Animal-Genome cDNA 20060611S-000625


Search to RefSeqSP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611S-000625
         (570 letters)

Database: RefSeqSP 
           1040 sequences; 434,620 total letters

Searching...done

 ***** No hits found ******

  Database: RefSeqSP
    Posted date:  Aug 1, 2006  7:14 PM
  Number of letters in database: 434,620
  Number of sequences in database:  1040
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 479,333
Number of Sequences: 1040
Number of extensions: 10454
Number of successful extensions: 30
Number of sequences better than 1.0e-05: 0
Number of HSP's better than  0.0 without gapping: 29
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 30
length of database: 434,620
effective HSP length: 72
effective length of database: 359,740
effective search space used: 42089580
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqBP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611S-000625
         (570 letters)

Database: RefSeqBP 
           33,508 sequences; 16,112,626 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_001030273.1| thioredoxin-like [Bos taurus]                     134   6e-32

>ref|NP_001030273.1| thioredoxin-like [Bos taurus]
          Length = 334

 Score =  134 bits (336), Expect = 6e-32
 Identities = 74/121 (61%), Positives = 85/121 (70%)
 Frame = +2

Query: 14  LASGXXXXXXTVLQVGSAGQFEELLRLRANSLLVVHFWAPWAPQCATMNYVMAELPNEHP 193
           +A G       V++VGS+GQFEELLRLRA SLLVVHFWAPWAPQCA MN VMAEL  EH 
Sbjct: 1   MAGGAAEAAAAVVEVGSSGQFEELLRLRAKSLLVVHFWAPWAPQCAQMNDVMAELAKEHQ 60

Query: 194 QVSFVNLDAEPVPEVSDIYSN*LLYTPLCFTRILTALLRLDGAHDSDLTQKVQRLASINF 373
           QVSFV L+AE VPEVS+ Y    + T L F +    + RLDGAH  +LT+KVQR AS   
Sbjct: 61  QVSFVKLEAEAVPEVSEKYEISSVPTFL-FFKNSQKIDRLDGAHAPELTKKVQRHASSGS 119

Query: 374 F 376
           F
Sbjct: 120 F 120


  Database: RefSeqBP
    Posted date:  Aug 1, 2006  7:14 PM
  Number of letters in database: 16,112,626
  Number of sequences in database:  33,508
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 17,670,589
Number of Sequences: 33508
Number of extensions: 388053
Number of successful extensions: 1010
Number of sequences better than 1.0e-05: 1
Number of HSP's better than  0.0 without gapping: 979
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1008
length of database: 16,112,626
effective HSP length: 96
effective length of database: 12,895,858
effective search space used: 1199314794
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqHP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611S-000625
         (570 letters)

Database: RefSeqHP 
           39,411 sequences; 17,774,539 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_006532.2| thioredoxin-like [Homo sapiens]                      127   5e-30

>ref|NP_006532.2| thioredoxin-like [Homo sapiens]
          Length = 335

 Score =  127 bits (320), Expect = 5e-30
 Identities = 73/120 (60%), Positives = 82/120 (68%)
 Frame = +2

Query: 17  ASGXXXXXXTVLQVGSAGQFEELLRLRANSLLVVHFWAPWAPQCATMNYVMAELPNEHPQ 196
           A         V +VGSAGQFEELLRL+A SLLVVHFWAPWAPQCA MN VMAEL  E PQ
Sbjct: 3   AGAAEAAVAAVEEVGSAGQFEELLRLKAKSLLVVHFWAPWAPQCAQMNEVMAELAKELPQ 62

Query: 197 VSFVNLDAEPVPEVSDIYSN*LLYTPLCFTRILTALLRLDGAHDSDLTQKVQRLASINFF 376
           VSFV L+AE VPEVS+ Y    + T L F +    + RLDGAH  +LT+KVQR AS   F
Sbjct: 63  VSFVKLEAEGVPEVSEKYEISSVPTFL-FFKNSQKIDRLDGAHAPELTKKVQRHASSGSF 121


  Database: RefSeqHP
    Posted date:  Aug 2, 2006 12:57 AM
  Number of letters in database: 17,774,539
  Number of sequences in database:  39,411
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 19,926,544
Number of Sequences: 39411
Number of extensions: 445663
Number of successful extensions: 1125
Number of sequences better than 1.0e-05: 1
Number of HSP's better than  0.0 without gapping: 1076
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1123
length of database: 17,774,539
effective HSP length: 96
effective length of database: 13,991,083
effective search space used: 1301170719
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqCP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611S-000625
         (570 letters)

Database: RefSeqCP 
           33,732 sequences; 19,266,565 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|XP_535061.2| PREDICTED: similar to Thioredoxin-like 2 protei...   131   5e-31

>ref|XP_535061.2| PREDICTED: similar to Thioredoxin-like 2 protein (PKC-interacting
           cousin of thioredoxin) (PKCq-interacting protein)
           (PKC-theta-interacting protein) [Canis familiaris]
          Length = 333

 Score =  131 bits (329), Expect = 5e-31
 Identities = 72/111 (64%), Positives = 82/111 (73%)
 Frame = +2

Query: 47  VLQVGSAGQFEELLRLRANSLLVVHFWAPWAPQCATMNYVMAELPNEHPQVSFVNLDAEP 226
           V++VGSA QFEELLRLRA SL+VVHFWAPWAPQC  MN VMAEL  EHPQVSFV L+AE 
Sbjct: 11  VVEVGSAPQFEELLRLRAKSLVVVHFWAPWAPQCVQMNDVMAELAKEHPQVSFVKLEAEA 70

Query: 227 VPEVSDIYSN*LLYTPLCFTRILTALLRLDGAHDSDLTQKVQRLASINFFP 379
           VPEVS+ Y    + T L F +    + RLDGAH  +LT+KVQR AS   FP
Sbjct: 71  VPEVSEKYEISSVPTFLLF-KNSQKIDRLDGAHAPELTKKVQRHASSGSFP 120


  Database: RefSeqCP
    Posted date:  Aug 1, 2006  9:25 PM
  Number of letters in database: 19,266,565
  Number of sequences in database:  33,732
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 20,775,165
Number of Sequences: 33732
Number of extensions: 454079
Number of successful extensions: 1196
Number of sequences better than 1.0e-05: 1
Number of HSP's better than  0.0 without gapping: 1138
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1194
length of database: 19,266,565
effective HSP length: 97
effective length of database: 15,994,561
effective search space used: 1471499612
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqMP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611S-000625
         (570 letters)

Database: RefSeqMP 
           45,328 sequences; 21,768,885 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|XP_995522.1| PREDICTED: similar to thioredoxin-like 2 [Mus m...   126   2e-29
Alignment   gi|XP_978406.1| PREDICTED: similar to thioredoxin-like 2 [Mus m...   126   2e-29
Alignment   gi|XP_978323.1| PREDICTED: similar to thioredoxin-like 2 [Mus m...   126   2e-29
Alignment   gi|NP_075629.2| thioredoxin-like 2 [Mus musculus]                    125   3e-29

>ref|XP_995522.1| PREDICTED: similar to thioredoxin-like 2 [Mus musculus]
          Length = 365

 Score =  126 bits (316), Expect = 2e-29
 Identities = 72/128 (56%), Positives = 82/128 (64%), Gaps = 3/128 (2%)
 Frame = +2

Query: 2   WRRQLASGXX--XXXXTVLQVGSAGQFEELLRLRANSLLVVHFWAPWAPQCATMNYVMAE 175
           WRRQ   G         V++VGSA QFEELLRL+  SLLVVHFWAPWAPQC  MN VMAE
Sbjct: 26  WRRQHGGGGGPGEAAVAVVEVGSAQQFEELLRLKTKSLLVVHFWAPWAPQCVQMNDVMAE 85

Query: 176 LPNEHPQVSFVNLDAEPVPEVSDIYSN*LLYTP-LCFTRILTALLRLDGAHDSDLTQKVQ 352
           L  EHP VSFV L+AE VPEVS+ Y   +   P   F +    + RLDGAH  +LT+KVQ
Sbjct: 86  LAKEHPHVSFVKLEAEAVPEVSEKYE--ISSVPSFLFFKNSQKVDRLDGAHAPELTKKVQ 143

Query: 353 RLASINFF 376
           R  S   F
Sbjct: 144 RHVSSGAF 151


>ref|XP_978406.1| PREDICTED: similar to thioredoxin-like 2 [Mus musculus]
          Length = 365

 Score =  126 bits (316), Expect = 2e-29
 Identities = 72/128 (56%), Positives = 82/128 (64%), Gaps = 3/128 (2%)
 Frame = +2

Query: 2   WRRQLASGXX--XXXXTVLQVGSAGQFEELLRLRANSLLVVHFWAPWAPQCATMNYVMAE 175
           WRRQ   G         V++VGSA QFEELLRL+  SLLVVHFWAPWAPQC  MN VMAE
Sbjct: 26  WRRQHGGGGGPGEAAVAVVEVGSAQQFEELLRLKTKSLLVVHFWAPWAPQCVQMNDVMAE 85

Query: 176 LPNEHPQVSFVNLDAEPVPEVSDIYSN*LLYTP-LCFTRILTALLRLDGAHDSDLTQKVQ 352
           L  EHP VSFV L+AE VPEVS+ Y   +   P   F +    + RLDGAH  +LT+KVQ
Sbjct: 86  LAKEHPHVSFVKLEAEAVPEVSEKYE--ISSVPSFLFFKNSQKVDRLDGAHAPELTKKVQ 143

Query: 353 RLASINFF 376
           R  S   F
Sbjct: 144 RHVSSGAF 151


>ref|XP_978323.1| PREDICTED: similar to thioredoxin-like 2 [Mus musculus]
          Length = 365

 Score =  126 bits (316), Expect = 2e-29
 Identities = 72/128 (56%), Positives = 82/128 (64%), Gaps = 3/128 (2%)
 Frame = +2

Query: 2   WRRQLASGXX--XXXXTVLQVGSAGQFEELLRLRANSLLVVHFWAPWAPQCATMNYVMAE 175
           WRRQ   G         V++VGSA QFEELLRL+  SLLVVHFWAPWAPQC  MN VMAE
Sbjct: 26  WRRQHGGGGGPGEAAVAVVEVGSAQQFEELLRLKTKSLLVVHFWAPWAPQCVQMNDVMAE 85

Query: 176 LPNEHPQVSFVNLDAEPVPEVSDIYSN*LLYTP-LCFTRILTALLRLDGAHDSDLTQKVQ 352
           L  EHP VSFV L+AE VPEVS+ Y   +   P   F +    + RLDGAH  +LT+KVQ
Sbjct: 86  LAKEHPHVSFVKLEAEAVPEVSEKYE--ISSVPSFLFFKNSQKVDRLDGAHAPELTKKVQ 143

Query: 353 RLASINFF 376
           R  S   F
Sbjct: 144 RHVSSGAF 151


>ref|NP_075629.2| thioredoxin-like 2 [Mus musculus]
          Length = 337

 Score =  125 bits (314), Expect = 3e-29
 Identities = 69/111 (62%), Positives = 79/111 (71%)
 Frame = +2

Query: 47  VLQVGSAGQFEELLRLRANSLLVVHFWAPWAPQCATMNYVMAELPNEHPQVSFVNLDAEP 226
           V++VGSA QFEELLRL+  SLLVVHFWAPWAPQC  MN VMAEL  EHP VSFV L+AE 
Sbjct: 15  VVEVGSAQQFEELLRLKTKSLLVVHFWAPWAPQCVQMNDVMAELAKEHPHVSFVKLEAEA 74

Query: 227 VPEVSDIYSN*LLYTPLCFTRILTALLRLDGAHDSDLTQKVQRLASINFFP 379
           VPEVS+ Y    + T L F +    + RLDGAH  +LT+KVQR  S   FP
Sbjct: 75  VPEVSEKYEISSVPTFL-FFKNSQKVDRLDGAHAPELTKKVQRHVSSGAFP 124


  Database: RefSeqMP
    Posted date:  Aug 2, 2006 12:58 AM
  Number of letters in database: 21,768,885
  Number of sequences in database:  45,328
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 23,855,933
Number of Sequences: 45328
Number of extensions: 521652
Number of successful extensions: 1340
Number of sequences better than 1.0e-05: 4
Number of HSP's better than  0.0 without gapping: 1245
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1332
length of database: 21,768,885
effective HSP length: 97
effective length of database: 17,372,069
effective search space used: 1598230348
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)