1| PREDICTED: similar to Retinol dehydrogenase 11 (Retinal reductase 1)
            (RalR1) (Prostate short-chain dehydrogenase/reductase 1)
            (Androgen-regulated short-chain dehydrogenase/reductase
            1) (HCV core-binding protein HCBP12) isoform 2 [Bos
            taurus]
          Length = 314

 Score =  205 bits (521), Expect = 9e-53
 Identities = 110/264 (41%), Positives = 160/264 (60%)
 Frame = +3

Query: 762  VAGGACPSKATIPGKTVIVTGANTGIGKQTALELAKRGGNIILACRDLEKCEAAAKDIRG 941
            ++ G C S   +PGK  +VTGAN GIGK+TA ELA+RG  + LACRD++  E  A++I+ 
Sbjct: 2    LSSGVCTSTIQLPGKVAVVTGANAGIGKETAKELARRGARVYLACRDVQNGELVAREIQM 61

Query: 942  ETLNHRVSARHLDLASLTSVREFAAKINEEEEHLHVLINNAAVMRCPHWTTEDGFEMQLG 1121
             T N +V  R LDLA   S+R FA +  E+ +++H++ ++   + C    +  G +    
Sbjct: 62   MTGNQQVLVRKLDLADTKSIRAFAKRFLEDHKYIHLINSSPHFLICGFPGSSAGKDSACN 121

Query: 1122 VNYLGHFXXXXXXXXXXKASAPSRIINLSSLAHVAGHIDFDDLNWEKRKYDTKAAYCQSK 1301
              YLGHF          + SAPSR++N+SSLAH+ G I F +L  EK  Y +  AYC SK
Sbjct: 122  TGYLGHFLLTHLLLEKLEESAPSRVVNVSSLAHLLGRIHFHNLQGEK-FYQSGLAYCHSK 180

Query: 1302 LALVLFSMELSQRLQGTGVTVNALHPGVARTELGRHTGMHNSAFSSFTLGPIFWLLVKSP 1481
            LA +LF+ EL++RL+G+GVTV ++HPG   +EL RH+ +         +  IF   +K+P
Sbjct: 181  LANILFTQELARRLKGSGVTVYSVHPGTVNSELVRHSALMR------WIWWIFSFFIKTP 234

Query: 1482 QLAAQPSTYLAVAEELESVSGKYF 1553
            Q  AQ S Y A+ E LE +SG +F
Sbjct: 235  QQGAQTSLYCALTEGLEVLSGNHF 258


>ref|XP_582373.2| PREDICTED: similar to Retinol dehydrogenase 11 (Retinal reductase 1)
            (RalR1) (Prostate short-chain dehydrogenase/reductase 1)
            (Androgen-regulated short-chain dehydrogenase/reductase
            1) (HCV core-binding protein HCBP12) isoform 1 [Bos
            taurus]
          Length = 308

 Score =  199 bits (506), Expect = 5e-51
 Identities = 112/264 (42%), Positives = 158/264 (59%)
 Frame = +3

Query: 762  VAGGACPSKATIPGKTVIVTGANTGIGKQTALELAKRGGNIILACRDLEKCEAAAKDIRG 941
            ++ G C S   +PGK  +VTGAN GIGK+TA ELA+RG  + LACRD++  E  A++I+ 
Sbjct: 2    LSSGVCTSTIQLPGKVAVVTGANAGIGKETAKELARRGARVYLACRDVQNGELVAREIQM 61

Query: 942  ETLNHRVSARHLDLASLTSVREFAAKINEEEEHLHVLINNAAVMRCPHWTTEDGFEMQLG 1121
             T N +V  R LDLA   S+R FA +  E+ +++H LIN+          +  G +    
Sbjct: 62   MTGNQQVLVRKLDLADTKSIRAFAKRFLEDHKYIH-LINSVGFP-----GSSAGKDSACN 115

Query: 1122 VNYLGHFXXXXXXXXXXKASAPSRIINLSSLAHVAGHIDFDDLNWEKRKYDTKAAYCQSK 1301
              YLGHF          + SAPSR++N+SSLAH+ G I F +L  EK  Y +  AYC SK
Sbjct: 116  TGYLGHFLLTHLLLEKLEESAPSRVVNVSSLAHLLGRIHFHNLQGEK-FYQSGLAYCHSK 174

Query: 1302 LALVLFSMELSQRLQGTGVTVNALHPGVARTELGRHTGMHNSAFSSFTLGPIFWLLVKSP 1481
            LA +LF+ EL++RL+G+GVTV ++HPG   +EL RH+ +         +  IF   +K+P
Sbjct: 175  LANILFTQELARRLKGSGVTVYSVHPGTVNSELVRHSALMR------WIWWIFSFFIKTP 228

Query: 1482 QLAAQPSTYLAVAEELESVSGKYF 1553
            Q  AQ S Y A+ E LE +SG +F
Sbjct: 229  QQGAQTSLYCALTEGLEVLSGNHF 252


>ref|XP_592820.2| PREDICTED: similar to retinol dehydrogenase 11 (predicted) [Bos
            taurus]
          Length = 377

 Score =  195 bits (496), Expect = 7e-50
 Identities = 119/284 (41%), Positives = 165/284 (58%), Gaps = 6/284 (2%)
 Frame = +3

Query: 720  LGTAVGGAVLLK-DFVAGGACPSKATIPGKTVIVTGANTGIGKQTALELAKRGGNIILAC 896
            +G  +G  VL+  + V    C   A++ G+T +VTGAN+GIGK TALELA+RG  ++LAC
Sbjct: 8    VGLLLGAYVLVYYNLVKAPPCRGLASLRGRTAVVTGANSGIGKMTALELARRGARVVLAC 67

Query: 897  RDLEKCEAAAKDIRGETLNHRVSARHLDLASLTSVREFAAKINEEEEHLHVLINNAAVMR 1076
            R  E+ EAAA D+R E+ N+ V    LDLASL SVR FA      E  L +LI+NA +  
Sbjct: 68   RSRERGEAAAFDLRQESGNNEVIFMALDLASLASVRAFATAFLSSEPRLDILIHNAGISS 127

Query: 1077 CPHWTTEDGFEMQLGVNYLGHFXXXXXXXXXXKASAPSRIINLSSLAHVAGHIDFDDLN- 1253
            C    T + F + L VN++G F          K SAPSR++ +SS AH  G +DF  L+ 
Sbjct: 128  CGR--TREPFNLLLRVNHIGPFLLTHLLLPRLKTSAPSRVVVVSSAAHRRGRLDFTRLDH 185

Query: 1254 ----WEKRKYDTKAAYCQSKLALVLFSMELSQRLQGTGVTVNALHPGVARTELGRHTGMH 1421
                W++       AY  SKLA VLF+ EL+ +L+GTGVT  A HPG   +EL      H
Sbjct: 186  PVVGWQQE----LRAYANSKLANVLFARELATQLEGTGVTCYAAHPGPVNSELFLR---H 238

Query: 1422 NSAFSSFTLGPIFWLLVKSPQLAAQPSTYLAVAEELESVSGKYF 1553
               +    L P+ WL++++P+  AQ   Y A+ E +E +SG+YF
Sbjct: 239  VPGWLRPLLRPLAWLVLRAPRGGAQTPLYCALQEGIEPLSGRYF 282


>ref|XP_584642.2| PREDICTED: similar to retinol dehydrogenase 11 (predicted) [Bos
            taurus]
          Length = 330

 Score =  174 bits (440), Expect = 2e-43
 Identities = 98/256 (38%), Positives = 149/256 (58%), Gaps = 3/256 (1%)
 Frame = +3

Query: 795  IPGKTVIVTGANTGIGKQTALELAKRGGNIILACRDLEKCEAAAKDIRGETLNHRVSARH 974
            + GKT +VTGAN+GIGK  + ELA RG  +ILACR  E+ + A  +I+  + ++R+    
Sbjct: 47   LTGKTAVVTGANSGIGKAVSQELAHRGARVILACRSRERGQQALAEIQATSKSNRLLLGE 106

Query: 975  LDLASLTSVREFAAKINEEEEHLHVLINNAAVMRCPHWTTEDGFEMQLGVNYLGHFXXXX 1154
            +DL+S+ S+R FA ++ +E   +H+L+NNAAV   P   T +G ++    NY G F    
Sbjct: 107  VDLSSMASIRSFAQRLLQECPEIHLLVNNAAVCGFPTTLTPEGLDLTFATNYTGPFLLTN 166

Query: 1155 XXXXXXKASAPSRIINLSSLAHVAGHIDFDDLNWEKRKYDTKAAYCQSKLALVLFSMELS 1334
                  + +  +R++N+SS     G+ID D L    R       Y  SKL L  F+ +L+
Sbjct: 167  LLQGALQRAGSARVVNVSSFRQSHGYIDEDHLIGAGRPLTFNQNYDCSKLLLASFTGKLA 226

Query: 1335 QRLQGTGVTVNALHPGVARTELGRHTGMHNSAFSSFTLGPIFWLL---VKSPQLAAQPST 1505
            QRLQGTGVTVN++ PGV  T++ +H         S++   +FWLL    K  +  A P  
Sbjct: 227  QRLQGTGVTVNSVDPGVVYTKIMKH--------FSWSYRFLFWLLSFFFKDSKQGAVPVL 278

Query: 1506 YLAVAEELESVSGKYF 1553
            YL++A+EL+ +SGK+F
Sbjct: 279  YLSLAKELDGISGKHF 294


>ref|XP_591168.2| PREDICTED: similar to dehydrogenase/reductase (SDR family) X-linked
            [Bos taurus]
          Length = 251

 Score =  129 bits (323), Expect = 8e-30
 Identities = 83/199 (41%), Positives = 105/199 (52%), Gaps = 6/199 (3%)
 Frame = +3

Query: 972  HLDLASLTSVREFAAKINEEEEHLHVLINNAAVMRCPHWTTEDGFEMQLGVNYLGHFXXX 1151
            + DLAS+ S+REF      ++  LHVL+NNA VM  P  TTEDGFE   GVNYLGHF   
Sbjct: 9    YCDLASMRSIREFVQTFKMKKLPLHVLVNNAGVMMVPQRTTEDGFEEHFGVNYLGHFLLT 68

Query: 1152 XXXXXXXKAS-AP---SRIINLSSLAHVAGHIDFDDLNWEKRKYDTKAAYCQSKLALVLF 1319
                   + S AP   +R++ +SS  H  G ++ DDL      Y   AAY QSKLALVLF
Sbjct: 69   NLLLDTLQESGAPGHSARVVTVSSATHYVGELNLDDLQ-SSTYYSAHAAYAQSKLALVLF 127

Query: 1320 SMELSQRL--QGTGVTVNALHPGVARTELGRHTGMHNSAFSSFTLGPIFWLLVKSPQLAA 1493
            +  L   L  QG  VT +   PGV  T+L R+     +      LG   W + K+P   A
Sbjct: 128  TYHLQALLTAQGMPVTASVADPGVVDTDLYRYV-FWGTRLVKKLLG---WWVFKTPDEGA 183

Query: 1494 QPSTYLAVAEELESVSGKY 1550
              S Y AV   LE + G+Y
Sbjct: 184  WTSVYAAVTPALEGLGGRY 202


>ref|XP_583859.2| PREDICTED: similar to short chain dehydrogenase/reductase [Bos
            taurus]
          Length = 317

 Score =  107 bits (266), Expect = 3e-23
 Identities = 81/257 (31%), Positives = 121/257 (47%), Gaps = 7/257 (2%)
 Frame = +3

Query: 753  KDFVAGGACPSKATIPGKTVIVTGANTGIGKQTALELAKRGGNIILACRDLEKCEAAAKD 932
            KDFV       +  +PG+  +VTG N+GIGK TA+E+AKRGG + L CRD  + E A  +
Sbjct: 27   KDFVPDDL---EVQVPGRAFMVTGGNSGIGKATAMEIAKRGGTVHLVCRDHSRAEGAKAE 83

Query: 933  IRGETLNHRVSARHLDLASLTSVREFAAKINEEEEHLHVLINNAAVMRCPHWTTEDGFEM 1112
            I  E+ N  +    +DL+   SV +F     ++E  L+VLINNA  M      TEDG E 
Sbjct: 84   IIRESGNQNIFLHIVDLSLPKSVWKFVENF-KQEHTLNVLINNAGCMVNKRELTEDGLEK 142

Query: 1113 QLGVNYLGHFXXXXXXXXXXKASAPSRIINLSSLAHVAGHIDFDDLNWEKRKYDTKAAYC 1292
                N LG +          +     R+I +SS   +   ++ DD   E+  +D    Y 
Sbjct: 143  NFATNTLGVYVLTTALIPVLEKEHDPRVITVSSGGMLVQKLNTDDPQSERTAFDGTMVYA 202

Query: 1293 QSKLALVLFSMELSQRLQGTGVTVNALHPGVARTELGRHT--GMH---NSAFSSFTLG-- 1451
            Q+K   V+ +   ++      +  + +HPG   T   R +  G H    +   S   G  
Sbjct: 203  QNKRQQVVLTERWAR--AHPAIHFSCMHPGWVDTPGVRLSMPGFHARLGARLRSEAQGAD 260

Query: 1452 PIFWLLVKSPQLAAQPS 1502
             + WL + +P   AQPS
Sbjct: 261  TVLWLAL-APAATAQPS 276


  Database: RefSeqBP
    Posted date:  Aug 1, 2006  7:14 PM
  Number of letters in database: 16,112,626
  Number of sequences in database:  33,508
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 59,487,959
Number of Sequences: 33508
Number of extensions: 1811941
Number of successful extensions: 8420
Number of sequences better than 1.0e-05: 10
Number of HSP's better than  0.0 without gapping: 6187
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 8321
length of database: 16,112,626
effective HSP length: 106
effective length of database: 12,560,778
effective search space used: 5187601314
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqCP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611C-003420
         (1560 letters)

Database: RefSeqCP 
           33,732 sequences; 19,266,565 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|XP_854127.1| PREDICTED: similar to Retinol dehydrogenase 13 ...   520   e-147
Alignment   gi|XP_547866.2| PREDICTED: similar to retinol dehydrogenase 12 ...   257   2e-68
Alignment   gi|XP_854354.1| PREDICTED: similar to Retinol dehydrogenase 11 ...   247   3e-65
Alignment   gi|XP_540096.2| PREDICTED: similar to retinol dehydrogenase 14 ...   221   2e-57
Alignment   gi|XP_548293.2| PREDICTED: similar to retinol dehydrogenase 11 ...   192   8e-49
Alignment   gi|XP_852222.1| PREDICTED: similar to dehydrogenase/reductase (...   177   3e-44
Alignment   gi|XP_857582.1| PREDICTED: similar to retinol dehydrogenase 14 ...   169   9e-42
Alignment   gi|XP_533000.2| PREDICTED: similar to Retinol dehydrogenase 12 ...   166   6e-41
Alignment   gi|XP_852623.1| PREDICTED: similar to WW domain-containing oxid...   145   8e-35
Alignment   gi|XP_544970.2| PREDICTED: similar to dehydrogenase/reductase (...    67   6e-11

>ref|XP_854127.1| PREDICTED: similar to Retinol dehydrogenase 13 [Canis familiaris]
          Length = 334

 Score =  520 bits (1338), Expect = e-147
 Identities = 255/290 (87%), Positives = 273/290 (94%)
 Frame = +3

Query: 690  MNRYILPLSVLGTAVGGAVLLKDFVAGGACPSKATIPGKTVIVTGANTGIGKQTALELAK 869
            MNRY+LPLSVLGTAVGGAVLL+D++AGGACPSKATIPGKTVIVTGANTGIGKQTALELA+
Sbjct: 1    MNRYLLPLSVLGTAVGGAVLLRDYIAGGACPSKATIPGKTVIVTGANTGIGKQTALELAR 60

Query: 870  RGGNIILACRDLEKCEAAAKDIRGETLNHRVSARHLDLASLTSVREFAAKINEEEEHLHV 1049
            RGGNIILACRD+EKCEAAAK+IRGETLNHRVSA HLDLASL S+REFAAKI EEEE +H+
Sbjct: 61   RGGNIILACRDMEKCEAAAKEIRGETLNHRVSAWHLDLASLKSIREFAAKIIEEEEQVHI 120

Query: 1050 LINNAAVMRCPHWTTEDGFEMQLGVNYLGHFXXXXXXXXXXKASAPSRIINLSSLAHVAG 1229
            L+NNAAVMRCPHWTT+DGFEMQ GVN+LGHF          KASAPSRIINLSSLAHVAG
Sbjct: 121  LVNNAAVMRCPHWTTKDGFEMQFGVNHLGHFLLTNLLLDKLKASAPSRIINLSSLAHVAG 180

Query: 1230 HIDFDDLNWEKRKYDTKAAYCQSKLALVLFSMELSQRLQGTGVTVNALHPGVARTELGRH 1409
            HIDFDDLNWEKRKYDTKAAYCQSKLA++LF+ ELS+RLQGTGVTVNALHPGVARTELGRH
Sbjct: 181  HIDFDDLNWEKRKYDTKAAYCQSKLAVILFTKELSRRLQGTGVTVNALHPGVARTELGRH 240

Query: 1410 TGMHNSAFSSFTLGPIFWLLVKSPQLAAQPSTYLAVAEELESVSGKYFDG 1559
            TGMH+SAFSSFTLGPIFWLLVKSPQLAAQPSTYLAVAEELE VSGKYFDG
Sbjct: 241  TGMHSSAFSSFTLGPIFWLLVKSPQLAAQPSTYLAVAEELEGVSGKYFDG 290


>ref|XP_547866.2| PREDICTED: similar to retinol dehydrogenase 12 (all-trans and 9-cis)
            [Canis familiaris]
          Length = 303

 Score =  257 bits (657), Expect = 2e-68
 Identities = 140/267 (52%), Positives = 174/267 (65%)
 Frame = +3

Query: 753  KDFVAGGACPSKATIPGKTVIVTGANTGIGKQTALELAKRGGNIILACRDLEKCEAAAKD 932
            + F AGG C S   +PGK V++TGANTGIGK+TA ELA+RG  + +ACRD+ K E+AA +
Sbjct: 10   RKFFAGGVCRSNVQLPGKVVVITGANTGIGKETARELARRGARVYIACRDVLKGESAASE 69

Query: 933  IRGETLNHRVSARHLDLASLTSVREFAAKINEEEEHLHVLINNAAVMRCPHWTTEDGFEM 1112
            IR +T N +V  R LDL+   S+R FA     EE+ LH+LINNA VM CP+  T DGFE 
Sbjct: 70   IRADTKNSQVLVRKLDLSDTKSIRAFAEGFLAEEKQLHILINNAGVMMCPYSKTADGFET 129

Query: 1113 QLGVNYLGHFXXXXXXXXXXKASAPSRIINLSSLAHVAGHIDFDDLNWEKRKYDTKAAYC 1292
             LGVN+LGHF          K S P+R++NLSS+AH  G I F DL  EKR Y    AYC
Sbjct: 130  HLGVNHLGHFLLTHLLLERLKESTPARVVNLSSVAHHIGKIHFHDLQGEKR-YSRGFAYC 188

Query: 1293 QSKLALVLFSMELSQRLQGTGVTVNALHPGVARTELGRHTGMHNSAFSSFTLGPIFWLLV 1472
             SKLA +LF+ EL++RLQGTGVT  A+HPGV  +EL RH      +F    L  IF   V
Sbjct: 189  HSKLANMLFTRELAKRLQGTGVTTYAVHPGVVSSELVRH------SFLLCLLWRIFSPFV 242

Query: 1473 KSPQLAAQPSTYLAVAEELESVSGKYF 1553
            KS +  AQ S + A+AE LE +SGKYF
Sbjct: 243  KSAREGAQTSLHCALAEGLEPLSGKYF 269


>ref|XP_854354.1| PREDICTED: similar to Retinol dehydrogenase 11 (Retinal reductase 1)
            (RalR1) (Prostate short-chain dehydrogenase/reductase 1)
            (Androgen-regulated short-chain dehydrogenase/reductase
            1) (HCV core-binding protein HCBP12) [Canis familiaris]
          Length = 337

 Score =  247 bits (630), Expect = 3e-65
 Identities = 133/268 (49%), Positives = 174/268 (64%)
 Frame = +3

Query: 750  LKDFVAGGACPSKATIPGKTVIVTGANTGIGKQTALELAKRGGNIILACRDLEKCEAAAK 929
            L   ++ G C S   +PGK  +VTGANTGIGK+TA ELA+RG  + LACRD+ K E  A+
Sbjct: 43   LMKILSRGVCTSTVQLPGKVAVVTGANTGIGKETAKELAQRGARVYLACRDVLKGELVAR 102

Query: 930  DIRGETLNHRVSARHLDLASLTSVREFAAKINEEEEHLHVLINNAAVMRCPHWTTEDGFE 1109
            +I+  T N +V  R LDLA   S+R FA     EE+HLH+LINNA VM CP+  T DGFE
Sbjct: 103  EIQTMTGNKQVLVRKLDLADTKSIRAFAKGFLAEEKHLHILINNAGVMMCPYTKTVDGFE 162

Query: 1110 MQLGVNYLGHFXXXXXXXXXXKASAPSRIINLSSLAHVAGHIDFDDLNWEKRKYDTKAAY 1289
            M +GVN+LGHF          K SAPSRI+N+SSLAH  G I F DL  EK  Y++  AY
Sbjct: 163  MHMGVNHLGHFLLTHLLLEKLKESAPSRIVNVSSLAHHLGRIHFHDLQGEK-FYNSGLAY 221

Query: 1290 CQSKLALVLFSMELSQRLQGTGVTVNALHPGVARTELGRHTGMHNSAFSSFTLGPIFWLL 1469
            C SKLA +LF+ EL++RL+G+G+T  ++HPG  ++EL RH     S F  + +  +F   
Sbjct: 222  CHSKLANILFTQELARRLKGSGITAYSVHPGTVKSELVRH-----SPFMKW-MWWLFSFF 275

Query: 1470 VKSPQLAAQPSTYLAVAEELESVSGKYF 1553
            +K+PQ  AQ S Y A+ E LE +SG +F
Sbjct: 276  IKTPQQGAQTSLYCAITEGLEVLSGHHF 303


>ref|XP_540096.2| PREDICTED: similar to retinol dehydrogenase 14 (all-trans and 9-cis)
            isoform 1 [Canis familiaris]
          Length = 336

 Score =  221 bits (562), Expect = 2e-57
 Identities = 123/264 (46%), Positives = 160/264 (60%), Gaps = 13/264 (4%)
 Frame = +3

Query: 801  GKTVIVTGANTGIGKQTALELAKRGGNIILACRDLEKCEAAAKDIRGETLNH-------- 956
            GKTV++TGAN+G+G+ TA  L + G  +I+ CRD  + E AA  +R E            
Sbjct: 43   GKTVLITGANSGLGRATAAALLRLGARVIMGCRDRARAEEAAGQLRRELRQAGGREPGSD 102

Query: 957  -----RVSARHLDLASLTSVREFAAKINEEEEHLHVLINNAAVMRCPHWTTEDGFEMQLG 1121
                  +  R LDLASL SVR F  ++ +EE  L VLINNA + +CP+  TEDGFEMQ G
Sbjct: 103  VGAAGELVVRELDLASLRSVRAFCQEVLQEEPRLDVLINNAGIFQCPYMKTEDGFEMQFG 162

Query: 1122 VNYLGHFXXXXXXXXXXKASAPSRIINLSSLAHVAGHIDFDDLNWEKRKYDTKAAYCQSK 1301
            VN+LGHF          K SAPSRI+ +SS  +  G I+F+DLN E + Y+    Y +SK
Sbjct: 163  VNHLGHFLLTNLLLGLLKNSAPSRIVVVSSKLYKYGDINFEDLNSE-QSYNKSFCYSRSK 221

Query: 1302 LALVLFSMELSQRLQGTGVTVNALHPGVARTELGRHTGMHNSAFSSFTLGPIFWLLVKSP 1481
            LA +LF+ EL++RL+GT VTVN LHPG+ RT LGRH  +       F L  + W   K+P
Sbjct: 222  LANILFTRELARRLEGTNVTVNVLHPGIVRTNLGRHIHIPLLVRPLFNL--VSWAFFKTP 279

Query: 1482 QLAAQPSTYLAVAEELESVSGKYF 1553
               AQ S YLA + E+E VSGKYF
Sbjct: 280  VEGAQTSVYLASSPEVEGVSGKYF 303


>ref|XP_548293.2| PREDICTED: similar to retinol dehydrogenase 11 (predicted) [Canis
            familiaris]
          Length = 377

 Score =  192 bits (488), Expect = 8e-49
 Identities = 118/283 (41%), Positives = 162/283 (57%), Gaps = 6/283 (2%)
 Frame = +3

Query: 723  GTAVGGAVLLK-DFVAGGACPSKATIPGKTVIVTGANTGIGKQTALELAKRGGNIILACR 899
            G  +G  VL+  + V    C   A++ G+T +VTGAN+GIGK TALELA+RG  ++LACR
Sbjct: 9    GLLLGAYVLIYYNLVKAPPCGGIASLRGRTAVVTGANSGIGKMTALELARRGARVVLACR 68

Query: 900  DLEKCEAAAKDIRGETLNHRVSARHLDLASLTSVREFAAKINEEEEHLHVLINNAAVMRC 1079
              E+ EAAA D+R E+ N+ V    LDLASL SVR FA      E  L +LI+NA +  C
Sbjct: 69   SRERGEAAAFDLRQESGNNEVIFMALDLASLASVRAFATAFLSSEPRLDILIHNAGISSC 128

Query: 1080 PHWTTEDGFEMQLGVNYLGHFXXXXXXXXXXKASAPSRIINLSSLAHVAGHIDFDDLN-- 1253
                T   F + L VN++G F          K  APSR++ +SS AH  G +DF  L+  
Sbjct: 129  GR--THKPFNLLLRVNHIGPFLLTHLLLPRLKTCAPSRVVVVSSAAHRRGRLDFTRLDRP 186

Query: 1254 ---WEKRKYDTKAAYCQSKLALVLFSMELSQRLQGTGVTVNALHPGVARTELGRHTGMHN 1424
               W++       AY  SKLA VLF+ EL+ +L+GTGVT  A HPG   +EL      H 
Sbjct: 187  VVGWQQE----LRAYADSKLANVLFARELATQLEGTGVTCYAAHPGPVNSELFLR---HV 239

Query: 1425 SAFSSFTLGPIFWLLVKSPQLAAQPSTYLAVAEELESVSGKYF 1553
              +    L P+ WL++++P+  AQ   Y A+ E +E +SG+YF
Sbjct: 240  PGWLCPLLRPLAWLMLRAPRGGAQTPLYCALQEGIEPLSGRYF 282


>ref|XP_852222.1| PREDICTED: similar to dehydrogenase/reductase (SDR family) X-linked
            [Canis familiaris]
          Length = 387

 Score =  177 bits (448), Expect = 3e-44
 Identities = 111/264 (42%), Positives = 144/264 (54%), Gaps = 7/264 (2%)
 Frame = +3

Query: 780  PSKATIPGKTVIVTGANTGIGKQTALELAKRGGNIILACRDLEKCEAAAKDIRGETLNHR 959
            P  A  P +  IVTG   GIG  TA  LA+ G ++ILA  +        + I+ ETLN +
Sbjct: 88   PFLAPQPERVAIVTGGTDGIGYSTAKHLARLGMHVILAGNNDSSAPDVVRKIQEETLNDK 147

Query: 960  VSARHLDLASLTSVREFAAKINEEEEHLHVLINNAAVMRCPHWTTEDGFEMQLGVNYLGH 1139
            V   + DLASL S+R+F  K  +++  LHVL+NNA VM  P  TTEDGFE   G+NYLGH
Sbjct: 148  VEFLYCDLASLRSIRQFVQKFKKKKIPLHVLVNNAGVMMVPERTTEDGFEEHFGLNYLGH 207

Query: 1140 FXXXXXXXXXXKAS-AP---SRIINLSSLAHVAGHIDFDDLNWEKRKYDTKAAYCQSKLA 1307
            F          K S AP   +R++ +SS  H  G +D DDL    R Y   AAY QSKLA
Sbjct: 208  FLLTNLLLDTLKESGAPGRCARVVTVSSATHYIGELDMDDLQ-GSRCYSPHAAYAQSKLA 266

Query: 1308 LVLFSMELSQRL--QGTGVTVNALHPGVARTELGRHTGMHNSAFSSFTLGPIF-WLLVKS 1478
            LVLF+  L + L  QG+ VT N + PGV  T L RH       + +  +  +F W   K+
Sbjct: 267  LVLFTYHLQRLLAAQGSPVTANVVDPGVVNTNLYRHV-----FWGTRLIKKLFGWWFFKT 321

Query: 1479 PQLAAQPSTYLAVAEELESVSGKY 1550
            P   A  S Y AV  +LE + G+Y
Sbjct: 322  PDEGAWTSVYAAVTPDLEGLGGRY 345


>ref|XP_857582.1| PREDICTED: similar to retinol dehydrogenase 14 (all-trans and 9-cis)
            isoform 4 [Canis familiaris]
          Length = 307

 Score =  169 bits (427), Expect = 9e-42
 Identities = 105/264 (39%), Positives = 139/264 (52%), Gaps = 13/264 (4%)
 Frame = +3

Query: 801  GKTVIVTGANTGIGKQTALELAKRGGNIILACRDLEKCEAAAKDIRGETLNH-------- 956
            GKTV++TGAN+G+G+ TA  L + G  +I+ CRD  + E AA  +R E            
Sbjct: 43   GKTVLITGANSGLGRATAAALLRLGARVIMGCRDRARAEEAAGQLRRELRQAGGREPGSD 102

Query: 957  -----RVSARHLDLASLTSVREFAAKINEEEEHLHVLINNAAVMRCPHWTTEDGFEMQLG 1121
                  +  R LDLASL SVR F  ++                             +Q G
Sbjct: 103  VGAAGELVVRELDLASLRSVRAFCQEV-----------------------------LQFG 133

Query: 1122 VNYLGHFXXXXXXXXXXKASAPSRIINLSSLAHVAGHIDFDDLNWEKRKYDTKAAYCQSK 1301
            VN+LGHF          K SAPSRI+ +SS  +  G I+F+DLN E+  Y+    Y +SK
Sbjct: 134  VNHLGHFLLTNLLLGLLKNSAPSRIVVVSSKLYKYGDINFEDLNSEQ-SYNKSFCYSRSK 192

Query: 1302 LALVLFSMELSQRLQGTGVTVNALHPGVARTELGRHTGMHNSAFSSFTLGPIFWLLVKSP 1481
            LA +LF+ EL++RL+GT VTVN LHPG+ RT LGRH  +       F L  + W   K+P
Sbjct: 193  LANILFTRELARRLEGTNVTVNVLHPGIVRTNLGRHIHIPLLVRPLFNL--VSWAFFKTP 250

Query: 1482 QLAAQPSTYLAVAEELESVSGKYF 1553
               AQ S YLA + E+E VSGKYF
Sbjct: 251  VEGAQTSVYLASSPEVEGVSGKYF 274


>ref|XP_533000.2| PREDICTED: similar to Retinol dehydrogenase 12 [Canis familiaris]
          Length = 596

 Score =  166 bits (420), Expect = 6e-41
 Identities = 93/254 (36%), Positives = 146/254 (57%), Gaps = 1/254 (0%)
 Frame = +3

Query: 795  IPGKTVIVTGANTGIGKQTALELAKRGGNIILACRDLEKCEAAAKDIRGETLNHRVSARH 974
            + GKT +VTGAN+GIGK    ELA+RG  +ILACR+ E+ + A  +I+  +    +    
Sbjct: 313  LTGKTAVVTGANSGIGKAVCQELARRGARVILACRNWERGQKALAEIQVASKGTCLLLGQ 372

Query: 975  LDLASLTSVREFAAKINEEEEHLHVLINNAAVMRCPHWTTEDGFEMQLGVNYLGHFXXXX 1154
            +DL+S+ S+R FA  + +E   +H+L+NNAA+   P   T +G ++    NY+G F    
Sbjct: 373  VDLSSMASIRSFARWLLQEYPEIHLLVNNAAISGFPKTLTPEGLDLTFATNYVGPFLLTN 432

Query: 1155 XXXXXXKASAPSRIINLSSLAHVAGHIDFDDLNWEKRKYDTKAAYCQSKLALVLFSMELS 1334
                  + +  +R++N+SS  H  G++D   L    +  +   +Y  SKL L  F+ EL+
Sbjct: 433  LLQGALQRAGSARVVNVSSFRHAHGYVDEKHLTGAGKPLNLIQSYDCSKLLLTSFTGELA 492

Query: 1335 QRLQGTGVTVNALHPGVARTELGR-HTGMHNSAFSSFTLGPIFWLLVKSPQLAAQPSTYL 1511
            +RLQGTGVTVN++ PGV  TE+ + +  ++   F       +F    K  +  A P  YL
Sbjct: 493  RRLQGTGVTVNSVDPGVVYTEIMKPYPWLYRFLFW------LFSFFCKDVKQGAIPVLYL 546

Query: 1512 AVAEELESVSGKYF 1553
            ++A+EL+ VSGKYF
Sbjct: 547  SLAKELDGVSGKYF 560


>ref|XP_852623.1| PREDICTED: similar to WW domain-containing oxidoreductase isoform 1
            [Canis familiaris]
          Length = 383

 Score =  145 bits (367), Expect = 8e-35
 Identities = 86/201 (42%), Positives = 112/201 (55%), Gaps = 7/201 (3%)
 Frame = +3

Query: 801  GKTVIVTGANTGIGKQTALELAKRGGNIILACRDLEKCEAAAKDIRGETLNHRVSARHLD 980
            GK V+VTGAN+GIG +TA   A  G ++ILACR++ +   A   I GE    +V A  LD
Sbjct: 124  GKVVVVTGANSGIGFETAKSFALHGAHVILACRNMTRANEAVSQILGEWHKAKVEAMTLD 183

Query: 981  LASLTSVREFAAKINEEEEHLHVLINNAAVMRCPHWTTEDGFEMQLGVNYLGHFXXXXXX 1160
            LA L SV+ FA     +   LHVL+ NAA    P   T+DG E    VN+LGHF      
Sbjct: 184  LALLRSVQHFAQAFKAKNVSLHVLVCNAAAFALPWSLTKDGLETTFQVNHLGHFYLVQLL 243

Query: 1161 XXXXKASAPSRIINLSSLAH-------VAGHIDFDDLNWEKRKYDTKAAYCQSKLALVLF 1319
                  SAP+R++ +SS +H        +G +DF  L+  K  Y    AY +SKL  +LF
Sbjct: 244  QDVLCRSAPARVVVVSSESHRFTDINDSSGKLDFSRLSPSKSDYWAMLAYNRSKLCNILF 303

Query: 1320 SMELSQRLQGTGVTVNALHPG 1382
            S EL +RL   GVT NA+HPG
Sbjct: 304  SNELHRRLSPRGVTSNAVHPG 324


>ref|XP_544970.2| PREDICTED: similar to dehydrogenase/reductase (SDR family) member 8
            [Canis familiaris]
          Length = 300

 Score = 66.6 bits (161), Expect = 6e-11
 Identities = 71/256 (27%), Positives = 106/256 (41%), Gaps = 5/256 (1%)
 Frame = +3

Query: 705  LPLSVLGTAVGGAVLLKDFVAGGACPSKATIPGKTVIVTGANTGIGKQTALELAKRGGNI 884
            LPL ++ T      LLK F+       + ++ G+ V++TGA  GIG+ TA E AK    +
Sbjct: 11   LPLLIIFTLES---LLKLFIP----KKRKSVTGEIVLITGAGHGIGRLTAYEFAKLKSKL 63

Query: 885  ILACRDLEKCEAAAKDIRGETLNHRVSARHLDLASLTSVREFAAKINEEEEHLHVLINNA 1064
            +L   +    E  A + R   L  +V A  +D ++   +   A K+  E   + +L+NNA
Sbjct: 64   VLWDINKHGIEDTAAECR--RLGAKVHAFVVDCSNREDIYGSATKVKAEVGDVSILVNNA 121

Query: 1065 AVMRCPHW--TTEDGFEMQLGVNYLGHFXXXXXXXXXXKASAPSRIINLSSLAHVAGHID 1238
             V+       T +   E    VN L HF            +    I+ ++S    AGH  
Sbjct: 122  GVVYTSDLFATQDPQIEKTFEVNVLAHFWTTKAFLPVMMKNNHGHIVTVAS---AAGHTG 178

Query: 1239 FDDLNWEKRKYDTKAAYCQSKLALVLFSMELSQR---LQGTGVTVNALHPGVARTELGRH 1409
               L           AYC SK A V F   L++    L+ TGV    L P    T   ++
Sbjct: 179  VPFL----------LAYCSSKFAAVGFHKALTEELAALERTGVKTTCLCPNFINTGFIKN 228

Query: 1410 TGMHNSAFSSFTLGPI 1457
                    +S  LGPI
Sbjct: 229  --------ASTALGPI 236


  Database: RefSeqCP
    Posted date:  Aug 1, 2006  9:25 PM
  Number of letters in database: 19,266,565
  Number of sequences in database:  33,732
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 69,792,685
Number of Sequences: 33732
Number of extensions: 2131911
Number of successful extensions: 10669
Number of sequences better than 1.0e-05: 10
Number of HSP's better than  0.0 without gapping: 7344
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 10488
length of database: 19,266,565
effective HSP length: 107
effective length of database: 15,657,241
effective search space used: 6450783292
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqHP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611C-003420
         (1560 letters)

Database: RefSeqHP 
           39,411 sequences; 17,774,539 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_612421.1| retinol dehydrogenase 13 (all-trans and 9-cis) ...   369   e-102
Alignment   gi|NP_689656.1| retinol dehydrogenase 12 (all-trans and 9-cis) ...   256   4e-68
Alignment   gi|NP_057110.2| androgen-regulated short-chain dehydrogenase/re...   249   3e-66
Alignment   gi|NP_065956.1| retinol dehydrogenase 14 (all-trans and 9-cis) ...   223   3e-58
Alignment   gi|NP_660160.1| dehydrogenase/reductase (SDR family) X-linked [...   178   1e-44
Alignment   gi|NP_653284.1| hypothetical protein LOC147015 [Homo sapiens]        160   2e-39
Alignment   gi|NP_057457.1| WW domain-containing oxidoreductase isoform 1 [...   155   1e-37
Alignment   gi|XP_371503.3| PREDICTED: similar to short-chain dehydrogenase...    87   3e-17
Alignment   gi|XP_947127.1| PREDICTED: similar to short-chain dehydrogenase...    87   3e-17
Alignment   gi|NP_057329.1| dehydrogenase/reductase (SDR family) member 8 [...    66   7e-11

>ref|NP_612421.1| retinol dehydrogenase 13 (all-trans and 9-cis) [Homo sapiens]
          Length = 260

 Score =  369 bits (947), Expect = e-102
 Identities = 181/219 (82%), Positives = 195/219 (89%)
 Frame = +3

Query: 903  LEKCEAAAKDIRGETLNHRVSARHLDLASLTSVREFAAKINEEEEHLHVLINNAAVMRCP 1082
            +EKCEAAAKDIRGETLNH V+ARHLDLASL S+REFAAKI EEEE + +LINNA VMRCP
Sbjct: 1    MEKCEAAAKDIRGETLNHHVNARHLDLASLKSIREFAAKIIEEEERVDILINNAGVMRCP 60

Query: 1083 HWTTEDGFEMQLGVNYLGHFXXXXXXXXXXKASAPSRIINLSSLAHVAGHIDFDDLNWEK 1262
            HWTTEDGFEMQ GVN+LGHF          KASAPSRIINLSSLAHVAGHIDFDDLNW+ 
Sbjct: 61   HWTTEDGFEMQFGVNHLGHFLLTNLLLDKLKASAPSRIINLSSLAHVAGHIDFDDLNWQT 120

Query: 1263 RKYDTKAAYCQSKLALVLFSMELSQRLQGTGVTVNALHPGVARTELGRHTGMHNSAFSSF 1442
            RKY+TKAAYCQSKLA+VLF+ ELS+RLQG+GVTVNALHPGVARTELGRHTG+H S FSS 
Sbjct: 121  RKYNTKAAYCQSKLAIVLFTKELSRRLQGSGVTVNALHPGVARTELGRHTGIHGSTFSST 180

Query: 1443 TLGPIFWLLVKSPQLAAQPSTYLAVAEELESVSGKYFDG 1559
            TLGPIFWLLVKSP+LAAQPSTYLAVAEEL  VSGKYFDG
Sbjct: 181  TLGPIFWLLVKSPELAAQPSTYLAVAEELADVSGKYFDG 219


>ref|NP_689656.1| retinol dehydrogenase 12 (all-trans and 9-cis) [Homo sapiens]
          Length = 316

 Score =  256 bits (654), Expect = 4e-68
 Identities = 138/268 (51%), Positives = 176/268 (65%)
 Frame = +3

Query: 750  LKDFVAGGACPSKATIPGKTVIVTGANTGIGKQTALELAKRGGNIILACRDLEKCEAAAK 929
            ++ F AGG C +   +PGK V++TGANTGIGK+TA ELA RG  + +ACRD+ K E+AA 
Sbjct: 22   IRKFFAGGVCRTNVQLPGKVVVITGANTGIGKETARELASRGARVYIACRDVLKGESAAS 81

Query: 930  DIRGETLNHRVSARHLDLASLTSVREFAAKINEEEEHLHVLINNAAVMRCPHWTTEDGFE 1109
            +IR +T N +V  R LDL+   S+R FA     EE+ LH+LINNA VM CP+  T DGFE
Sbjct: 82   EIRVDTKNSQVLVRKLDLSDTKSIRAFAEGFLAEEKQLHILINNAGVMMCPYSKTADGFE 141

Query: 1110 MQLGVNYLGHFXXXXXXXXXXKASAPSRIINLSSLAHVAGHIDFDDLNWEKRKYDTKAAY 1289
              LGVN+LGHF          K SAP+R++N+SS+AH  G I F DL  EKR Y    AY
Sbjct: 142  THLGVNHLGHFLLTYLLLEQLKVSAPARVVNVSSVAHHIGKIPFHDLQSEKR-YSRGFAY 200

Query: 1290 CQSKLALVLFSMELSQRLQGTGVTVNALHPGVARTELGRHTGMHNSAFSSFTLGPIFWLL 1469
            C SKLA VLF+ EL++RLQGTGVT  A+HPGV R+EL RH+ +         L  +F   
Sbjct: 201  CHSKLANVLFTRELAKRLQGTGVTTYAVHPGVVRSELVRHSSL------LCLLWRLFSPF 254

Query: 1470 VKSPQLAAQPSTYLAVAEELESVSGKYF 1553
            VK+ +  AQ S + A+AE LE +SGKYF
Sbjct: 255  VKTAREGAQTSLHCALAEGLEPLSGKYF 282


>ref|NP_057110.2| androgen-regulated short-chain dehydrogenase/reductase 1 [Homo
            sapiens]
          Length = 318

 Score =  249 bits (637), Expect = 3e-66
 Identities = 134/268 (50%), Positives = 177/268 (66%)
 Frame = +3

Query: 750  LKDFVAGGACPSKATIPGKTVIVTGANTGIGKQTALELAKRGGNIILACRDLEKCEAAAK 929
            ++  ++ G C S   +PGK V+VTGANTGIGK+TA ELA+RG  + LACRD+EK E  AK
Sbjct: 24   IRKMLSSGVCTSTVQLPGKVVVVTGANTGIGKETAKELAQRGARVYLACRDVEKGELVAK 83

Query: 930  DIRGETLNHRVSARHLDLASLTSVREFAAKINEEEEHLHVLINNAAVMRCPHWTTEDGFE 1109
            +I+  T N +V  R LDL+   S+R FA     EE+HLHVLINNA VM CP+  T DGFE
Sbjct: 84   EIQTTTGNQQVLVRKLDLSDTKSIRAFAKGFLAEEKHLHVLINNAGVMMCPYSKTADGFE 143

Query: 1110 MQLGVNYLGHFXXXXXXXXXXKASAPSRIINLSSLAHVAGHIDFDDLNWEKRKYDTKAAY 1289
            M +GVN+LGHF          K SAPSRI+N+SSLAH  G I F +L  EK  Y+   AY
Sbjct: 144  MHIGVNHLGHFLLTHLLLEKLKESAPSRIVNVSSLAHHLGRIHFHNLQGEK-FYNAGLAY 202

Query: 1290 CQSKLALVLFSMELSQRLQGTGVTVNALHPGVARTELGRHTGMHNSAFSSFTLGPIFWLL 1469
            C SKLA +LF+ EL++RL+G+GVT  ++HPG  ++EL RH     S+F  + +  +F   
Sbjct: 203  CHSKLANILFTQELARRLKGSGVTTYSVHPGTVQSELVRH-----SSFMRW-MWWLFSFF 256

Query: 1470 VKSPQLAAQPSTYLAVAEELESVSGKYF 1553
            +K+PQ  AQ S + A+ E LE +SG +F
Sbjct: 257  IKTPQQGAQTSLHCALTEGLEILSGNHF 284


>ref|NP_065956.1| retinol dehydrogenase 14 (all-trans and 9-cis) [Homo sapiens]
          Length = 336

 Score =  223 bits (569), Expect = 3e-58
 Identities = 124/264 (46%), Positives = 162/264 (61%), Gaps = 13/264 (4%)
 Frame = +3

Query: 801  GKTVIVTGANTGIGKQTALELAKRGGNIILACRDLEKCEAAAKDIRGETLNH-------- 956
            GKTV++TGAN+G+G+ TA EL + G  +I+ CRD  + E AA  +R E            
Sbjct: 43   GKTVLITGANSGLGRATAAELLRLGARVIMGCRDRARAEEAAGQLRRELRQAAECGPEPG 102

Query: 957  -----RVSARHLDLASLTSVREFAAKINEEEEHLHVLINNAAVMRCPHWTTEDGFEMQLG 1121
                  +  R LDLASL SVR F  ++ +EE  L VLINNA + +CP+  TEDGFEMQ G
Sbjct: 103  VSGVGELIVRELDLASLRSVRAFCQEMLQEEPRLDVLINNAGIFQCPYMKTEDGFEMQFG 162

Query: 1122 VNYLGHFXXXXXXXXXXKASAPSRIINLSSLAHVAGHIDFDDLNWEKRKYDTKAAYCQSK 1301
            VN+LGHF          K+SAPSRI+ +SS  +  G I+FDDLN E + Y+    Y +SK
Sbjct: 163  VNHLGHFLLTNLLLGLLKSSAPSRIVVVSSKLYKYGDINFDDLNSE-QSYNKSFCYSRSK 221

Query: 1302 LALVLFSMELSQRLQGTGVTVNALHPGVARTELGRHTGMHNSAFSSFTLGPIFWLLVKSP 1481
            LA +LF+ EL++RL+GT VTVN LHPG+ RT LGRH  +       F L  + W   K+P
Sbjct: 222  LANILFTRELARRLEGTNVTVNVLHPGIVRTNLGRHIHIPLLVKPLFNL--VSWAFFKTP 279

Query: 1482 QLAAQPSTYLAVAEELESVSGKYF 1553
               AQ S YLA + E+E VSG+YF
Sbjct: 280  VEGAQTSIYLASSPEVEGVSGRYF 303


>ref|NP_660160.1| dehydrogenase/reductase (SDR family) X-linked [Homo sapiens]
          Length = 330

 Score =  178 bits (452), Expect = 1e-44
 Identities = 117/297 (39%), Positives = 154/297 (51%), Gaps = 6/297 (2%)
 Frame = +3

Query: 678  APPGMNRYILPLSVLGTAVGGAVLLKDFVAGGACPSKATIPGKTVIVTGANTGIGKQTAL 857
            +P    R  L +  +G AV  A LL+    G   P     P +  IVTG   GIG  TA 
Sbjct: 2    SPLSAARAALRVYAVGAAVILAQLLRRCRGGFLEPVFPPRPDRVAIVTGGTDGIGYSTAK 61

Query: 858  ELAKRGGNIILACRDLEKCEAAAKDIRGETLNHRVSARHLDLASLTSVREFAAKINEEEE 1037
             LA+ G ++I+A  +  K +     I+ ETLN +V   + DLAS+TS+R+F  K   ++ 
Sbjct: 62   HLARLGMHVIIAGNNDSKAKQVVSKIKEETLNDKVEFLYCDLASMTSIRQFVQKFKMKKI 121

Query: 1038 HLHVLINNAAVMRCPHWTTEDGFEMQLGVNYLGHFXXXXXXXXXXKASA----PSRIINL 1205
             LHVLINNA VM  P   T DGFE   G+NYLGHF          K S      +R++ +
Sbjct: 122  PLHVLINNAGVMMVPQRKTRDGFEEHFGLNYLGHFLLTNLLLDTLKESGSPGHSARVVTV 181

Query: 1206 SSLAHVAGHIDFDDLNWEKRKYDTKAAYCQSKLALVLFSMELSQRL--QGTGVTVNALHP 1379
            SS  H    ++ DDL      Y   AAY QSKLALVLF+  L + L  +G+ VT N + P
Sbjct: 182  SSATHYVAELNMDDLQ-SSACYSPHAAYAQSKLALVLFTYHLQRLLAAEGSHVTANVVDP 240

Query: 1380 GVARTELGRHTGMHNSAFSSFTLGPIFWLLVKSPQLAAQPSTYLAVAEELESVSGKY 1550
            GV  T+L +H     +  +   LG   WLL K+P   A  S Y AV  ELE V G+Y
Sbjct: 241  GVVNTDLYKHV-FWATRLAKKLLG---WLLFKTPDEGAWTSIYAAVTPELEGVGGRY 293


>ref|NP_653284.1| hypothetical protein LOC147015 [Homo sapiens]
          Length = 327

 Score =  160 bits (406), Expect = 2e-39
 Identities = 98/240 (40%), Positives = 136/240 (56%), Gaps = 5/240 (2%)
 Frame = +3

Query: 849  TALELAKRGGNIILACRDLEKCEAAAKDIRGETLNHRVSARHLDLASLTSVREFAAKINE 1028
            TALELA+RG  ++LACR  E+ EAAA D+R E+ N+ V    LDLASL SVR FA     
Sbjct: 2    TALELARRGARVVLACRSQERGEAAAFDLRQESGNNEVIFMALDLASLASVRAFATAFLS 61

Query: 1029 EEEHLHVLINNAAVMRCPHWTTEDGFEMQLGVNYLGHFXXXXXXXXXXKASAPSRIINLS 1208
             E  L +LI+NA +  C    T + F + L VN++G F          KA APSR++ ++
Sbjct: 62   SEPRLDILIHNAGISSCGR--TREAFNLLLRVNHIGPFLLTHLLLPCLKACAPSRVVVVA 119

Query: 1209 SLAHVAGHIDFDDLN-----WEKRKYDTKAAYCQSKLALVLFSMELSQRLQGTGVTVNAL 1373
            S AH  G +DF  L+     W +       AY  +KLA VLF+ EL+ +L+ TGVT  A 
Sbjct: 120  SAAHCRGRLDFKRLDRPVVGWRQE----LRAYADTKLANVLFARELANQLEATGVTCYAA 175

Query: 1374 HPGVARTELGRHTGMHNSAFSSFTLGPIFWLLVKSPQLAAQPSTYLAVAEELESVSGKYF 1553
            HPG   +EL      H   +    L P+ WL++++P+  AQ   Y A+ E +E +SG+YF
Sbjct: 176  HPGPVNSELFLR---HVPGWLRPLLRPLAWLVLRAPRGGAQTPLYCALQEGIEPLSGRYF 232


>ref|NP_057457.1| WW domain-containing oxidoreductase isoform 1 [Homo sapiens]
          Length = 414

 Score =  155 bits (391), Expect = 1e-37
 Identities = 101/259 (38%), Positives = 133/259 (51%), Gaps = 7/259 (2%)
 Frame = +3

Query: 801  GKTVIVTGANTGIGKQTALELAKRGGNIILACRDLEKCEAAAKDIRGETLNHRVSARHLD 980
            GK V+VTGAN+GIG +TA   A  G ++ILACR++ +   A   I  E    +V A  LD
Sbjct: 124  GKVVVVTGANSGIGFETAKSFALHGAHVILACRNMARASEAVSRILEEWHKAKVEAMTLD 183

Query: 981  LASLTSVREFAAKINEEEEHLHVLINNAAVMRCPHWTTEDGFEMQLGVNYLGHFXXXXXX 1160
            LA L SV+ FA     +   LHVL+ NAA    P   T+DG E    VN+LGHF      
Sbjct: 184  LALLRSVQHFAEAFKAKNVPLHVLVCNAATFALPWSLTKDGLETTFQVNHLGHFYLVQLL 243

Query: 1161 XXXXKASAPSRIINLSSLAH-------VAGHIDFDDLNWEKRKYDTKAAYCQSKLALVLF 1319
                  SAP+R+I +SS +H         G +DF  L+  K  Y    AY +SKL  +LF
Sbjct: 244  QDVLCRSAPARVIVVSSESHRFTDINDSLGKLDFSRLSPTKNDYWAMLAYNRSKLCNILF 303

Query: 1320 SMELSQRLQGTGVTVNALHPGVARTELGRHTGMHNSAFSSFTLGPIFWLLVKSPQLAAQP 1499
            S EL +RL   GVT NA+HPG        ++ +H S +    L  +     KS Q  A  
Sbjct: 304  SNELHRRLSPRGVTSNAVHPGNM-----MYSNIHRSWWVYTLLFTLARPFTKSMQQGAAT 358

Query: 1500 STYLAVAEELESVSGKYFD 1556
            + Y A   ELE + G YF+
Sbjct: 359  TVYCAAVPELEGLGGMYFN 377


>ref|XP_371503.3| PREDICTED: similar to short-chain dehydrogenase/reductase 1 [Homo
            sapiens]
          Length = 891

 Score = 87.4 bits (215), Expect = 3e-17
 Identities = 45/120 (37%), Positives = 72/120 (60%), Gaps = 1/120 (0%)
 Frame = +3

Query: 786  KATIPGKTVIVTGANTGIGKQTALELAKRGGNIILACRDLEKCEAAAKDIRGETLNHRVS 965
            K  + GK  IVTGAN+GIGK  + +LA+ G  +IL C+  E  + A  +I+  + ++R+ 
Sbjct: 597  KEDLTGKIAIVTGANSGIGKVVSQDLARCGAQVILTCQSRECGQQALAEIQAASNSNRLL 656

Query: 966  ARHLDLASLTSVREFAAKINEEEEHLHVLINNAAVM-RCPHWTTEDGFEMQLGVNYLGHF 1142
               +DL+S+TS+R FA ++ +E   +H+L+NNA V    P   T  G ++    NY+G F
Sbjct: 657  LGEVDLSSMTSIRSFARRLLQENPEIHLLVNNAGVSGMIPKTLTPGGLDLTFVTNYVGPF 716


>ref|XP_947127.1| PREDICTED: similar to short-chain dehydrogenase/reductase 1 [Homo
            sapiens]
          Length = 916

 Score = 87.4 bits (215), Expect = 3e-17
 Identities = 45/120 (37%), Positives = 72/120 (60%), Gaps = 1/120 (0%)
 Frame = +3

Query: 786  KATIPGKTVIVTGANTGIGKQTALELAKRGGNIILACRDLEKCEAAAKDIRGETLNHRVS 965
            K  + GK  IVTGAN+GIGK  + +LA+ G  +IL C+  E  + A  +I+  + ++R+ 
Sbjct: 622  KEDLTGKIAIVTGANSGIGKVVSQDLARCGAQVILTCQSRECGQQALAEIQAASNSNRLL 681

Query: 966  ARHLDLASLTSVREFAAKINEEEEHLHVLINNAAVM-RCPHWTTEDGFEMQLGVNYLGHF 1142
               +DL+S+TS+R FA ++ +E   +H+L+NNA V    P   T  G ++    NY+G F
Sbjct: 682  LGEVDLSSMTSIRSFARRLLQENPEIHLLVNNAGVSGMIPKTLTPGGLDLTFVTNYVGPF 741


>ref|NP_057329.1| dehydrogenase/reductase (SDR family) member 8 [Homo sapiens]
          Length = 300

 Score = 66.2 bits (160), Expect = 7e-11
 Identities = 61/220 (27%), Positives = 90/220 (40%), Gaps = 5/220 (2%)
 Frame = +3

Query: 750  LKDFVAGGACPSKATIPGKTVIVTGANTGIGKQTALELAKRGGNIILACRDLEKCEAAAK 929
            L+ FV       + ++ G+ V++TGA  GIG+ TA E AK    ++L   +    E  A 
Sbjct: 19   LESFVKLFIPKRRKSVTGEIVLITGAGHGIGRLTAYEFAKLKSKLVLWDINKHGLEETAA 78

Query: 930  DIRGETLNHRVSARHLDLASLTSVREFAAKINEEEEHLHVLINNAAVMRCPHW--TTEDG 1103
              +G  L  +V    +D ++   +   A K+  E   + +L+NNA V+       T +  
Sbjct: 79   KCKG--LGAKVHTFVVDCSNREDIYSSAKKVKAEIGDVSILVNNAGVVYTSDLFATQDPQ 136

Query: 1104 FEMQLGVNYLGHFXXXXXXXXXXKASAPSRIINLSSLAHVAGHIDFDDLNWEKRKYDTKA 1283
             E    VN L HF            +    I+ ++S    AGH+    L           
Sbjct: 137  IEKTFEVNVLAHFWTTKAFLPAMTKNNHGHIVTVAS---AAGHVSVPFL----------L 183

Query: 1284 AYCQSKLALVLFSMELSQR---LQGTGVTVNALHPGVART 1394
            AYC SK A V F   L+     LQ TGV    L P    T
Sbjct: 184  AYCSSKFAAVGFHKTLTDELAALQITGVKTTCLCPNFVNT 223


  Database: RefSeqHP
    Posted date:  Aug 2, 2006 12:57 AM
  Number of letters in database: 17,774,539
  Number of sequences in database:  39,411
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 68,316,615
Number of Sequences: 39411
Number of extensions: 2185221
Number of successful extensions: 11247
Number of sequences better than 1.0e-05: 10
Number of HSP's better than  0.0 without gapping: 7363
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 11076
length of database: 17,774,539
effective HSP length: 106
effective length of database: 13,596,973
effective search space used: 5615549849
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqMP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611C-003420
         (1560 letters)

Database: RefSeqMP 
           45,328 sequences; 21,768,885 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_780581.1| retinol dehydrogenase 13 (all-trans and 9-cis) ...   488   e-138
Alignment   gi|NP_067532.2| short-chain dehydrogenase/reductase 1 [Mus musc...   251   1e-66
Alignment   gi|NP_084293.1| retinol dehydrogenase 12 [Mus musculus]              249   4e-66
Alignment   gi|NP_076186.1| alcohol dehydrogenase PAN2 [Mus musculus]            224   1e-58
Alignment   gi|NP_001028498.1| dehydrogenase/reductase (SDR family) X chrom...   176   6e-44
Alignment   gi|NP_899109.1| hypothetical protein LOC70451 [Mus musculus]         168   2e-41
Alignment   gi|NP_062519.2| WW-domain oxidoreductase [Mus musculus]              154   3e-37
Alignment   gi|NP_780721.1| NADP-dependent retinol dehydrogenase/reductase ...    64   6e-10
Alignment   gi|XP_203753.2| PREDICTED: follicular lymphoma variant transloc...    63   1e-09
Alignment   gi|XP_915916.1| PREDICTED: similar to 3-ketodihydrosphingosine ...    63   1e-09

>ref|NP_780581.1| retinol dehydrogenase 13 (all-trans and 9-cis) [Mus musculus]
          Length = 334

 Score =  488 bits (1257), Expect = e-138
 Identities = 238/290 (82%), Positives = 260/290 (89%)
 Frame = +3

Query: 690  MNRYILPLSVLGTAVGGAVLLKDFVAGGACPSKATIPGKTVIVTGANTGIGKQTALELAK 869
            M+R++LP+SV+GT +GG VLLKD+VAGGACPSKATIPGKTVIVTGANTGIGKQTALELAK
Sbjct: 1    MSRFLLPVSVVGTVIGGTVLLKDYVAGGACPSKATIPGKTVIVTGANTGIGKQTALELAK 60

Query: 870  RGGNIILACRDLEKCEAAAKDIRGETLNHRVSARHLDLASLTSVREFAAKINEEEEHLHV 1049
            RGGN+ILACRD+EKCE AAKDIRGETLN RV A  LDLASL S+REFA K+ +EEE + +
Sbjct: 61   RGGNVILACRDMEKCEVAAKDIRGETLNPRVRAERLDLASLKSIREFARKVIKEEERVDI 120

Query: 1050 LINNAAVMRCPHWTTEDGFEMQLGVNYLGHFXXXXXXXXXXKASAPSRIINLSSLAHVAG 1229
            L+NNAAVMRCPHWTTEDGFEMQ GVNYLGHF          KASAPSRIINLSSLAHVAG
Sbjct: 121  LVNNAAVMRCPHWTTEDGFEMQFGVNYLGHFLLTNLLLDKLKASAPSRIINLSSLAHVAG 180

Query: 1230 HIDFDDLNWEKRKYDTKAAYCQSKLALVLFSMELSQRLQGTGVTVNALHPGVARTELGRH 1409
            HIDF+DLNW+ +KYDTKAAYCQSKLA+VLF+ ELS RLQG+GVTVNALHPGVARTELGRH
Sbjct: 181  HIDFEDLNWQMKKYDTKAAYCQSKLAVVLFTKELSHRLQGSGVTVNALHPGVARTELGRH 240

Query: 1410 TGMHNSAFSSFTLGPIFWLLVKSPQLAAQPSTYLAVAEELESVSGKYFDG 1559
            TGMHNSAFS F LGP FWLL KSPQLAAQPSTYLAVAEELE+VSGKYFDG
Sbjct: 241  TGMHNSAFSGFMLGPFFWLLFKSPQLAAQPSTYLAVAEELENVSGKYFDG 290


>ref|NP_067532.2| short-chain dehydrogenase/reductase 1 [Mus musculus]
          Length = 316

 Score =  251 bits (641), Expect = 1e-66
 Identities = 132/268 (49%), Positives = 175/268 (65%)
 Frame = +3

Query: 750  LKDFVAGGACPSKATIPGKTVIVTGANTGIGKQTALELAKRGGNIILACRDLEKCEAAAK 929
            ++  ++ G C S   +PGK  IVTGANTGIGK+TA +LA+RG  + LACRD++K E AA+
Sbjct: 21   IRKMLSSGVCTSNVQLPGKVAIVTGANTGIGKETAKDLAQRGARVYLACRDVDKGELAAR 80

Query: 930  DIRGETLNHRVSARHLDLASLTSVREFAAKINEEEEHLHVLINNAAVMRCPHWTTEDGFE 1109
            +I+  T N +V  R LDLA   S+R FA     EE+HLH+LINNA VM CP+  T DGFE
Sbjct: 81   EIQAVTGNSQVFVRKLDLADTKSIRAFAKDFLAEEKHLHLLINNAGVMMCPYSKTADGFE 140

Query: 1110 MQLGVNYLGHFXXXXXXXXXXKASAPSRIINLSSLAHVAGHIDFDDLNWEKRKYDTKAAY 1289
            M +GVN+LGHF          K SAPSRI+NLSSL H  G I F +L  EK  Y    AY
Sbjct: 141  MHIGVNHLGHFLLTHLLLEKLKESAPSRIVNLSSLGHHLGRIHFHNLQGEK-FYSAGLAY 199

Query: 1290 CQSKLALVLFSMELSQRLQGTGVTVNALHPGVARTELGRHTGMHNSAFSSFTLGPIFWLL 1469
            C SKLA +LF+ EL++RL+G+GVT  ++HPG   +EL R++ +         L  +F++ 
Sbjct: 200  CHSKLANILFTKELAKRLKGSGVTTYSVHPGTVHSELTRYSSIMR------WLWQLFFVF 253

Query: 1470 VKSPQLAAQPSTYLAVAEELESVSGKYF 1553
            +K+PQ  AQ S Y A+ E LES+SG +F
Sbjct: 254  IKTPQEGAQTSLYCALTEGLESLSGSHF 281


>ref|NP_084293.1| retinol dehydrogenase 12 [Mus musculus]
          Length = 316

 Score =  249 bits (637), Expect = 4e-66
 Identities = 137/284 (48%), Positives = 181/284 (63%)
 Frame = +3

Query: 702  ILPLSVLGTAVGGAVLLKDFVAGGACPSKATIPGKTVIVTGANTGIGKQTALELAKRGGN 881
            +L  S L      A  ++ F AGG C +   IPGK V++TGANTGIGK+TA ELA+RG  
Sbjct: 6    VLLTSFLSILYLTAPSIRKFFAGGVCTTNVQIPGKVVVITGANTGIGKETARELARRGAR 65

Query: 882  IILACRDLEKCEAAAKDIRGETLNHRVSARHLDLASLTSVREFAAKINEEEEHLHVLINN 1061
            + +ACRD+ K E+AA +IR +T N +V  R LDL+   S+R FA +   EE+ LH+LINN
Sbjct: 66   VYIACRDVLKGESAASEIRADTKNSQVLVRKLDLSDTKSIRAFAERFLAEEKKLHILINN 125

Query: 1062 AAVMRCPHWTTEDGFEMQLGVNYLGHFXXXXXXXXXXKASAPSRIINLSSLAHVAGHIDF 1241
            A VM CP+  T DGFE   GVN+LGHF          K SAP+R++NLSS+AH+ G I F
Sbjct: 126  AGVMMCPYSKTTDGFETHFGVNHLGHFLLTYLLLERLKESAPARVVNLSSIAHLIGKIRF 185

Query: 1242 DDLNWEKRKYDTKAAYCQSKLALVLFSMELSQRLQGTGVTVNALHPGVARTELGRHTGMH 1421
             DL  +KR Y +  AY  SKLA +LF+ EL++RLQGTGVT  A+HPGV  +E+ R     
Sbjct: 186  HDLQGQKR-YCSAFAYGHSKLANLLFTRELAKRLQGTGVTAYAVHPGVVLSEITR----- 239

Query: 1422 NSAFSSFTLGPIFWLLVKSPQLAAQPSTYLAVAEELESVSGKYF 1553
             +++    L  +F    KS    AQ S + A+AE+LE +SGKYF
Sbjct: 240  -NSYLLCLLWRLFSPFFKSTSQGAQTSLHCALAEDLEPLSGKYF 282


>ref|NP_076186.1| alcohol dehydrogenase PAN2 [Mus musculus]
          Length = 334

 Score =  224 bits (572), Expect = 1e-58
 Identities = 126/272 (46%), Positives = 168/272 (61%), Gaps = 10/272 (3%)
 Frame = +3

Query: 768  GGACPSKATIPGKTVIVTGANTGIGKQTALELAKRGGNIILACRDLEKCEAAAKDIRGET 947
            GG  P    + GKTV++TGAN+G+G+ TA EL + G  +I+ CRD  + E AA  +R E 
Sbjct: 35   GGGDPG--LMHGKTVLITGANSGLGRATAAELLRLGARVIMGCRDRARAEEAAGQLRQEL 92

Query: 948  L----------NHRVSARHLDLASLTSVREFAAKINEEEEHLHVLINNAAVMRCPHWTTE 1097
                       + ++  + LDLASL SVR F  ++ +EE  L VLINNA V  CP+  TE
Sbjct: 93   CQAGGAGPDGTDGQLVVKELDLASLRSVRAFCQELLQEEPRLDVLINNAGVFHCPYTKTE 152

Query: 1098 DGFEMQLGVNYLGHFXXXXXXXXXXKASAPSRIINLSSLAHVAGHIDFDDLNWEKRKYDT 1277
            DGFEMQ GVN+LGHF          K+SAPSRI+ +SS  +  G I+F+DLN E + Y+ 
Sbjct: 153  DGFEMQFGVNHLGHFLLTNLLLGLLKSSAPSRIVVVSSKLYKYGEINFEDLNSE-QSYNK 211

Query: 1278 KAAYCQSKLALVLFSMELSQRLQGTGVTVNALHPGVARTELGRHTGMHNSAFSSFTLGPI 1457
               Y +SKLA +LF+ EL++RL+GT VTVN LHPG+ RT LGRH  +   A   F L  +
Sbjct: 212  SFCYSRSKLANILFTRELARRLEGTNVTVNVLHPGIVRTNLGRHIHIPLLARPLFNL--V 269

Query: 1458 FWLLVKSPQLAAQPSTYLAVAEELESVSGKYF 1553
             W   K+P   AQ S YLA + ++E VSG+YF
Sbjct: 270  SWAFFKTPLEGAQTSIYLACSPDVEGVSGRYF 301


>ref|NP_001028498.1| dehydrogenase/reductase (SDR family) X chromosome [Mus musculus]
          Length = 335

 Score =  176 bits (446), Expect = 6e-44
 Identities = 117/291 (40%), Positives = 149/291 (51%), Gaps = 6/291 (2%)
 Frame = +3

Query: 696  RYILPLSVLGTAVGGAVLLKDFVAGGACPSKATIPGKTVIVTGANTGIGKQTALELAKRG 875
            R +L +  +G AV  A LL+        P     PG+  IVTGA  GIG+ TA +LA+ G
Sbjct: 8    RAVLCVYAVGIAVALAQLLRRLRGDFRPPVLPPQPGRVAIVTGATAGIGRSTARQLARLG 67

Query: 876  GNIILACRDLEKCEAAAKDIRGETLNHRVSARHLDLASLTSVREFAAKINEEEEHLHVLI 1055
              +++A  D  + +     IR E  + R     LDLASL SVR FA         LH+L+
Sbjct: 68   MCVVVAGNDEHRGQEVVSSIRAEMGSDRAHFLPLDLASLASVRGFARDFQALGLPLHLLV 127

Query: 1056 NNAAVMRCPHWTTEDGFEMQLGVNYLGHFXXXXXXXXXXKASAP----SRIINLSSLAHV 1223
            NNA VM  P   TEDGFE  LGVN+LGHF          +AS      SR++ + S  H 
Sbjct: 128  NNAGVMLEPRAETEDGFERHLGVNFLGHFLLTLLLLPALRASGAEGRGSRVVTVGSATHY 187

Query: 1224 AGHIDFDDLNWEKRKYDTKAAYCQSKLALVLFSMELSQRLQGTG--VTVNALHPGVARTE 1397
             G +D  DL+  +  Y   AAY QSKLAL LF+++L + L   G  VT N   PGV  TE
Sbjct: 188  VGTVDMADLH-GRHAYSPYAAYAQSKLALALFALQLQRILDARGDPVTSNMADPGVVDTE 246

Query: 1398 LGRHTGMHNSAFSSFTLGPIFWLLVKSPQLAAQPSTYLAVAEELESVSGKY 1550
            L RH G        F    + WL+ KSP+  A    Y A A ELE V G+Y
Sbjct: 247  LYRHAGWVLRTAKRF----LGWLVFKSPEEGAWTLVYAAAAPELEGVGGRY 293


>ref|NP_899109.1| hypothetical protein LOC70451 [Mus musculus]
          Length = 260

 Score =  168 bits (425), Expect = 2e-41
 Identities = 106/254 (41%), Positives = 145/254 (57%), Gaps = 6/254 (2%)
 Frame = +3

Query: 723  GTAVGGAVLLK-DFVAGGACPSKATIPGKTVIVTGANTGIGKQTALELAKRGGNIILACR 899
            G  +G  VL+  + V   +C    ++ G+TV+VTGAN+GIGK TALELA+RG  ++LACR
Sbjct: 9    GLLLGAYVLVYYNLVKAPSCGGIGSLRGRTVVVTGANSGIGKMTALELARRGARVVLACR 68

Query: 900  DLEKCEAAAKDIRGETLNHRVSARHLDLASLTSVREFAAKINEEEEHLHVLINNAAVMRC 1079
              E+ EAAA D+R E+ N+ V    LDLASL SV+ FA      E  L VLI+NA +  C
Sbjct: 69   SRERGEAAAFDLRQESGNNEVIFMALDLASLASVQAFATAFLSSEPRLDVLIHNAGISSC 128

Query: 1080 PHWTTEDGFEMQLGVNYLGHFXXXXXXXXXXKASAPSRIINLSSLAHVAGHIDFDDLN-- 1253
                T + F + L VN++G F          ++ APSR++ +SS AH  G +DF  L+  
Sbjct: 129  GR--TRETFNLLLRVNHVGPFLLTHLLLPRLRSCAPSRVVIVSSAAHRRGRLDFTRLDCP 186

Query: 1254 ---WEKRKYDTKAAYCQSKLALVLFSMELSQRLQGTGVTVNALHPGVARTELGRHTGMHN 1424
               W++       AY  SKLA VLF+ EL+ +L+GTGVT  A HPG   +EL      H 
Sbjct: 187  VVGWQQE----LRAYADSKLANVLFARELATQLEGTGVTCYAAHPGPVNSELFLR---HL 239

Query: 1425 SAFSSFTLGPIFWL 1466
              +    L P+ WL
Sbjct: 240  RGWLRPILRPLAWL 253


>ref|NP_062519.2| WW-domain oxidoreductase [Mus musculus]
          Length = 414

 Score =  154 bits (388), Expect = 3e-37
 Identities = 99/259 (38%), Positives = 135/259 (52%), Gaps = 7/259 (2%)
 Frame = +3

Query: 801  GKTVIVTGANTGIGKQTALELAKRGGNIILACRDLEKCEAAAKDIRGETLNHRVSARHLD 980
            GK V+VTGAN+GIG +TA   A  G ++ILACR+L +   A   I  E    +V A  LD
Sbjct: 124  GKVVLVTGANSGIGFETAKSFALHGAHVILACRNLSRASEAVSRILEEWHKAKVEAMTLD 183

Query: 981  LASLTSVREFAAKINEEEEHLHVLINNAAVMRCPHWTTEDGFEMQLGVNYLGHFXXXXXX 1160
            LA L SV+ FA     +   LHVL+ NA     P   T+DG E    VN+LGHF      
Sbjct: 184  LAVLRSVQHFAEAFKAKNVSLHVLVCNAGTFALPWGLTKDGLETTFQVNHLGHFYLVQLL 243

Query: 1161 XXXXKASAPSRIINLSSLAH-------VAGHIDFDDLNWEKRKYDTKAAYCQSKLALVLF 1319
                  S+P+R+I +SS +H        +G +D   L+  +  Y    AY +SKL  +LF
Sbjct: 244  QDVLCRSSPARVIVVSSESHRFTDINDSSGKLDLSRLSPPRSDYWAMLAYNRSKLCNILF 303

Query: 1320 SMELSQRLQGTGVTVNALHPGVARTELGRHTGMHNSAFSSFTLGPIFWLLVKSPQLAAQP 1499
            S EL +RL   GVT NA+HPG        ++ +H +++    L  +     KS Q  A  
Sbjct: 304  SNELHRRLSPRGVTSNAVHPGNM-----MYSAIHRNSWVYKLLFTLARPFTKSMQQGAAT 358

Query: 1500 STYLAVAEELESVSGKYFD 1556
            + Y AVA ELE + G YF+
Sbjct: 359  TVYCAVAPELEGLGGMYFN 377


>ref|NP_780721.1| NADP-dependent retinol dehydrogenase/reductase [Mus musculus]
          Length = 319

 Score = 63.5 bits (153), Expect = 6e-10
 Identities = 60/209 (28%), Positives = 93/209 (44%), Gaps = 5/209 (2%)
 Frame = +3

Query: 789  ATIPGKTVIVTGANTGIGKQTALELAKRGGNIILACRDLEKCEAAAKDIRGETLNHRVSA 968
            A I  K V +TG +TG G   A    K+G  +I AC      E+ +  ++ +T + R+  
Sbjct: 25   ADIADKYVFITGCDTGFGNLAARTFDKKGFRVIAAC----LTESGSAALKAKT-SERLHT 79

Query: 969  RHLDLASLTSVREFA--AKINEEEEHLHVLINNAAVMRC---PHWTTEDGFEMQLGVNYL 1133
              LD+    +V++ A   K +  E+ L  LINNA V+       W T D +   + VN  
Sbjct: 80   VLLDVTDPENVKKTAQWVKSHVGEKGLWGLINNAGVLGVLAPTDWLTVDDYREPIEVNLF 139

Query: 1134 GHFXXXXXXXXXXKASAPSRIINLSSLAHVAGHIDFDDLNWEKRKYDTKAAYCQSKLALV 1313
            G            K  A  R+IN+SS   + G + F               Y  SK A+ 
Sbjct: 140  GLINVTLNMLPLVK-KARGRVINVSS---IGGRLAFGG-----------GGYTPSKYAVE 184

Query: 1314 LFSMELSQRLQGTGVTVNALHPGVARTEL 1400
             F+  L + ++  GV V+ + PG+ +TEL
Sbjct: 185  GFNDSLRRDMKAFGVHVSCIEPGLFKTEL 213


>ref|XP_203753.2| PREDICTED: follicular lymphoma variant translocation 1 isoform 1 [Mus
            musculus]
          Length = 332

 Score = 62.8 bits (151), Expect = 1e-09
 Identities = 57/217 (26%), Positives = 87/217 (40%), Gaps = 5/217 (2%)
 Frame = +3

Query: 744  VLLKDFVAGGACPSKATIPGKTVIVTGANTGIGKQTALELAKRGGNIILACRDLEKCEAA 923
            VLL   V+    P    +PG  V+VTG ++GIGK  A+E  K+G  I L  R+ +K   A
Sbjct: 13   VLLLYMVSPLISPKPLALPGAHVVVTGGSSGIGKCIAIECYKQGAFITLVARNEDKLLQA 72

Query: 924  AKDIRGETLNHRVSARHLDLASLTSVREFAAKINEEEEHL---HVLINNAAVMRCPHWTT 1094
             KDI   ++N +     + +       +    I + +E L    +L+N A       +  
Sbjct: 73   KKDIEKHSINDKQVVLCISVDVSQDYNQVENVIKQAQEKLGPVDMLVNCAGTSMSGKFEE 132

Query: 1095 ED--GFEMQLGVNYLGHFXXXXXXXXXXKASAPSRIINLSSLAHVAGHIDFDDLNWEKRK 1268
             +   FE  + +NYLG            K     RI+ +SS A   G   F         
Sbjct: 133  LEVSSFEKLMSINYLGSVYPSRAVITTMKERRVGRIVFVSSQAGQLGLFGF--------- 183

Query: 1269 YDTKAAYCQSKLALVLFSMELSQRLQGTGVTVNALHP 1379
                 AY  SK A+   +  L   ++   V V   +P
Sbjct: 184  ----TAYSSSKFAIRGLAEALQMEVKPYNVYVTVAYP 216


>ref|XP_915916.1| PREDICTED: similar to 3-ketodihydrosphingosine reductase precursor
            (3-dehydrosphinganine reductase) (KDS reductase)
            (Follicular variant translocation protein 1) (FVT-1)
            isoform 4 [Mus musculus]
          Length = 332

 Score = 62.8 bits (151), Expect = 1e-09
 Identities = 57/217 (26%), Positives = 87/217 (40%), Gaps = 5/217 (2%)
 Frame = +3

Query: 744  VLLKDFVAGGACPSKATIPGKTVIVTGANTGIGKQTALELAKRGGNIILACRDLEKCEAA 923
            VLL   V+    P    +PG  V+VTG ++GIGK  A+E  K+G  I L  R+ +K   A
Sbjct: 13   VLLLYMVSPLISPKPLALPGAHVVVTGGSSGIGKCIAIECYKQGAFITLVARNEDKLLQA 72

Query: 924  AKDIRGETLNHRVSARHLDLASLTSVREFAAKINEEEEHL---HVLINNAAVMRCPHWTT 1094
             KDI   ++N +     + +       +    I + +E L    +L+N A       +  
Sbjct: 73   KKDIEKHSINDKQVVLCISVDVSQDYNQVENVIKQAQEKLGPVDMLVNCAGTSMSGKFEE 132

Query: 1095 ED--GFEMQLGVNYLGHFXXXXXXXXXXKASAPSRIINLSSLAHVAGHIDFDDLNWEKRK 1268
             +   FE  + +NYLG            K     RI+ +SS A   G   F         
Sbjct: 133  LEVSSFEKLMSINYLGSVYPSRAVITTMKERRVGRIVFVSSQAGQLGLFGF--------- 183

Query: 1269 YDTKAAYCQSKLALVLFSMELSQRLQGTGVTVNALHP 1379
                 AY  SK A+   +  L   ++   V V   +P
Sbjct: 184  ----TAYSSSKFAIRGLAEALQMEVKPYNVYVTVAYP 216


  Database: RefSeqMP
    Posted date:  Aug 2, 2006 12:58 AM
  Number of letters in database: 21,768,885
  Number of sequences in database:  45,328
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 79,123,064
Number of Sequences: 45328
Number of extensions: 2366200
Number of successful extensions: 11582
Number of sequences better than 1.0e-05: 10
Number of HSP's better than  0.0 without gapping: 7780
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 11453
length of database: 21,768,885
effective HSP length: 108
effective length of database: 16,873,461
effective search space used: 6934992471
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)