Animal-Genome cDNA 20060611C-006963


Search to RefSeqSP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611C-006963
         (1461 letters)

Database: RefSeqSP 
           1040 sequences; 434,620 total letters

Searching...done

 ***** No hits found ******

  Database: RefSeqSP
    Posted date:  Aug 1, 2006  7:14 PM
  Number of letters in database: 434,620
  Number of sequences in database:  1040
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,315,702
Number of Sequences: 1040
Number of extensions: 34944
Number of successful extensions: 258
Number of sequences better than 1.0e-05: 0
Number of HSP's better than  0.0 without gapping: 114
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 201
length of database: 434,620
effective HSP length: 80
effective length of database: 351,420
effective search space used: 142676520
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqBP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611C-006963
         (1461 letters)

Database: RefSeqBP 
           33,508 sequences; 16,112,626 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|XP_604169.2| PREDICTED: similar to malic enzyme 3, NADP(+)-d...   654   0.0  
Alignment   gi|XP_584500.2| PREDICTED: similar to NAD-dependent malic enzym...   453   e-127
Alignment   gi|XP_613987.2| PREDICTED: similar to NADP-dependent malic enzy...   214   2e-55
Alignment   gi|XP_596455.2| PREDICTED: similar to NADP-dependent malic enzy...   147   2e-35

>ref|XP_604169.2| PREDICTED: similar to malic enzyme 3, NADP(+)-dependent,
            mitochondrial [Bos taurus]
          Length = 564

 Score =  654 bits (1688), Expect = 0.0
 Identities = 326/352 (92%), Positives = 336/352 (95%)
 Frame = +2

Query: 404  MAFTLEERLQLGIHGLIPPCFLSQDVQLLRIMRYYERQQSDLDKYIILMTLQDRNEKLFY 583
            MAFTLEERLQLGIHGLIPPCFLSQDVQLLR+MRYYERQQSDLDKYIILMTLQDRNEKLFY
Sbjct: 1    MAFTLEERLQLGIHGLIPPCFLSQDVQLLRVMRYYERQQSDLDKYIILMTLQDRNEKLFY 60

Query: 584  RVLTSDVEKFMPIVYTPTVGLACQHYGLTFRRPRGLFITIHDKGHLPTMLNSWPEDDIKA 763
            RVLTSDVEKF+PIVYTPTVGLACQHYGLTFRRPRGLFIT+HDKGHL TMLNSWPEDDIKA
Sbjct: 61   RVLTSDVEKFLPIVYTPTVGLACQHYGLTFRRPRGLFITVHDKGHLATMLNSWPEDDIKA 120

Query: 764  VVVTDGERILGLGDLGCYGMGIPVGKLALYTACGGVNPRQCLPVLLDVGTNNEELLRDPL 943
            VVVTDGERILGLGDLGCYGMGIPVGKLALYTACGGVNPRQCLPVLLDVGTNNEELLRDPL
Sbjct: 121  VVVTDGERILGLGDLGCYGMGIPVGKLALYTACGGVNPRQCLPVLLDVGTNNEELLRDPL 180

Query: 944  YIGLKHRRVRGQDYDDLLDEFMQAVTDKFGINCLIQFEDFANANAFRLLNKYRNKYCMFN 1123
            YIGLKHRRVRGQ+YDDLLDEFMQAVTDKFGINCLIQFEDFANANAFRLLNKYRNKYCMFN
Sbjct: 181  YIGLKHRRVRGQEYDDLLDEFMQAVTDKFGINCLIQFEDFANANAFRLLNKYRNKYCMFN 240

Query: 1124 DDIQGTASVAVAGILAALRITKNKLSNHVFVFQGAGEAAMGIAHLLVMALEKGGVPKAEA 1303
            DDIQGTASVAVAGILAALRITKNKLSNHVFVFQGAGEAAMGIAHLLVMALEK G+ + E 
Sbjct: 241  DDIQGTASVAVAGILAALRITKNKLSNHVFVFQGAGEAAMGIAHLLVMALEKEGISRQE- 299

Query: 1304 TRKIWMVDSRGLIVKGRSHLNHEKEMFAQDHPEMSSLEEVVRLVNPTAIIGV 1459
                WM     L ++GRSHLNHEKEMFAQDHPE++SLEEVVRLV PTAIIGV
Sbjct: 300  ---YWMF---FLSLQGRSHLNHEKEMFAQDHPEVNSLEEVVRLVKPTAIIGV 345


>ref|XP_584500.2| PREDICTED: similar to NAD-dependent malic enzyme, mitochondrial
            precursor (NAD-ME) (Malic enzyme 2), partial [Bos taurus]
          Length = 513

 Score =  453 bits (1166), Expect = e-127
 Identities = 220/376 (58%), Positives = 284/376 (75%), Gaps = 3/376 (0%)
 Frame = +2

Query: 341  RPVPLKKRGYDVTRNPHLNKGMAFTLEERLQLGIHGLIPPCFLSQDVQLLRIMRYYERQQ 520
            R +  K++G  +  NP  NKGMAFTL+ER  LG+ GL+PP   +QD+Q LR  R  ++  
Sbjct: 92   RHLHTKEKGKPLMLNPRTNKGMAFTLQERQMLGLQGLLPPKIETQDIQALRFHRNLKKLN 151

Query: 521  SDLDKYIILMTLQDRNEKLFYRVLTSDVEKFMPIVYTPTVGLACQHYGLTFRRPRGLFIT 700
              L+KYI +M +Q+RNEKLFYR+L  D+E  MPIVYTPTVGLAC  YG  FRRP+GLFI+
Sbjct: 152  GPLEKYIYIMGIQERNEKLFYRILQDDIETLMPIVYTPTVGLACSQYGHIFRRPKGLFIS 211

Query: 701  IHDKGHLPTMLNSWPEDDIKAVVVTDGERILGLGDLGCYGMGIPVGKLALYTACGGVNPR 880
            I D+GH+ +++++WPE+ +KAVVVTDGERILGLGDLG YGMGIPVGKL LYTAC G+ P 
Sbjct: 212  ISDRGHVRSIVDNWPENHVKAVVVTDGERILGLGDLGVYGMGIPVGKLCLYTACAGIRPD 271

Query: 881  QCLPVLLDVGTNNEELLRDPLYIGLKHRRVRGQDYDDLLDEFMQAVTDKFGINCLIQFED 1060
            +CLPV +DVGT+N  LL+DP Y+GL  +R R Q YDDL+DEFM+A+TD++G N LIQFED
Sbjct: 272  RCLPVCIDVGTDNPALLKDPFYMGLYQKRDRSQRYDDLIDEFMKAITDRYGQNTLIQFED 331

Query: 1061 FANANAFRLLNKYRNKYCMFNDDIQGTASVAVAGILAALRITKNKLSNHVFVFQGAGEAA 1240
            F N NAFR L KYR KYC FNDDIQGTA+VA+AG+LAA ++    +S+H  +F GAGEAA
Sbjct: 332  FGNHNAFRFLRKYREKYCTFNDDIQGTAAVALAGLLAAQKVIGKPISDHRILFLGAGEAA 391

Query: 1241 MGIAHLLVMALEKGGVPKAEATRKIWMVDSRGLIVKGR-SHLNHEKEMFAQDHPEM--SS 1411
            +GIA+L+VMA+ + G+ + EA +KIWMVD  GL+ KGR + +   +E FA   PE    +
Sbjct: 392  LGIANLIVMAMVENGLSEEEARKKIWMVDKFGLLFKGRKAKIESHQEAFAHSAPESLPDT 451

Query: 1412 LEEVVRLVNPTAIIGV 1459
             EE V ++ P+AIIGV
Sbjct: 452  FEEAVNILKPSAIIGV 467


>ref|XP_613987.2| PREDICTED: similar to NADP-dependent malic enzyme (NADP-ME) (Malic
            enzyme 1) [Bos taurus]
          Length = 472

 Score =  214 bits (544), Expect = 2e-55
 Identities = 103/151 (68%), Positives = 127/151 (84%)
 Frame = +2

Query: 1007 MQAVTDKFGINCLIQFEDFANANAFRLLNKYRNKYCMFNDDIQGTASVAVAGILAALRIT 1186
            +  ++ ++G+NCLIQFEDFAN NAFRLL KY+N+YC FNDDIQGTASVAVAGILAALRIT
Sbjct: 130  VNVLSHRYGMNCLIQFEDFANINAFRLLRKYQNQYCTFNDDIQGTASVAVAGILAALRIT 189

Query: 1187 KNKLSNHVFVFQGAGEAAMGIAHLLVMALEKGGVPKAEATRKIWMVDSRGLIVKGRSHLN 1366
            KNKLS+   +FQGAGEAA+GIAHL+VMA+EK G+ K +A  KIW+VDS+GLIVKGR+ L 
Sbjct: 190  KNKLSDQTVLFQGAGEAALGIAHLIVMAMEKEGLSKEQAIEKIWLVDSKGLIVKGRAALT 249

Query: 1367 HEKEMFAQDHPEMSSLEEVVRLVNPTAIIGV 1459
             EKE FA +H EM +LE +V+ + PTA+IGV
Sbjct: 250  QEKEEFAHEHKEMKNLEAIVQDIKPTALIGV 280



 Score =  150 bits (380), Expect = 2e-36
 Identities = 71/108 (65%), Positives = 87/108 (80%), Gaps = 8/108 (7%)
 Frame = +2

Query: 404 MAFTLEERLQLGIHGLIPPCFLSQDVQLLRIMRYYERQQSDLDKYIILMTLQDRNEKLFY 583
           +AFTLEER QL IHGL+PP F+SQDVQ+LR+++ +ER  SD D+Y++LM LQDRNEKLFY
Sbjct: 15  LAFTLEERQQLNIHGLLPPSFISQDVQVLRVLKNFERLNSDFDRYLLLMDLQDRNEKLFY 74

Query: 584 RVLTSDVEKFMPIVYTPTVGLACQHYGLTFRRPR--------GLFITI 703
           +VL SD+EKFMPIVYTPTVGLACQ Y L FR+PR        GLF+ +
Sbjct: 75  KVLMSDIEKFMPIVYTPTVGLACQQYSLAFRKPRFNVLVTSYGLFLNV 122


>ref|XP_596455.2| PREDICTED: similar to NADP-dependent malic enzyme (NADP-ME) (Malic
           enzyme 1) [Bos taurus]
          Length = 157

 Score =  147 bits (372), Expect = 2e-35
 Identities = 66/80 (82%), Positives = 76/80 (95%)
 Frame = +2

Query: 683 RGLFITIHDKGHLPTMLNSWPEDDIKAVVVTDGERILGLGDLGCYGMGIPVGKLALYTAC 862
           RGLFI+IHD+GH+ ++LN+WPED IKA+VVTDGERILGLGDLGC GMGIPVGKLALYTAC
Sbjct: 72  RGLFISIHDRGHISSVLNAWPEDVIKAIVVTDGERILGLGDLGCNGMGIPVGKLALYTAC 131

Query: 863 GGVNPRQCLPVLLDVGTNNE 922
           GG+NP+QCLPV+LDVGT NE
Sbjct: 132 GGMNPQQCLPVMLDVGTENE 151


  Database: RefSeqBP
    Posted date:  Aug 1, 2006  7:14 PM
  Number of letters in database: 16,112,626
  Number of sequences in database:  33,508
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 50,028,891
Number of Sequences: 33508
Number of extensions: 1390925
Number of successful extensions: 9001
Number of sequences better than 1.0e-05: 4
Number of HSP's better than  0.0 without gapping: 5152
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 8223
length of database: 16,112,626
effective HSP length: 105
effective length of database: 12,594,286
effective search space used: 4798422966
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqCP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611C-006963
         (1461 letters)

Database: RefSeqCP 
           33,732 sequences; 19,266,565 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|XP_848770.1| PREDICTED: similar to malic enzyme 3, NADP(+)-d...   758   0.0  
Alignment   gi|XP_857177.1| PREDICTED: similar to malic enzyme 3, NADP(+)-d...   687   0.0  
Alignment   gi|XP_857051.1| PREDICTED: similar to malic enzyme 3, NADP(+)-d...   687   0.0  
Alignment   gi|XP_857135.1| PREDICTED: similar to malic enzyme 3, NADP(+)-d...   683   0.0  
Alignment   gi|XP_542269.2| PREDICTED: similar to malic enzyme 3, NADP(+)-d...   674   0.0  
Alignment   gi|XP_857227.1| PREDICTED: similar to malic enzyme 3, NADP(+)-d...   671   0.0  
Alignment   gi|XP_532217.2| PREDICTED: similar to NADP-dependent malic enzy...   554   e-158
Alignment   gi|XP_849530.1| PREDICTED: similar to NAD-dependent malic enzym...   452   e-127
Alignment   gi|XP_533402.2| PREDICTED: similar to NAD-dependent malic enzym...   390   e-108
Alignment   gi|XP_857091.1| PREDICTED: similar to NADP-dependent malic enzy...    74   3e-13

>ref|XP_848770.1| PREDICTED: similar to malic enzyme 3, NADP(+)-dependent,
            mitochondrial isoform 2 [Canis familiaris]
          Length = 604

 Score =  758 bits (1957), Expect = 0.0
 Identities = 378/414 (91%), Positives = 388/414 (93%)
 Frame = +2

Query: 218  MGASLGSGARVALLPRQACGAVXXXXXXXXXXDCHSKTGLPRPVPLKKRGYDVTRNPHLN 397
            MGA+LG GAR  LL  +A GAV           C S+ G  RPVPLKKRGYDVTRNPHLN
Sbjct: 1    MGAALGRGARPGLLRGKAWGAVPRWTPSAPGRGCRSRAGPARPVPLKKRGYDVTRNPHLN 60

Query: 398  KGMAFTLEERLQLGIHGLIPPCFLSQDVQLLRIMRYYERQQSDLDKYIILMTLQDRNEKL 577
            KGMAFTLEERLQLGIHGLIPPCFLSQDVQLLRIMRYYERQQSDLDKYIILMTLQDRNEKL
Sbjct: 61   KGMAFTLEERLQLGIHGLIPPCFLSQDVQLLRIMRYYERQQSDLDKYIILMTLQDRNEKL 120

Query: 578  FYRVLTSDVEKFMPIVYTPTVGLACQHYGLTFRRPRGLFITIHDKGHLPTMLNSWPEDDI 757
            FYRVLTSDVEKFMPIVYTPTVGLACQ YGLTFRRPRGLFITIHDKGHL TMLNSWPEDDI
Sbjct: 121  FYRVLTSDVEKFMPIVYTPTVGLACQQYGLTFRRPRGLFITIHDKGHLATMLNSWPEDDI 180

Query: 758  KAVVVTDGERILGLGDLGCYGMGIPVGKLALYTACGGVNPRQCLPVLLDVGTNNEELLRD 937
            KAVVVTDGERILGLGDLGCYGMGIPVGKLALYTACGGV+P+QCLPVLLDVGTNNEELLRD
Sbjct: 181  KAVVVTDGERILGLGDLGCYGMGIPVGKLALYTACGGVSPQQCLPVLLDVGTNNEELLRD 240

Query: 938  PLYIGLKHRRVRGQDYDDLLDEFMQAVTDKFGINCLIQFEDFANANAFRLLNKYRNKYCM 1117
            PLYIGLKH+RVRG++YDDLLDEFMQAVTDKFGINCLIQFEDFANANAFRLLNKYRNKYCM
Sbjct: 241  PLYIGLKHQRVRGKEYDDLLDEFMQAVTDKFGINCLIQFEDFANANAFRLLNKYRNKYCM 300

Query: 1118 FNDDIQGTASVAVAGILAALRITKNKLSNHVFVFQGAGEAAMGIAHLLVMALEKGGVPKA 1297
            FNDDIQGTASVAVAGILAALRITKNKLSNHVFVFQGAGEAAMGIAHLLVMALEK GVPKA
Sbjct: 301  FNDDIQGTASVAVAGILAALRITKNKLSNHVFVFQGAGEAAMGIAHLLVMALEKEGVPKA 360

Query: 1298 EATRKIWMVDSRGLIVKGRSHLNHEKEMFAQDHPEMSSLEEVVRLVNPTAIIGV 1459
            EATRKIWMVDS+GLIVKGRSHLNHEKEMFAQDHPE+ SLEEVVRLV PTAIIGV
Sbjct: 361  EATRKIWMVDSKGLIVKGRSHLNHEKEMFAQDHPEVKSLEEVVRLVKPTAIIGV 414


>ref|XP_857177.1| PREDICTED: similar to malic enzyme 3, NADP(+)-dependent,
            mitochondrial isoform 6 [Canis familiaris]
          Length = 513

 Score =  687 bits (1772), Expect = 0.0
 Identities = 339/351 (96%), Positives = 346/351 (98%)
 Frame = +2

Query: 404  MAFTLEERLQLGIHGLIPPCFLSQDVQLLRIMRYYERQQSDLDKYIILMTLQDRNEKLFY 583
            MAFTLEERLQLGIHGLIPPCFLSQDVQLLRIMRYYERQQSDLDKYIILMTLQDRNEKLFY
Sbjct: 1    MAFTLEERLQLGIHGLIPPCFLSQDVQLLRIMRYYERQQSDLDKYIILMTLQDRNEKLFY 60

Query: 584  RVLTSDVEKFMPIVYTPTVGLACQHYGLTFRRPRGLFITIHDKGHLPTMLNSWPEDDIKA 763
            RVLTSDVEKFMPIVYTPTVGLACQ YGLTFRRPRGLFITIHDKGHL TMLNSWPEDDIKA
Sbjct: 61   RVLTSDVEKFMPIVYTPTVGLACQQYGLTFRRPRGLFITIHDKGHLATMLNSWPEDDIKA 120

Query: 764  VVVTDGERILGLGDLGCYGMGIPVGKLALYTACGGVNPRQCLPVLLDVGTNNEELLRDPL 943
            VVVTDGERILGLGDLGCYGMGIPVGKLALYTACGGV+P+QCLPVLLDVGTNNEELLRDPL
Sbjct: 121  VVVTDGERILGLGDLGCYGMGIPVGKLALYTACGGVSPQQCLPVLLDVGTNNEELLRDPL 180

Query: 944  YIGLKHRRVRGQDYDDLLDEFMQAVTDKFGINCLIQFEDFANANAFRLLNKYRNKYCMFN 1123
            YIGLKH+RVRG++YDDLLDEFMQAVTDKFGINCLIQFEDFANANAFRLLNKYRNKYCMFN
Sbjct: 181  YIGLKHQRVRGKEYDDLLDEFMQAVTDKFGINCLIQFEDFANANAFRLLNKYRNKYCMFN 240

Query: 1124 DDIQGTASVAVAGILAALRITKNKLSNHVFVFQGAGEAAMGIAHLLVMALEKGGVPKAEA 1303
            DDIQGTASVAVAGILAALRITKNKLSNHVFVFQGAGEAAMGIAHLLVMALEK GVPKAEA
Sbjct: 241  DDIQGTASVAVAGILAALRITKNKLSNHVFVFQGAGEAAMGIAHLLVMALEKEGVPKAEA 300

Query: 1304 TRKIWMVDSRGLIVKGRSHLNHEKEMFAQDHPEMSSLEEVVRLVNPTAIIG 1456
            TRKIWMVDS+GLIVKGRSHLNHEKEMFAQDHPE+ SLEEVVRLV PTAIIG
Sbjct: 301  TRKIWMVDSKGLIVKGRSHLNHEKEMFAQDHPEVKSLEEVVRLVKPTAIIG 351


>ref|XP_857051.1| PREDICTED: similar to malic enzyme 3, NADP(+)-dependent,
            mitochondrial isoform 3 [Canis familiaris]
          Length = 361

 Score =  687 bits (1772), Expect = 0.0
 Identities = 339/351 (96%), Positives = 346/351 (98%)
 Frame = +2

Query: 404  MAFTLEERLQLGIHGLIPPCFLSQDVQLLRIMRYYERQQSDLDKYIILMTLQDRNEKLFY 583
            MAFTLEERLQLGIHGLIPPCFLSQDVQLLRIMRYYERQQSDLDKYIILMTLQDRNEKLFY
Sbjct: 1    MAFTLEERLQLGIHGLIPPCFLSQDVQLLRIMRYYERQQSDLDKYIILMTLQDRNEKLFY 60

Query: 584  RVLTSDVEKFMPIVYTPTVGLACQHYGLTFRRPRGLFITIHDKGHLPTMLNSWPEDDIKA 763
            RVLTSDVEKFMPIVYTPTVGLACQ YGLTFRRPRGLFITIHDKGHL TMLNSWPEDDIKA
Sbjct: 61   RVLTSDVEKFMPIVYTPTVGLACQQYGLTFRRPRGLFITIHDKGHLATMLNSWPEDDIKA 120

Query: 764  VVVTDGERILGLGDLGCYGMGIPVGKLALYTACGGVNPRQCLPVLLDVGTNNEELLRDPL 943
            VVVTDGERILGLGDLGCYGMGIPVGKLALYTACGGV+P+QCLPVLLDVGTNNEELLRDPL
Sbjct: 121  VVVTDGERILGLGDLGCYGMGIPVGKLALYTACGGVSPQQCLPVLLDVGTNNEELLRDPL 180

Query: 944  YIGLKHRRVRGQDYDDLLDEFMQAVTDKFGINCLIQFEDFANANAFRLLNKYRNKYCMFN 1123
            YIGLKH+RVRG++YDDLLDEFMQAVTDKFGINCLIQFEDFANANAFRLLNKYRNKYCMFN
Sbjct: 181  YIGLKHQRVRGKEYDDLLDEFMQAVTDKFGINCLIQFEDFANANAFRLLNKYRNKYCMFN 240

Query: 1124 DDIQGTASVAVAGILAALRITKNKLSNHVFVFQGAGEAAMGIAHLLVMALEKGGVPKAEA 1303
            DDIQGTASVAVAGILAALRITKNKLSNHVFVFQGAGEAAMGIAHLLVMALEK GVPKAEA
Sbjct: 241  DDIQGTASVAVAGILAALRITKNKLSNHVFVFQGAGEAAMGIAHLLVMALEKEGVPKAEA 300

Query: 1304 TRKIWMVDSRGLIVKGRSHLNHEKEMFAQDHPEMSSLEEVVRLVNPTAIIG 1456
            TRKIWMVDS+GLIVKGRSHLNHEKEMFAQDHPE+ SLEEVVRLV PTAIIG
Sbjct: 301  TRKIWMVDSKGLIVKGRSHLNHEKEMFAQDHPEVKSLEEVVRLVKPTAIIG 351


>ref|XP_857135.1| PREDICTED: similar to malic enzyme 3, NADP(+)-dependent,
            mitochondrial isoform 5 [Canis familiaris]
          Length = 573

 Score =  683 bits (1762), Expect = 0.0
 Identities = 340/355 (95%), Positives = 347/355 (97%), Gaps = 3/355 (0%)
 Frame = +2

Query: 404  MAFTLEERLQLGIHGLIPPCFLSQDVQLLRIMRYYERQQSDLDKYIILMTLQDRNEKLFY 583
            MAFTLEERLQLGIHGLIPPCFLSQDVQLLRIMRYYERQQSDLDKYIILMTLQDRNEKLFY
Sbjct: 1    MAFTLEERLQLGIHGLIPPCFLSQDVQLLRIMRYYERQQSDLDKYIILMTLQDRNEKLFY 60

Query: 584  RVLTSDVEKFMPIVYTPTVGLACQHYGLTFRRPRGLFITIHDKGHLPTMLNSWPEDDIKA 763
            RVLTSDVEKFMPIVYTPTVGLACQ YGLTFRRPRGLFITIHDKGHL TMLNSWPEDDIKA
Sbjct: 61   RVLTSDVEKFMPIVYTPTVGLACQQYGLTFRRPRGLFITIHDKGHLATMLNSWPEDDIKA 120

Query: 764  VVVTDGERILGLGDLGCYGMGIPVGKLALYTACGGVNPRQCLPVLLDVGTNNEELLRDPL 943
            VVVTDGERILGLGDLGCYGMGIPVGKLALYTACGGV+P+QCLPVLLDVGTNNEELLRDPL
Sbjct: 121  VVVTDGERILGLGDLGCYGMGIPVGKLALYTACGGVSPQQCLPVLLDVGTNNEELLRDPL 180

Query: 944  YIGLKHRRVRGQDYDDLLDEFMQAVTDKFGINCLIQFEDFANANAFRLLNKYRNKYCMFN 1123
            YIGLKH+RVRG++YDDLLDEFMQAVTDKFGINCLIQFEDFANANAFRLLNKYRNKYCMFN
Sbjct: 181  YIGLKHQRVRGKEYDDLLDEFMQAVTDKFGINCLIQFEDFANANAFRLLNKYRNKYCMFN 240

Query: 1124 DDIQGTASVAVAGILAALRITKNKLSNHVFVFQGAGEAAMGIAHLLVMALEKGGVPKAEA 1303
            DDIQGTASVAVAGILAALRITKNKLSNHVFVFQGAGEAAMGIAHLLVMALEK GVPKAEA
Sbjct: 241  DDIQGTASVAVAGILAALRITKNKLSNHVFVFQGAGEAAMGIAHLLVMALEKEGVPKAEA 300

Query: 1304 TRKIWMVDSRGLIVK---GRSHLNHEKEMFAQDHPEMSSLEEVVRLVNPTAIIGV 1459
            TRKIWMVDS+GLIVK   GRSHLNHEKEMFAQDHPE+ SLEEVVRLV PTAIIGV
Sbjct: 301  TRKIWMVDSKGLIVKVLSGRSHLNHEKEMFAQDHPEVKSLEEVVRLVKPTAIIGV 355


>ref|XP_542269.2| PREDICTED: similar to malic enzyme 3, NADP(+)-dependent,
            mitochondrial isoform 1 [Canis familiaris]
          Length = 569

 Score =  674 bits (1738), Expect = 0.0
 Identities = 340/379 (89%), Positives = 347/379 (91%), Gaps = 27/379 (7%)
 Frame = +2

Query: 404  MAFTLEERLQLGIHGLIPPCFLSQDVQLLRIMRYYERQQSDLDKYIILMTLQDRNEKLFY 583
            MAFTLEERLQLGIHGLIPPCFLSQDVQLLRIMRYYERQQSDLDKYIILMTLQDRNEKLFY
Sbjct: 1    MAFTLEERLQLGIHGLIPPCFLSQDVQLLRIMRYYERQQSDLDKYIILMTLQDRNEKLFY 60

Query: 584  RVLTSDVEKFMPIVYTPTVGLACQHYGLTFRRPR-------------------------- 685
            RVLTSDVEKFMPIVYTPTVGLACQ YGLTFRRPR                          
Sbjct: 61   RVLTSDVEKFMPIVYTPTVGLACQQYGLTFRRPRSAKEGLRGESHYGVDSLSSEGLSCSA 120

Query: 686  -GLFITIHDKGHLPTMLNSWPEDDIKAVVVTDGERILGLGDLGCYGMGIPVGKLALYTAC 862
             GLFITIHDKGHL TMLNSWPEDDIKAVVVTDGERILGLGDLGCYGMGIPVGKLALYTAC
Sbjct: 121  RGLFITIHDKGHLATMLNSWPEDDIKAVVVTDGERILGLGDLGCYGMGIPVGKLALYTAC 180

Query: 863  GGVNPRQCLPVLLDVGTNNEELLRDPLYIGLKHRRVRGQDYDDLLDEFMQAVTDKFGINC 1042
            GGV+P+QCLPVLLDVGTNNEELLRDPLYIGLKH+RVRG++YDDLLDEFMQAVTDKFGINC
Sbjct: 181  GGVSPQQCLPVLLDVGTNNEELLRDPLYIGLKHQRVRGKEYDDLLDEFMQAVTDKFGINC 240

Query: 1043 LIQFEDFANANAFRLLNKYRNKYCMFNDDIQGTASVAVAGILAALRITKNKLSNHVFVFQ 1222
            LIQFEDFANANAFRLLNKYRNKYCMFNDDIQGTASVAVAGILAALRITKNKLSNHVFVFQ
Sbjct: 241  LIQFEDFANANAFRLLNKYRNKYCMFNDDIQGTASVAVAGILAALRITKNKLSNHVFVFQ 300

Query: 1223 GAGEAAMGIAHLLVMALEKGGVPKAEATRKIWMVDSRGLIVKGRSHLNHEKEMFAQDHPE 1402
            GAGEAAMGIAHLLVMALEK GVPKAEATRKIWMVDS+GLIVKGRSHLNHEKEMFAQDHPE
Sbjct: 301  GAGEAAMGIAHLLVMALEKEGVPKAEATRKIWMVDSKGLIVKGRSHLNHEKEMFAQDHPE 360

Query: 1403 MSSLEEVVRLVNPTAIIGV 1459
            + SLEEVVRLV PTAIIGV
Sbjct: 361  VKSLEEVVRLVKPTAIIGV 379


>ref|XP_857227.1| PREDICTED: similar to malic enzyme 3, NADP(+)-dependent,
            mitochondrial isoform 7 [Canis familiaris]
          Length = 562

 Score =  671 bits (1730), Expect = 0.0
 Identities = 337/372 (90%), Positives = 345/372 (92%), Gaps = 20/372 (5%)
 Frame = +2

Query: 404  MAFTLEERLQLGIHGLIPPCFLSQDVQLLRIMRYYERQQSDLDKYIILMTLQDRNEKLFY 583
            MAFTLEERLQLGIHGLIPPCFLSQDVQLLRIMRYYERQQSDLDKYIILMTLQDRNEKLFY
Sbjct: 1    MAFTLEERLQLGIHGLIPPCFLSQDVQLLRIMRYYERQQSDLDKYIILMTLQDRNEKLFY 60

Query: 584  RVLTSDVEKFMPIVYTPTVGLACQHYGLTFRRPRGLFITIHDKGHLPTMLNSWPEDDIKA 763
            RVLTSDVEKFMPIVYTPTVGLACQ YGLTFRRPRGLFITIHDKGHL TMLNSWPEDDIKA
Sbjct: 61   RVLTSDVEKFMPIVYTPTVGLACQQYGLTFRRPRGLFITIHDKGHLATMLNSWPEDDIKA 120

Query: 764  VVVTDGERILGLGDLGCYGMGIPVGKLALYTACGGVNPRQCLPVLLDVGTNNEELLRDPL 943
            VVVTDGERILGLGDLGCYGMGIPVGKLALYTACGGV+P+QCLPVLLDVGTNNEELLRDPL
Sbjct: 121  VVVTDGERILGLGDLGCYGMGIPVGKLALYTACGGVSPQQCLPVLLDVGTNNEELLRDPL 180

Query: 944  YIGLKHRRVRGQDYDDLLDEFMQAVTDKFGINCLIQFEDFANANAFRLLNKYRNKYCMFN 1123
            YIGLKH+RVRG++YDDLLDEFMQAVTDKFGINCLIQFEDFANANAFRLLNKYRNKYCMFN
Sbjct: 181  YIGLKHQRVRGKEYDDLLDEFMQAVTDKFGINCLIQFEDFANANAFRLLNKYRNKYCMFN 240

Query: 1124 DDIQGTASVAVAGILAALRITKNKLSNHVFVFQGAGEAAMGIAHLLVMALEKGGVPKAEA 1303
            DDIQGTASVAVAGILAALRITKNKLSNHVFVFQGAGEAAMGIAHLLVMALEK GVPKAEA
Sbjct: 241  DDIQGTASVAVAGILAALRITKNKLSNHVFVFQGAGEAAMGIAHLLVMALEKEGVPKAEA 300

Query: 1304 TRKIWMVDSRGLIVK--------------------GRSHLNHEKEMFAQDHPEMSSLEEV 1423
            TRKIWMVDS+GLIVK                     + HLNHEKEMFAQDHPE+ SLEEV
Sbjct: 301  TRKIWMVDSKGLIVKVLSSSYQCLACNECVIMPADPKDHLNHEKEMFAQDHPEVKSLEEV 360

Query: 1424 VRLVNPTAIIGV 1459
            VRLV PTAIIGV
Sbjct: 361  VRLVKPTAIIGV 372


>ref|XP_532217.2| PREDICTED: similar to NADP-dependent malic enzyme (NADP-ME) (Malic
            enzyme 1) [Canis familiaris]
          Length = 634

 Score =  554 bits (1428), Expect = e-158
 Identities = 261/352 (74%), Positives = 311/352 (88%)
 Frame = +2

Query: 404  MAFTLEERLQLGIHGLIPPCFLSQDVQLLRIMRYYERQQSDLDKYIILMTLQDRNEKLFY 583
            +AFTLEER QL IHGL+PPCF+SQD+Q+LRI++ +ER  SD D+Y++LM LQDRNEKLFY
Sbjct: 90   LAFTLEERQQLNIHGLLPPCFISQDIQVLRIIKNFERLTSDFDRYLLLMDLQDRNEKLFY 149

Query: 584  RVLTSDVEKFMPIVYTPTVGLACQHYGLTFRRPRGLFITIHDKGHLPTMLNSWPEDDIKA 763
             VL SD+EKFMPIVYTPTVGLACQ Y L FR+PRGLFI+IHD+GH+ ++LN+WPED IKA
Sbjct: 150  SVLMSDLEKFMPIVYTPTVGLACQQYSLAFRKPRGLFISIHDRGHIASVLNAWPEDVIKA 209

Query: 764  VVVTDGERILGLGDLGCYGMGIPVGKLALYTACGGVNPRQCLPVLLDVGTNNEELLRDPL 943
            +VVTDGERILGLGDLGC GMGIPVGKLALYTACGG+NP++CLPV+LDVGT NE LL+DPL
Sbjct: 210  IVVTDGERILGLGDLGCNGMGIPVGKLALYTACGGMNPQECLPVILDVGTENEALLKDPL 269

Query: 944  YIGLKHRRVRGQDYDDLLDEFMQAVTDKFGINCLIQFEDFANANAFRLLNKYRNKYCMFN 1123
            YIGL+ RRVRG +YDD LDEFM+AV+ K+G+NCLIQFEDFAN NAFRLL KY+N+YC FN
Sbjct: 270  YIGLRQRRVRGPEYDDFLDEFMEAVSSKYGMNCLIQFEDFANINAFRLLKKYQNRYCTFN 329

Query: 1124 DDIQGTASVAVAGILAALRITKNKLSNHVFVFQGAGEAAMGIAHLLVMALEKGGVPKAEA 1303
            DDIQGTASVAVAGILAALRITKNKLS+   +FQGAGEAA+GIAHL+VMA+EK G+PK +A
Sbjct: 330  DDIQGTASVAVAGILAALRITKNKLSDQKILFQGAGEAALGIAHLIVMAMEKEGLPKEKA 389

Query: 1304 TRKIWMVDSRGLIVKGRSHLNHEKEMFAQDHPEMSSLEEVVRLVNPTAIIGV 1459
             + IW+VDS+GLIVKGR+ L  EKE FA +H EM +LE +V+ + PTA+IGV
Sbjct: 390  MKNIWLVDSKGLIVKGRAALTQEKEQFAHEHEEMKNLEAIVQEIKPTALIGV 441


>ref|XP_849530.1| PREDICTED: similar to NAD-dependent malic enzyme, mitochondrial
            precursor (NAD-ME) (Malic enzyme 2) isoform 2 [Canis
            familiaris]
          Length = 584

 Score =  452 bits (1163), Expect = e-127
 Identities = 217/376 (57%), Positives = 284/376 (75%), Gaps = 3/376 (0%)
 Frame = +2

Query: 341  RPVPLKKRGYDVTRNPHLNKGMAFTLEERLQLGIHGLIPPCFLSQDVQLLRIMRYYERQQ 520
            R + +K++G  +  NP  NKGMAFTL+ER  LG+ GL+PP   +QD+Q LR  +  ++  
Sbjct: 17   RHIHIKEKGKPLMLNPRTNKGMAFTLQERQMLGLQGLLPPKIETQDIQALRFHKNVKKMN 76

Query: 521  SDLDKYIILMTLQDRNEKLFYRVLTSDVEKFMPIVYTPTVGLACQHYGLTFRRPRGLFIT 700
              L+KYI +M +Q+RNEKLFYR+L  D+E  MPIVYTPTVGLAC  YG  FRRP+GLFI+
Sbjct: 77   GPLEKYIYIMGIQERNEKLFYRILQDDIESLMPIVYTPTVGLACSQYGHIFRRPKGLFIS 136

Query: 701  IHDKGHLPTMLNSWPEDDIKAVVVTDGERILGLGDLGCYGMGIPVGKLALYTACGGVNPR 880
            I D+GH+ +++++WPE+ +KAVVVTDGERILGLGDLG YGMGIPVGKL LYTAC G+ P 
Sbjct: 137  ISDRGHVRSIVDNWPENHVKAVVVTDGERILGLGDLGVYGMGIPVGKLCLYTACAGIRPD 196

Query: 881  QCLPVLLDVGTNNEELLRDPLYIGLKHRRVRGQDYDDLLDEFMQAVTDKFGINCLIQFED 1060
            +CLPV +DVGT+N  LL+DP Y+GL  +R R Q YDDL+DEFM+A+TD++G N LIQFED
Sbjct: 197  RCLPVCIDVGTDNPALLKDPFYMGLYQKRDRSQRYDDLIDEFMKAITDRYGQNTLIQFED 256

Query: 1061 FANANAFRLLNKYRNKYCMFNDDIQGTASVAVAGILAALRITKNKLSNHVFVFQGAGEAA 1240
            F N NAFR L KYR KYC FNDDIQGTA+VA+AG+LAA ++     S H  +F GAGEAA
Sbjct: 257  FGNHNAFRFLRKYREKYCTFNDDIQGTAAVALAGLLAAQKVIGKSFSEHKILFLGAGEAA 316

Query: 1241 MGIAHLLVMALEKGGVPKAEATRKIWMVDSRGLIVKGR-SHLNHEKEMFAQDHPEM--SS 1411
            +GIA+L+VMA+ + G+ + EA +KIWMVD  GL+ KGR + + + +E FA   P +   +
Sbjct: 317  LGIANLIVMAMVENGLSEEEAQKKIWMVDKFGLLFKGRKAKIENHQEPFAHSAPGIIPDT 376

Query: 1412 LEEVVRLVNPTAIIGV 1459
             E+ V ++ P+AIIGV
Sbjct: 377  FEDAVNILRPSAIIGV 392


>ref|XP_533402.2| PREDICTED: similar to NAD-dependent malic enzyme, mitochondrial
            precursor (NAD-ME) (Malic enzyme 2) isoform 1 [Canis
            familiaris]
          Length = 499

 Score =  390 bits (1003), Expect = e-108
 Identities = 187/307 (60%), Positives = 239/307 (77%), Gaps = 3/307 (0%)
 Frame = +2

Query: 548  MTLQDRNEKLFYRVLTSDVEKFMPIVYTPTVGLACQHYGLTFRRPRGLFITIHDKGHLPT 727
            M +Q+RNEKLFYR+L  D+E  MPIVYTPTVGLAC  YG  FRRP+GLFI+I D+GH+ +
Sbjct: 1    MGIQERNEKLFYRILQDDIESLMPIVYTPTVGLACSQYGHIFRRPKGLFISISDRGHVRS 60

Query: 728  MLNSWPEDDIKAVVVTDGERILGLGDLGCYGMGIPVGKLALYTACGGVNPRQCLPVLLDV 907
            ++++WPE+ +KAVVVTDGERILGLGDLG YGMGIPVGKL LYTAC G+ P +CLPV +DV
Sbjct: 61   IVDNWPENHVKAVVVTDGERILGLGDLGVYGMGIPVGKLCLYTACAGIRPDRCLPVCIDV 120

Query: 908  GTNNEELLRDPLYIGLKHRRVRGQDYDDLLDEFMQAVTDKFGINCLIQFEDFANANAFRL 1087
            GT+N  LL+DP Y+GL  +R R Q YDDL+DEFM+A+TD++G N LIQFEDF N NAFR 
Sbjct: 121  GTDNPALLKDPFYMGLYQKRDRSQRYDDLIDEFMKAITDRYGQNTLIQFEDFGNHNAFRF 180

Query: 1088 LNKYRNKYCMFNDDIQGTASVAVAGILAALRITKNKLSNHVFVFQGAGEAAMGIAHLLVM 1267
            L KYR KYC FNDDIQGTA+VA+AG+LAA ++     S H  +F GAGEAA+GIA+L+VM
Sbjct: 181  LRKYREKYCTFNDDIQGTAAVALAGLLAAQKVIGKSFSEHKILFLGAGEAALGIANLIVM 240

Query: 1268 ALEKGGVPKAEATRKIWMVDSRGLIVKGR-SHLNHEKEMFAQDHPEM--SSLEEVVRLVN 1438
            A+ + G+ + EA +KIWMVD  GL+ KGR + + + +E FA   P +   + E+ V ++ 
Sbjct: 241  AMVENGLSEEEAQKKIWMVDKFGLLFKGRKAKIENHQEPFAHSAPGIIPDTFEDAVNILR 300

Query: 1439 PTAIIGV 1459
            P+AIIGV
Sbjct: 301  PSAIIGV 307


>ref|XP_857091.1| PREDICTED: similar to NADP-dependent malic enzyme, mitochondrial
            precursor (NADP-ME) (Malic enzyme 3) isoform 4 [Canis
            familiaris]
          Length = 231

 Score = 74.3 bits (181), Expect = 3e-13
 Identities = 35/38 (92%), Positives = 36/38 (94%)
 Frame = +2

Query: 1346 KGRSHLNHEKEMFAQDHPEMSSLEEVVRLVNPTAIIGV 1459
            KGRSHLNHEKEMFAQDHPE+ SLEEVVRLV PTAIIGV
Sbjct: 4    KGRSHLNHEKEMFAQDHPEVKSLEEVVRLVKPTAIIGV 41


  Database: RefSeqCP
    Posted date:  Aug 1, 2006  9:25 PM
  Number of letters in database: 19,266,565
  Number of sequences in database:  33,732
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 58,669,901
Number of Sequences: 33732
Number of extensions: 1639938
Number of successful extensions: 10696
Number of sequences better than 1.0e-05: 10
Number of HSP's better than  0.0 without gapping: 6141
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 9855
length of database: 19,266,565
effective HSP length: 107
effective length of database: 15,657,241
effective search space used: 5934094339
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqHP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611C-006963
         (1461 letters)

Database: RefSeqHP 
           39,411 sequences; 17,774,539 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_001014811.1| malic enzyme 3, NADP(+)-dependent, mitochond...   766   0.0  
Alignment   gi|NP_006671.2| malic enzyme 3, NADP(+)-dependent, mitochondria...   766   0.0  
Alignment   gi|NP_002386.1| cytosolic malic enzyme 1 [Homo sapiens]              586   e-167
Alignment   gi|NP_002387.1| malic enzyme 2, NAD(+)-dependent, mitochondrial...   451   e-127
Alignment   gi|XP_934770.1| PREDICTED: similar to NAD-dependent malic enzym...   238   1e-62
Alignment   gi|XP_944182.1| PREDICTED: similar to NAD-dependent malic enzym...   238   1e-62

>ref|NP_001014811.1| malic enzyme 3, NADP(+)-dependent, mitochondrial [Homo sapiens]
          Length = 604

 Score =  766 bits (1977), Expect = 0.0
 Identities = 379/414 (91%), Positives = 391/414 (94%)
 Frame = +2

Query: 218  MGASLGSGARVALLPRQACGAVXXXXXXXXXXDCHSKTGLPRPVPLKKRGYDVTRNPHLN 397
            MGA+LG+G R+A  P +ACGA+           CHSK G  RPVPLKKRGYDVTRNPHLN
Sbjct: 1    MGAALGTGTRLAPWPGRACGALPRWTPTAPAQGCHSKPGPARPVPLKKRGYDVTRNPHLN 60

Query: 398  KGMAFTLEERLQLGIHGLIPPCFLSQDVQLLRIMRYYERQQSDLDKYIILMTLQDRNEKL 577
            KGMAFTLEERLQLGIHGLIPPCFLSQDVQLLRIMRYYERQQSDLDKYIILMTLQDRNEKL
Sbjct: 61   KGMAFTLEERLQLGIHGLIPPCFLSQDVQLLRIMRYYERQQSDLDKYIILMTLQDRNEKL 120

Query: 578  FYRVLTSDVEKFMPIVYTPTVGLACQHYGLTFRRPRGLFITIHDKGHLPTMLNSWPEDDI 757
            FYRVLTSDVEKFMPIVYTPTVGLACQHYGLTFRRPRGLFITIHDKGHL TMLNSWPED+I
Sbjct: 121  FYRVLTSDVEKFMPIVYTPTVGLACQHYGLTFRRPRGLFITIHDKGHLATMLNSWPEDNI 180

Query: 758  KAVVVTDGERILGLGDLGCYGMGIPVGKLALYTACGGVNPRQCLPVLLDVGTNNEELLRD 937
            KAVVVTDGERILGLGDLGCYGMGIPVGKLALYTACGGVNP+QCLPVLLDVGTNNEELLRD
Sbjct: 181  KAVVVTDGERILGLGDLGCYGMGIPVGKLALYTACGGVNPQQCLPVLLDVGTNNEELLRD 240

Query: 938  PLYIGLKHRRVRGQDYDDLLDEFMQAVTDKFGINCLIQFEDFANANAFRLLNKYRNKYCM 1117
            PLYIGLKH+RV G+ YDDLLDEFMQAVTDKFGINCLIQFEDFANANAFRLLNKYRNKYCM
Sbjct: 241  PLYIGLKHQRVHGKAYDDLLDEFMQAVTDKFGINCLIQFEDFANANAFRLLNKYRNKYCM 300

Query: 1118 FNDDIQGTASVAVAGILAALRITKNKLSNHVFVFQGAGEAAMGIAHLLVMALEKGGVPKA 1297
            FNDDIQGTASVAVAGILAALRITKNKLSNHVFVFQGAGEAAMGIAHLLVMALEK GVPKA
Sbjct: 301  FNDDIQGTASVAVAGILAALRITKNKLSNHVFVFQGAGEAAMGIAHLLVMALEKEGVPKA 360

Query: 1298 EATRKIWMVDSRGLIVKGRSHLNHEKEMFAQDHPEMSSLEEVVRLVNPTAIIGV 1459
            EATRKIWMVDS+GLIVKGRSHLNHEKEMFAQDHPE++SLEEVVRLV PTAIIGV
Sbjct: 361  EATRKIWMVDSKGLIVKGRSHLNHEKEMFAQDHPEVNSLEEVVRLVKPTAIIGV 414


>ref|NP_006671.2| malic enzyme 3, NADP(+)-dependent, mitochondrial [Homo sapiens]
          Length = 604

 Score =  766 bits (1977), Expect = 0.0
 Identities = 379/414 (91%), Positives = 391/414 (94%)
 Frame = +2

Query: 218  MGASLGSGARVALLPRQACGAVXXXXXXXXXXDCHSKTGLPRPVPLKKRGYDVTRNPHLN 397
            MGA+LG+G R+A  P +ACGA+           CHSK G  RPVPLKKRGYDVTRNPHLN
Sbjct: 1    MGAALGTGTRLAPWPGRACGALPRWTPTAPAQGCHSKPGPARPVPLKKRGYDVTRNPHLN 60

Query: 398  KGMAFTLEERLQLGIHGLIPPCFLSQDVQLLRIMRYYERQQSDLDKYIILMTLQDRNEKL 577
            KGMAFTLEERLQLGIHGLIPPCFLSQDVQLLRIMRYYERQQSDLDKYIILMTLQDRNEKL
Sbjct: 61   KGMAFTLEERLQLGIHGLIPPCFLSQDVQLLRIMRYYERQQSDLDKYIILMTLQDRNEKL 120

Query: 578  FYRVLTSDVEKFMPIVYTPTVGLACQHYGLTFRRPRGLFITIHDKGHLPTMLNSWPEDDI 757
            FYRVLTSDVEKFMPIVYTPTVGLACQHYGLTFRRPRGLFITIHDKGHL TMLNSWPED+I
Sbjct: 121  FYRVLTSDVEKFMPIVYTPTVGLACQHYGLTFRRPRGLFITIHDKGHLATMLNSWPEDNI 180

Query: 758  KAVVVTDGERILGLGDLGCYGMGIPVGKLALYTACGGVNPRQCLPVLLDVGTNNEELLRD 937
            KAVVVTDGERILGLGDLGCYGMGIPVGKLALYTACGGVNP+QCLPVLLDVGTNNEELLRD
Sbjct: 181  KAVVVTDGERILGLGDLGCYGMGIPVGKLALYTACGGVNPQQCLPVLLDVGTNNEELLRD 240

Query: 938  PLYIGLKHRRVRGQDYDDLLDEFMQAVTDKFGINCLIQFEDFANANAFRLLNKYRNKYCM 1117
            PLYIGLKH+RV G+ YDDLLDEFMQAVTDKFGINCLIQFEDFANANAFRLLNKYRNKYCM
Sbjct: 241  PLYIGLKHQRVHGKAYDDLLDEFMQAVTDKFGINCLIQFEDFANANAFRLLNKYRNKYCM 300

Query: 1118 FNDDIQGTASVAVAGILAALRITKNKLSNHVFVFQGAGEAAMGIAHLLVMALEKGGVPKA 1297
            FNDDIQGTASVAVAGILAALRITKNKLSNHVFVFQGAGEAAMGIAHLLVMALEK GVPKA
Sbjct: 301  FNDDIQGTASVAVAGILAALRITKNKLSNHVFVFQGAGEAAMGIAHLLVMALEKEGVPKA 360

Query: 1298 EATRKIWMVDSRGLIVKGRSHLNHEKEMFAQDHPEMSSLEEVVRLVNPTAIIGV 1459
            EATRKIWMVDS+GLIVKGRSHLNHEKEMFAQDHPE++SLEEVVRLV PTAIIGV
Sbjct: 361  EATRKIWMVDSKGLIVKGRSHLNHEKEMFAQDHPEVNSLEEVVRLVKPTAIIGV 414


>ref|NP_002386.1| cytosolic malic enzyme 1 [Homo sapiens]
          Length = 572

 Score =  586 bits (1510), Expect = e-167
 Identities = 277/374 (74%), Positives = 328/374 (87%)
 Frame = +2

Query: 338  PRPVPLKKRGYDVTRNPHLNKGMAFTLEERLQLGIHGLIPPCFLSQDVQLLRIMRYYERQ 517
            PR     +RGY +TRNPHLNK +AFTLEER QL IHGL+PP F SQ++Q+LR+++ +E  
Sbjct: 6    PRRRHTHQRGYLLTRNPHLNKDLAFTLEERQQLNIHGLLPPSFNSQEIQVLRVVKNFEHL 65

Query: 518  QSDLDKYIILMTLQDRNEKLFYRVLTSDVEKFMPIVYTPTVGLACQHYGLTFRRPRGLFI 697
             SD D+Y++LM LQDRNEKLFYRVLTSD+EKFMPIVYTPTVGLACQ Y L FR+PRGLFI
Sbjct: 66   NSDFDRYLLLMDLQDRNEKLFYRVLTSDIEKFMPIVYTPTVGLACQQYSLVFRKPRGLFI 125

Query: 698  TIHDKGHLPTMLNSWPEDDIKAVVVTDGERILGLGDLGCYGMGIPVGKLALYTACGGVNP 877
            TIHD+GH+ ++LN+WPED IKA+VVTDGERILGLGDLGC GMGIPVGKLALYTACGG+NP
Sbjct: 126  TIHDRGHIASVLNAWPEDVIKAIVVTDGERILGLGDLGCNGMGIPVGKLALYTACGGMNP 185

Query: 878  RQCLPVLLDVGTNNEELLRDPLYIGLKHRRVRGQDYDDLLDEFMQAVTDKFGINCLIQFE 1057
            ++CLPV+LDVGT NEELL+DPLYIGL+ RRVRG +YDD LDEFM+AV+ K+G+NCLIQFE
Sbjct: 186  QECLPVILDVGTENEELLKDPLYIGLRQRRVRGSEYDDFLDEFMEAVSSKYGMNCLIQFE 245

Query: 1058 DFANANAFRLLNKYRNKYCMFNDDIQGTASVAVAGILAALRITKNKLSNHVFVFQGAGEA 1237
            DFAN NAFRLLNKYRN+YC FNDDIQGTASVAVAG+LAALRITKNKLS+   +FQGAGEA
Sbjct: 246  DFANVNAFRLLNKYRNQYCTFNDDIQGTASVAVAGLLAALRITKNKLSDQTILFQGAGEA 305

Query: 1238 AMGIAHLLVMALEKGGVPKAEATRKIWMVDSRGLIVKGRSHLNHEKEMFAQDHPEMSSLE 1417
            A+GIAHL+VMALEK G+PK +A +KIW+VDS+GLIVKGR+ L  EKE FA +H EM +LE
Sbjct: 306  ALGIAHLIVMALEKEGLPKEKAIKKIWLVDSKGLIVKGRASLTQEKEKFAHEHEEMKNLE 365

Query: 1418 EVVRLVNPTAIIGV 1459
             +V+ + PTA+IGV
Sbjct: 366  AIVQEIKPTALIGV 379


>ref|NP_002387.1| malic enzyme 2, NAD(+)-dependent, mitochondrial [Homo sapiens]
          Length = 584

 Score =  451 bits (1160), Expect = e-127
 Identities = 217/376 (57%), Positives = 284/376 (75%), Gaps = 3/376 (0%)
 Frame = +2

Query: 341  RPVPLKKRGYDVTRNPHLNKGMAFTLEERLQLGIHGLIPPCFLSQDVQLLRIMRYYERQQ 520
            R + +K++G  +  NP  NKGMAFTL+ER  LG+ GL+PP   +QD+Q LR  R  ++  
Sbjct: 17   RHLHIKEKGKPLMLNPRTNKGMAFTLQERQMLGLQGLLPPKIETQDIQALRFHRNLKKMT 76

Query: 521  SDLDKYIILMTLQDRNEKLFYRVLTSDVEKFMPIVYTPTVGLACQHYGLTFRRPRGLFIT 700
            S L+KYI +M +Q+RNEKLFYR+L  D+E  MPIVYTPTVGLAC  YG  FRRP+GLFI+
Sbjct: 77   SPLEKYIYIMGIQERNEKLFYRILQDDIESLMPIVYTPTVGLACSQYGHIFRRPKGLFIS 136

Query: 701  IHDKGHLPTMLNSWPEDDIKAVVVTDGERILGLGDLGCYGMGIPVGKLALYTACGGVNPR 880
            I D+GH+ +++++WPE+ +KAVVVTDGERILGLGDLG YGMGIPVGKL LYTAC G+ P 
Sbjct: 137  ISDRGHVRSIVDNWPENHVKAVVVTDGERILGLGDLGVYGMGIPVGKLCLYTACAGIRPD 196

Query: 881  QCLPVLLDVGTNNEELLRDPLYIGLKHRRVRGQDYDDLLDEFMQAVTDKFGINCLIQFED 1060
            +CLPV +DVGT+N  LL+DP Y+GL  +R R Q YDDL+DEFM+A+TD++G N LIQFED
Sbjct: 197  RCLPVCIDVGTDNIALLKDPFYMGLYQKRDRTQQYDDLIDEFMKAITDRYGRNTLIQFED 256

Query: 1061 FANANAFRLLNKYRNKYCMFNDDIQGTASVAVAGILAALRITKNKLSNHVFVFQGAGEAA 1240
            F N NAFR L KYR KYC FNDDIQGTA+VA+AG+LAA ++    +S H  +F GAGEAA
Sbjct: 257  FGNHNAFRFLRKYREKYCTFNDDIQGTAAVALAGLLAAQKVISKPISEHKILFLGAGEAA 316

Query: 1241 MGIAHLLVMALEKGGVPKAEATRKIWMVDSRGLIVKGR-SHLNHEKEMFAQDHPEM--SS 1411
            +GIA+L+VM++ + G+ + EA +KIWM D  GL+VKGR + ++  +E F    PE    +
Sbjct: 317  LGIANLIVMSMVENGLSEQEAQKKIWMFDKYGLLVKGRKAKIDSYQEPFTHSAPESIPDT 376

Query: 1412 LEEVVRLVNPTAIIGV 1459
             E+ V ++ P+ IIGV
Sbjct: 377  FEDAVNILKPSTIIGV 392


>ref|XP_934770.1| PREDICTED: similar to NAD-dependent malic enzyme, mitochondrial
            precursor (NAD-ME) (Malic enzyme 2) [Homo sapiens]
          Length = 196

 Score =  238 bits (607), Expect = 1e-62
 Identities = 111/194 (57%), Positives = 144/194 (74%)
 Frame = +2

Query: 521  SDLDKYIILMTLQDRNEKLFYRVLTSDVEKFMPIVYTPTVGLACQHYGLTFRRPRGLFIT 700
            S  + YI +M +Q+RN+KLFYR+L  D E  MPI YTPTVGL C   G  FRRP+GLFI+
Sbjct: 3    SPSENYIYIMGIQERNDKLFYRILQDDTESLMPIAYTPTVGLVCSQCGHLFRRPKGLFIS 62

Query: 701  IHDKGHLPTMLNSWPEDDIKAVVVTDGERILGLGDLGCYGMGIPVGKLALYTACGGVNPR 880
            I D+GH+ ++++ WPE+ +KAV+VTDGERILG GDLG YGMGIPVGK+ LYT C G+ P 
Sbjct: 63   ISDRGHVRSIVDKWPENHVKAVLVTDGERILGHGDLGVYGMGIPVGKICLYTVCPGIWPD 122

Query: 881  QCLPVLLDVGTNNEELLRDPLYIGLKHRRVRGQDYDDLLDEFMQAVTDKFGINCLIQFED 1060
            +CL V +DVG +N  LL+   Y+GL  +R R Q  DD +DEFM+A+TD++G N L+QFE 
Sbjct: 123  RCLLVCIDVGADNIALLKGTFYMGLYQKRDRTQQSDDPIDEFMKAITDRYGWNTLLQFEG 182

Query: 1061 FANANAFRLLNKYR 1102
            F + NAFR L KY+
Sbjct: 183  FGHHNAFRFLRKYQ 196


>ref|XP_944182.1| PREDICTED: similar to NAD-dependent malic enzyme, mitochondrial
            precursor (NAD-ME) (Malic enzyme 2) [Homo sapiens]
          Length = 196

 Score =  238 bits (607), Expect = 1e-62
 Identities = 111/194 (57%), Positives = 144/194 (74%)
 Frame = +2

Query: 521  SDLDKYIILMTLQDRNEKLFYRVLTSDVEKFMPIVYTPTVGLACQHYGLTFRRPRGLFIT 700
            S  + YI +M +Q+RN+KLFYR+L  D E  MPI YTPTVGL C   G  FRRP+GLFI+
Sbjct: 3    SPSENYIYIMGIQERNDKLFYRILQDDTESLMPIAYTPTVGLVCSQCGHLFRRPKGLFIS 62

Query: 701  IHDKGHLPTMLNSWPEDDIKAVVVTDGERILGLGDLGCYGMGIPVGKLALYTACGGVNPR 880
            I D+GH+ ++++ WPE+ +KAV+VTDGERILG GDLG YGMGIPVGK+ LYT C G+ P 
Sbjct: 63   ISDRGHVRSIVDKWPENHVKAVLVTDGERILGHGDLGVYGMGIPVGKICLYTVCPGIWPD 122

Query: 881  QCLPVLLDVGTNNEELLRDPLYIGLKHRRVRGQDYDDLLDEFMQAVTDKFGINCLIQFED 1060
            +CL V +DVG +N  LL+   Y+GL  +R R Q  DD +DEFM+A+TD++G N L+QFE 
Sbjct: 123  RCLLVCIDVGADNIALLKGTFYMGLYQKRDRTQQSDDPIDEFMKAITDRYGWNTLLQFEG 182

Query: 1061 FANANAFRLLNKYR 1102
            F + NAFR L KY+
Sbjct: 183  FGHHNAFRFLRKYQ 196


  Database: RefSeqHP
    Posted date:  Aug 2, 2006 12:57 AM
  Number of letters in database: 17,774,539
  Number of sequences in database:  39,411
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 57,255,978
Number of Sequences: 39411
Number of extensions: 1667909
Number of successful extensions: 12356
Number of sequences better than 1.0e-05: 6
Number of HSP's better than  0.0 without gapping: 6343
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 11264
length of database: 17,774,539
effective HSP length: 106
effective length of database: 13,596,973
effective search space used: 5166849740
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqMP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611C-006963
         (1461 letters)

Database: RefSeqMP 
           45,328 sequences; 21,768,885 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_852072.1| malic enzyme 3, NADP(+)-dependent, mitochondria...   759   0.0  
Alignment   gi|NP_032641.1| malic enzyme, supernatant [Mus musculus]             580   e-165
Alignment   gi|XP_001004685.1| PREDICTED: similar to NADP-dependent malic e...   557   e-159
Alignment   gi|XP_001004679.1| PREDICTED: similar to NADP-dependent malic e...   531   e-151
Alignment   gi|NP_663469.1| malic enzyme 2, NAD(+)-dependent, mitochondrial...   450   e-126
Alignment   gi|XP_001004683.1| PREDICTED: similar to NADP-dependent malic e...   336   3e-92
Alignment   gi|XP_001004682.1| PREDICTED: similar to NADP-dependent malic e...    84   5e-16

>ref|NP_852072.1| malic enzyme 3, NADP(+)-dependent, mitochondrial [Mus musculus]
          Length = 604

 Score =  759 bits (1959), Expect = 0.0
 Identities = 371/414 (89%), Positives = 390/414 (94%)
 Frame = +2

Query: 218  MGASLGSGARVALLPRQACGAVXXXXXXXXXXDCHSKTGLPRPVPLKKRGYDVTRNPHLN 397
            MGA+LG+GAR+  +PR AC ++           CHSK+G PRPVPLKKRGYDVTRNPHLN
Sbjct: 1    MGAALGTGARLTSVPRIACSSLRRQAPSAPAQGCHSKSGPPRPVPLKKRGYDVTRNPHLN 60

Query: 398  KGMAFTLEERLQLGIHGLIPPCFLSQDVQLLRIMRYYERQQSDLDKYIILMTLQDRNEKL 577
            KGMAFTLEERLQLGIHGLIPPCFLSQDVQLLRIMRYYE QQSDLDKYIILMT QDRNEKL
Sbjct: 61   KGMAFTLEERLQLGIHGLIPPCFLSQDVQLLRIMRYYENQQSDLDKYIILMTHQDRNEKL 120

Query: 578  FYRVLTSDVEKFMPIVYTPTVGLACQHYGLTFRRPRGLFITIHDKGHLPTMLNSWPEDDI 757
            FYRVLTSDVEKFMPIVYTPTVGLACQHYGLTFRRPRGLFITIHDKGH+ TMLNSWPED+I
Sbjct: 121  FYRVLTSDVEKFMPIVYTPTVGLACQHYGLTFRRPRGLFITIHDKGHIATMLNSWPEDNI 180

Query: 758  KAVVVTDGERILGLGDLGCYGMGIPVGKLALYTACGGVNPRQCLPVLLDVGTNNEELLRD 937
            KAVVVTDGERILGLGDLGCYGMGIPVGKLALYTACGGVNP+QCLPVLLDVGTNNEELLRD
Sbjct: 181  KAVVVTDGERILGLGDLGCYGMGIPVGKLALYTACGGVNPQQCLPVLLDVGTNNEELLRD 240

Query: 938  PLYIGLKHRRVRGQDYDDLLDEFMQAVTDKFGINCLIQFEDFANANAFRLLNKYRNKYCM 1117
            PLYIGLKH+RVRG++YDDLLDEFMQAVTDKFGINCLIQFEDFANANAFRLLNKYRNKYCM
Sbjct: 241  PLYIGLKHQRVRGEEYDDLLDEFMQAVTDKFGINCLIQFEDFANANAFRLLNKYRNKYCM 300

Query: 1118 FNDDIQGTASVAVAGILAALRITKNKLSNHVFVFQGAGEAAMGIAHLLVMALEKGGVPKA 1297
            FNDDIQGTASVAVAGILAALRITKN+LSNHVFVFQGA EAAMGIAHLLVMALEK G+PK 
Sbjct: 301  FNDDIQGTASVAVAGILAALRITKNRLSNHVFVFQGADEAAMGIAHLLVMALEKEGIPKT 360

Query: 1298 EATRKIWMVDSRGLIVKGRSHLNHEKEMFAQDHPEMSSLEEVVRLVNPTAIIGV 1459
            EA +KIWMVDS+GLIVKGRSHLNHEKEMFAQDHPE++SLEEVVRLV PTAIIGV
Sbjct: 361  EAIKKIWMVDSKGLIVKGRSHLNHEKEMFAQDHPEVNSLEEVVRLVKPTAIIGV 414


>ref|NP_032641.1| malic enzyme, supernatant [Mus musculus]
          Length = 572

 Score =  580 bits (1495), Expect = e-165
 Identities = 275/374 (73%), Positives = 325/374 (86%)
 Frame = +2

Query: 338  PRPVPLKKRGYDVTRNPHLNKGMAFTLEERLQLGIHGLIPPCFLSQDVQLLRIMRYYERQ 517
            PR     +RGY +TR+PHLNK +AFTLEER QL IHGL+PPC +SQ++Q+LRI++ +ER 
Sbjct: 6    PRRRHTHQRGYLLTRDPHLNKDLAFTLEERQQLNIHGLLPPCIISQELQVLRIIKNFERL 65

Query: 518  QSDLDKYIILMTLQDRNEKLFYRVLTSDVEKFMPIVYTPTVGLACQHYGLTFRRPRGLFI 697
             SD D+Y++LM LQDRNEKLFY VL SDVEKFMPIVYTPTVGLACQ Y L FR+PRGLFI
Sbjct: 66   NSDFDRYLLLMDLQDRNEKLFYSVLMSDVEKFMPIVYTPTVGLACQQYSLAFRKPRGLFI 125

Query: 698  TIHDKGHLPTMLNSWPEDDIKAVVVTDGERILGLGDLGCYGMGIPVGKLALYTACGGVNP 877
            +IHDKGH+ ++LN+WPED +KA+VVTDGERILGLGDLGC GMGIPVGKLALYTACGGVNP
Sbjct: 126  SIHDKGHIASVLNAWPEDVVKAIVVTDGERILGLGDLGCNGMGIPVGKLALYTACGGVNP 185

Query: 878  RQCLPVLLDVGTNNEELLRDPLYIGLKHRRVRGQDYDDLLDEFMQAVTDKFGINCLIQFE 1057
            +QCLP+ LDVGT NEELL+DPLYIGL+HRRVRG +YD  LDEFM+A + K+G+NCLIQFE
Sbjct: 186  QQCLPITLDVGTENEELLKDPLYIGLRHRRVRGPEYDAFLDEFMEAASSKYGMNCLIQFE 245

Query: 1058 DFANANAFRLLNKYRNKYCMFNDDIQGTASVAVAGILAALRITKNKLSNHVFVFQGAGEA 1237
            DFAN NAFRLLNKYRNKYC FNDDIQGTASVAVAG+LAALRITKNKLS+   +FQGAGEA
Sbjct: 246  DFANRNAFRLLNKYRNKYCTFNDDIQGTASVAVAGLLAALRITKNKLSDQTVLFQGAGEA 305

Query: 1238 AMGIAHLLVMALEKGGVPKAEATRKIWMVDSRGLIVKGRSHLNHEKEMFAQDHPEMSSLE 1417
            A+GIAHL+VMA+EK G+ K  A +KIW+VDS+GLIVKGR+ L  EKE+FA +H EM +LE
Sbjct: 306  ALGIAHLVVMAMEKEGLSKENARKKIWLVDSKGLIVKGRASLTEEKEVFAHEHEEMKNLE 365

Query: 1418 EVVRLVNPTAIIGV 1459
             +V+ + PTA+IGV
Sbjct: 366  AIVQKIKPTALIGV 379


>ref|XP_001004685.1| PREDICTED: similar to NADP-dependent malic enzyme (NADP-ME) (Malic
            enzyme 1) isoform 4 [Mus musculus]
          Length = 552

 Score =  557 bits (1436), Expect = e-159
 Identities = 263/352 (74%), Positives = 310/352 (88%)
 Frame = +2

Query: 404  MAFTLEERLQLGIHGLIPPCFLSQDVQLLRIMRYYERQQSDLDKYIILMTLQDRNEKLFY 583
            +AFTLEER QL IHGL+PPC +SQ++Q+LRI++ +ER  SD D+Y++LM LQDRNEKLFY
Sbjct: 8    LAFTLEERQQLNIHGLLPPCIISQELQVLRIIKNFERLNSDFDRYLLLMDLQDRNEKLFY 67

Query: 584  RVLTSDVEKFMPIVYTPTVGLACQHYGLTFRRPRGLFITIHDKGHLPTMLNSWPEDDIKA 763
             VL SDVEKFMPIVYTPTVGLACQ Y L FR+PRGLFI+IHDKGH+ ++LN+WPED +KA
Sbjct: 68   SVLMSDVEKFMPIVYTPTVGLACQQYSLAFRKPRGLFISIHDKGHIASVLNAWPEDVVKA 127

Query: 764  VVVTDGERILGLGDLGCYGMGIPVGKLALYTACGGVNPRQCLPVLLDVGTNNEELLRDPL 943
            +VVTDGERILGLGDLGC GMGIPVGKLALYTACGGVNP+QCLP+ LDVGT NEELL+DPL
Sbjct: 128  IVVTDGERILGLGDLGCNGMGIPVGKLALYTACGGVNPQQCLPITLDVGTENEELLKDPL 187

Query: 944  YIGLKHRRVRGQDYDDLLDEFMQAVTDKFGINCLIQFEDFANANAFRLLNKYRNKYCMFN 1123
            YIGL+HRRVRG +YD  LDEFM+A + K+G+NCLIQFEDFAN NAFRLLNKYRNKYC FN
Sbjct: 188  YIGLRHRRVRGPEYDAFLDEFMEAASSKYGMNCLIQFEDFANRNAFRLLNKYRNKYCTFN 247

Query: 1124 DDIQGTASVAVAGILAALRITKNKLSNHVFVFQGAGEAAMGIAHLLVMALEKGGVPKAEA 1303
            DDIQGTASVAVAG+LAALRITKNKLS+   +FQGAGEAA+GIAHL+VMA+EK G+ K  A
Sbjct: 248  DDIQGTASVAVAGLLAALRITKNKLSDQTVLFQGAGEAALGIAHLVVMAMEKEGLSKENA 307

Query: 1304 TRKIWMVDSRGLIVKGRSHLNHEKEMFAQDHPEMSSLEEVVRLVNPTAIIGV 1459
             +KIW+VDS+GLIVKGR+ L  EKE+FA +H EM +LE +V+ + PTA+IGV
Sbjct: 308  RKKIWLVDSKGLIVKGRASLTEEKEVFAHEHEEMKNLEAIVQKIKPTALIGV 359


>ref|XP_001004679.1| PREDICTED: similar to NADP-dependent malic enzyme (NADP-ME) (Malic
            enzyme 1) isoform 1 [Mus musculus]
          Length = 554

 Score =  531 bits (1367), Expect = e-151
 Identities = 255/354 (72%), Positives = 303/354 (85%), Gaps = 2/354 (0%)
 Frame = +2

Query: 404  MAFTLEERLQLGIHGLIPPCFLSQDVQLLRIMRYYERQQSDLDKYIILMTLQDRNEKLFY 583
            +AFTLEER QL IHGL+PPC +SQ++Q+LRI++ +ER  SD D+Y++LM LQDRNEKLFY
Sbjct: 8    LAFTLEERQQLNIHGLLPPCIISQELQVLRIIKNFERLNSDFDRYLLLMDLQDRNEKLFY 67

Query: 584  RVLTSDVEKFMPIVYTPTVGLACQHYGLTFRRPRGLFITIHDKGHLPTMLNSWPEDDIKA 763
             VL SDVEKFMPIVYTPTVGLACQ Y L FR+PRGLFI+IHDKGH+ ++LN+WPED +KA
Sbjct: 68   SVLMSDVEKFMPIVYTPTVGLACQQYSLAFRKPRGLFISIHDKGHIASVLNAWPEDVVKA 127

Query: 764  VVVTDGERILGLGDLGCYGMGIPVGKLALYTACGGVNPRQCLPVLLDVGTNNEELLRDPL 943
            +VVTDGERILGLGDLGC GMGIPVGKLALYTACGGVNP+QCLP+ LDVGT NEELL+DPL
Sbjct: 128  IVVTDGERILGLGDLGCNGMGIPVGKLALYTACGGVNPQQCLPITLDVGTENEELLKDPL 187

Query: 944  YIGLKHRRVRGQDYDDLLDEFMQAVTDKFGINCLIQFEDFANANAFRLLNKYRNKYCMFN 1123
            YIGL+HRRVRG +YD  LDEFM+A + K+G+NCLIQFEDFAN NAFRLLNKYRNKYC FN
Sbjct: 188  YIGLRHRRVRGPEYDAFLDEFMEAASSKYGMNCLIQFEDFANRNAFRLLNKYRNKYCTFN 247

Query: 1124 DDIQGTASVAVAGILAALRITKNKLSNHVFVFQGAGEAAMGIAHLLVMALEKGGVPKAEA 1303
            DDIQGTASVAVAG+LAALRITKNKLS+   +FQGAGEAA+GIAHL+VMA+EK G+ K  A
Sbjct: 248  DDIQGTASVAVAGLLAALRITKNKLSDQTVLFQGAGEAALGIAHLVVMAMEKEGLSKENA 307

Query: 1304 TRKIWMVDSRGLIVKGRSHLNHEKEMFAQDHPEM--SSLEEVVRLVNPTAIIGV 1459
             +KIW+VDS+GLIVK R  +    + +    P+   S+LE +V+ + PTA+IGV
Sbjct: 308  RKKIWLVDSKGLIVKVRKKVTTYLKPYTGAAPDSLHSNLEAIVQKIKPTALIGV 361


>ref|NP_663469.1| malic enzyme 2, NAD(+)-dependent, mitochondrial [Mus musculus]
          Length = 589

 Score =  450 bits (1157), Expect = e-126
 Identities = 218/376 (57%), Positives = 285/376 (75%), Gaps = 3/376 (0%)
 Frame = +2

Query: 341  RPVPLKKRGYDVTRNPHLNKGMAFTLEERLQLGIHGLIPPCFLSQDVQLLRIMRYYERQQ 520
            R V LK++G  +  NP  NKGMAFTL+ER  LG+ GL+PP   +QD+Q LR  R  ++  
Sbjct: 17   RRVHLKEKGKPLMLNPRTNKGMAFTLQERQMLGLQGLLPPKIETQDIQALRFHRNLKKMT 76

Query: 521  SDLDKYIILMTLQDRNEKLFYRVLTSDVEKFMPIVYTPTVGLACQHYGLTFRRPRGLFIT 700
            S L+KYI +M +Q+RNEKLFYR+L  D+E  MPIVYTPTVGLAC  YG  FRRP+GLFI+
Sbjct: 77   SPLEKYIYIMGIQERNEKLFYRILQDDIESLMPIVYTPTVGLACCQYGHIFRRPKGLFIS 136

Query: 701  IHDKGHLPTMLNSWPEDDIKAVVVTDGERILGLGDLGCYGMGIPVGKLALYTACGGVNPR 880
            I D+GH+ +++++WPE+ +KAVVVTDGERILGLGDLG YGMGIPVGKL LYTAC G+ P 
Sbjct: 137  ISDRGHVRSIVDNWPENHVKAVVVTDGERILGLGDLGVYGMGIPVGKLCLYTACAGIQPE 196

Query: 881  QCLPVLLDVGTNNEELLRDPLYIGLKHRRVRGQDYDDLLDEFMQAVTDKFGINCLIQFED 1060
            +CLPV +DVGT+N  LL+DP Y+GL  +R R Q YDDL+DEFM+A+TD++G N LIQFED
Sbjct: 197  KCLPVCIDVGTDNMALLKDPFYMGLYQKRDRSQLYDDLMDEFMKAITDRYGRNTLIQFED 256

Query: 1061 FANANAFRLLNKYRNKYCMFNDDIQGTASVAVAGILAALRITKNKLSNHVFVFQGAGEAA 1240
            F N NAFR L KY+ KYC FNDDIQGTA+VA++G+LAA R+    +S H  +F GAGEAA
Sbjct: 257  FGNHNAFRFLRKYQQKYCTFNDDIQGTAAVALSGLLAAQRVINKPVSEHKILFLGAGEAA 316

Query: 1241 MGIAHLLVMALEKGGVPKAEATRKIWMVDSRGLIVKGR-SHLNHEKEMFAQDHPEM--SS 1411
            +GIA+L+V+++ + G+ + EA RKIWM D  GL+VKGR + ++  +E +A   PE   ++
Sbjct: 317  LGIANLIVLSMVESGLSEEEAQRKIWMFDKSGLLVKGRTASIDSNQEPYAHAAPESIPAT 376

Query: 1412 LEEVVRLVNPTAIIGV 1459
             E+ V  + P+ IIGV
Sbjct: 377  FEDAVNKLKPSVIIGV 392


>ref|XP_001004683.1| PREDICTED: similar to NADP-dependent malic enzyme (NADP-ME) (Malic
            enzyme 1) isoform 3 [Mus musculus]
          Length = 406

 Score =  336 bits (862), Expect = 3e-92
 Identities = 160/213 (75%), Positives = 187/213 (87%)
 Frame = +2

Query: 821  MGIPVGKLALYTACGGVNPRQCLPVLLDVGTNNEELLRDPLYIGLKHRRVRGQDYDDLLD 1000
            MGIPVGKLALYTACGGVNP+QCLP+ LDVGT NEELL+DPLYIGL+HRRVRG +YD  LD
Sbjct: 1    MGIPVGKLALYTACGGVNPQQCLPITLDVGTENEELLKDPLYIGLRHRRVRGPEYDAFLD 60

Query: 1001 EFMQAVTDKFGINCLIQFEDFANANAFRLLNKYRNKYCMFNDDIQGTASVAVAGILAALR 1180
            EFM+A + K+G+NCLIQFEDFAN NAFRLLNKYRNKYC FNDDIQGTASVAVAG+LAALR
Sbjct: 61   EFMEAASSKYGMNCLIQFEDFANRNAFRLLNKYRNKYCTFNDDIQGTASVAVAGLLAALR 120

Query: 1181 ITKNKLSNHVFVFQGAGEAAMGIAHLLVMALEKGGVPKAEATRKIWMVDSRGLIVKGRSH 1360
            ITKNKLS+   +FQGAGEAA+GIAHL+VMA+EK G+ K  A +KIW+VDS+GLIVKGR+ 
Sbjct: 121  ITKNKLSDQTVLFQGAGEAALGIAHLVVMAMEKEGLSKENARKKIWLVDSKGLIVKGRAS 180

Query: 1361 LNHEKEMFAQDHPEMSSLEEVVRLVNPTAIIGV 1459
            L  EKE+FA +H EM +LE +V+ + PTA+IGV
Sbjct: 181  LTEEKEVFAHEHEEMKNLEAIVQKIKPTALIGV 213


>ref|XP_001004682.1| PREDICTED: similar to NADP-dependent malic enzyme (NADP-ME) (Malic
            enzyme 1) isoform 2 [Mus musculus]
          Length = 258

 Score = 83.6 bits (205), Expect = 5e-16
 Identities = 38/65 (58%), Positives = 51/65 (78%)
 Frame = +2

Query: 1265 MALEKGGVPKAEATRKIWMVDSRGLIVKGRSHLNHEKEMFAQDHPEMSSLEEVVRLVNPT 1444
            MA+EK G+ K  A +KIW+VDS+GLIVKGR+ L  EKE+FA +H EM +LE +V+ + PT
Sbjct: 1    MAMEKEGLSKENARKKIWLVDSKGLIVKGRASLTEEKEVFAHEHEEMKNLEAIVQKIKPT 60

Query: 1445 AIIGV 1459
            A+IGV
Sbjct: 61   ALIGV 65


  Database: RefSeqMP
    Posted date:  Aug 2, 2006 12:58 AM
  Number of letters in database: 21,768,885
  Number of sequences in database:  45,328
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 66,702,162
Number of Sequences: 45328
Number of extensions: 1821779
Number of successful extensions: 11380
Number of sequences better than 1.0e-05: 7
Number of HSP's better than  0.0 without gapping: 6555
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 10582
length of database: 21,768,885
effective HSP length: 107
effective length of database: 16,918,789
effective search space used: 6412221031
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)