Animal-Genome cDNA 20060611S-002158


Search to RefSeqSP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611S-002158
         (1174 letters)

Database: RefSeqSP 
           1040 sequences; 434,620 total letters

Searching...done

 ***** No hits found ******

  Database: RefSeqSP
    Posted date:  Aug 1, 2006  7:14 PM
  Number of letters in database: 434,620
  Number of sequences in database:  1040
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 764,698
Number of Sequences: 1040
Number of extensions: 18466
Number of successful extensions: 51
Number of sequences better than 1.0e-05: 0
Number of HSP's better than  0.0 without gapping: 48
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 51
length of database: 434,620
effective HSP length: 79
effective length of database: 352,460
effective search space used: 109615060
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqBP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611S-002158
         (1174 letters)

Database: RefSeqBP 
           33,508 sequences; 16,112,626 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|XP_582303.1| PREDICTED: similar to CG14407-PA [Bos taurus]        201   9e-52
Alignment   gi|NP_001030273.1| thioredoxin-like [Bos taurus]                      89   7e-18
Alignment   gi|XP_873370.1| PREDICTED: similar to Thioredoxin-like protein ...    61   1e-09
Alignment   gi|XP_583096.1| PREDICTED: hypothetical protein XP_583096 [Bos ...    53   4e-07

>ref|XP_582303.1| PREDICTED: similar to CG14407-PA [Bos taurus]
          Length = 158

 Score =  201 bits (511), Expect = 9e-52
 Identities = 96/99 (96%), Positives = 97/99 (97%)
 Frame = +2

Query: 2   KGTPEQPQCGFSNAVVQILRLHGVRDYAAYNVLDDPQLRQGIKDYSNWPTIPQVYLNGEF 181
           KGTPEQPQCGFSNAVVQILRLHGVRDYAAYNVLDDPQLRQGIKDYSNWPTIPQVYLNGEF
Sbjct: 60  KGTPEQPQCGFSNAVVQILRLHGVRDYAAYNVLDDPQLRQGIKDYSNWPTIPQVYLNGEF 119

Query: 182 VGGCDILLQMHQNGDLVEELKKLGIRSALLDEKTDQDSK 298
           VGGCDILLQMHQNGDLVEELKKLGIRSALLD+  DQDSK
Sbjct: 120 VGGCDILLQMHQNGDLVEELKKLGIRSALLDDTKDQDSK 158


>ref|NP_001030273.1| thioredoxin-like [Bos taurus]
          Length = 334

 Score = 89.0 bits (219), Expect = 7e-18
 Identities = 37/81 (45%), Positives = 60/81 (74%)
 Frame = +2

Query: 2   KGTPEQPQCGFSNAVVQILRLHGVRDYAAYNVLDDPQLRQGIKDYSNWPTIPQVYLNGEF 181
           KG  ++ +CGFS  +++IL   G+ +Y  +++L+D ++RQG+K YSNWPT PQ+Y+ GE 
Sbjct: 252 KGNKQEAKCGFSRQILEILNSTGI-EYETFDILEDEEVRQGLKAYSNWPTYPQLYVKGEL 310

Query: 182 VGGCDILLQMHQNGDLVEELK 244
           VGG DI+ ++ +NG+L+  LK
Sbjct: 311 VGGLDIVKELKENGELLPILK 331



 Score = 86.7 bits (213), Expect = 3e-17
 Identities = 33/76 (43%), Positives = 59/76 (77%)
 Frame = +2

Query: 2   KGTPEQPQCGFSNAVVQILRLHGVRDYAAYNVLDDPQLRQGIKDYSNWPTIPQVYLNGEF 181
           KGTP++P+CGFS  +V+IL  H ++ ++++++  D ++RQG+K YS+WPT PQ+Y++GE 
Sbjct: 150 KGTPQEPRCGFSKQMVEILNKHNIQ-FSSFDIFSDEEVRQGLKTYSSWPTYPQLYVSGEL 208

Query: 182 VGGCDILLQMHQNGDL 229
           +GG DI+ ++  + +L
Sbjct: 209 IGGLDIIKELEASKEL 224


>ref|XP_873370.1| PREDICTED: similar to Thioredoxin-like protein 2 (PKC-interacting
           cousin of thioredoxin) (PKC-theta-interacting protein)
           (PKCq-interacting protein) (HUSSY-22) [Bos taurus]
          Length = 164

 Score = 61.2 bits (147), Expect = 1e-09
 Identities = 33/100 (33%), Positives = 51/100 (51%), Gaps = 1/100 (1%)
 Frame = +2

Query: 2   KGTPEQPQCGFSNAVVQILRLHGVRDYAAYNVLDDPQLRQGIKDYSNWPTIPQVYLNGEF 181
           KGTP++P+CGF+                        ++RQ +K YSNWPT PQ+Y++GE 
Sbjct: 48  KGTPQEPRCGFN------------------------EVRQALKTYSNWPTYPQLYVSGEL 83

Query: 182 VGGCDILLQMHQNGDLVEELKKL-GIRSALLDEKTDQDSK 298
           +GG DI+ ++  + +L     K   +   L DE+  Q  K
Sbjct: 84  IGGLDIIKELEASKELDMICPKAPKLEERLKDEEVQQGLK 123


>ref|XP_583096.1| PREDICTED: hypothetical protein XP_583096 [Bos taurus]
          Length = 254

 Score = 53.1 bits (126), Expect = 4e-07
 Identities = 32/57 (56%), Positives = 33/57 (57%)
 Frame = -1

Query: 190 APHELAVEVHLRDGGPVGIVFNALPELXXXXXXXXXXXXXXXQPQDLHHGVAEATLG 20
           A H LAVEVHLRD G   IVFN L EL               + QDLHHGVAEATLG
Sbjct: 119 ALHGLAVEVHLRDSG---IVFNTLLELAVVQHVVGQVVTDAVELQDLHHGVAEATLG 172


  Database: RefSeqBP
    Posted date:  Aug 1, 2006  7:14 PM
  Number of letters in database: 16,112,626
  Number of sequences in database:  33,508
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 28,435,216
Number of Sequences: 33508
Number of extensions: 698528
Number of successful extensions: 2617
Number of sequences better than 1.0e-05: 4
Number of HSP's better than  0.0 without gapping: 2380
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2602
length of database: 16,112,626
effective HSP length: 103
effective length of database: 12,661,302
effective search space used: 3633793674
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqHP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611S-002158
         (1174 letters)

Database: RefSeqHP 
           39,411 sequences; 17,774,539 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_057501.2| glutaredoxin 5 [Homo sapiens]                        201   8e-52
Alignment   gi|NP_006532.2| thioredoxin-like [Homo sapiens]                       88   1e-17

>ref|NP_057501.2| glutaredoxin 5 [Homo sapiens]
          Length = 157

 Score =  201 bits (512), Expect = 8e-52
 Identities = 96/99 (96%), Positives = 97/99 (97%)
 Frame = +2

Query: 2   KGTPEQPQCGFSNAVVQILRLHGVRDYAAYNVLDDPQLRQGIKDYSNWPTIPQVYLNGEF 181
           KGTPEQPQCGFSNAVVQILRLHGVRDYAAYNVLDDP+LRQGIKDYSNWPTIPQVYLNGEF
Sbjct: 59  KGTPEQPQCGFSNAVVQILRLHGVRDYAAYNVLDDPELRQGIKDYSNWPTIPQVYLNGEF 118

Query: 182 VGGCDILLQMHQNGDLVEELKKLGIRSALLDEKTDQDSK 298
           VGGCDILLQMHQNGDLVEELKKLGI SALLDEK DQDSK
Sbjct: 119 VGGCDILLQMHQNGDLVEELKKLGIHSALLDEKKDQDSK 157


>ref|NP_006532.2| thioredoxin-like [Homo sapiens]
          Length = 335

 Score = 88.2 bits (217), Expect = 1e-17
 Identities = 37/81 (45%), Positives = 60/81 (74%)
 Frame = +2

Query: 2   KGTPEQPQCGFSNAVVQILRLHGVRDYAAYNVLDDPQLRQGIKDYSNWPTIPQVYLNGEF 181
           KG  ++ +CGFS  +++IL   GV +Y  +++L+D ++RQG+K YSNWPT PQ+Y+ GE 
Sbjct: 253 KGNKQEAKCGFSKQILEILNSTGV-EYETFDILEDEEVRQGLKAYSNWPTYPQLYVKGEL 311

Query: 182 VGGCDILLQMHQNGDLVEELK 244
           VGG DI+ ++ +NG+L+  L+
Sbjct: 312 VGGLDIVKELKENGELLPILR 332



 Score = 87.0 bits (214), Expect = 3e-17
 Identities = 37/93 (39%), Positives = 67/93 (72%)
 Frame = +2

Query: 2   KGTPEQPQCGFSNAVVQILRLHGVRDYAAYNVLDDPQLRQGIKDYSNWPTIPQVYLNGEF 181
           KGTP++P+CGFS  +V+IL  H ++ ++++++  D ++RQG+K YS+WPT PQ+Y++GE 
Sbjct: 151 KGTPQEPRCGFSKQMVEILHKHNIQ-FSSFDIFSDEEVRQGLKAYSSWPTYPQLYVSGEL 209

Query: 182 VGGCDILLQMHQNGDLVEELKKLGIRSALLDEK 280
           +GG DI+ ++  +    EEL  +  ++  L+E+
Sbjct: 210 IGGLDIIKELEAS----EELDTICPKAPKLEER 238


  Database: RefSeqHP
    Posted date:  Aug 2, 2006 12:57 AM
  Number of letters in database: 17,774,539
  Number of sequences in database:  39,411
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 32,261,818
Number of Sequences: 39411
Number of extensions: 824967
Number of successful extensions: 3052
Number of sequences better than 1.0e-05: 2
Number of HSP's better than  0.0 without gapping: 2689
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3045
length of database: 17,774,539
effective HSP length: 104
effective length of database: 13,675,795
effective search space used: 3911277370
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqCP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611S-002158
         (1174 letters)

Database: RefSeqCP 
           33,732 sequences; 19,266,565 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|XP_535061.2| PREDICTED: similar to Thioredoxin-like 2 protei...    89   6e-18

>ref|XP_535061.2| PREDICTED: similar to Thioredoxin-like 2 protein (PKC-interacting
           cousin of thioredoxin) (PKCq-interacting protein)
           (PKC-theta-interacting protein) [Canis familiaris]
          Length = 333

 Score = 89.4 bits (220), Expect = 6e-18
 Identities = 38/81 (46%), Positives = 59/81 (72%)
 Frame = +2

Query: 2   KGTPEQPQCGFSNAVVQILRLHGVRDYAAYNVLDDPQLRQGIKDYSNWPTIPQVYLNGEF 181
           KG  ++ +CGFS  +++IL   GV +Y  +++L+D ++RQG+K YSNWPT PQ+Y+ GE 
Sbjct: 251 KGNKQEAKCGFSKQILEILNSTGV-EYETFDILEDEEVRQGLKTYSNWPTYPQLYVKGEL 309

Query: 182 VGGCDILLQMHQNGDLVEELK 244
           VGG DI+ ++  NG+L+  LK
Sbjct: 310 VGGLDIVKELKDNGELLPVLK 330



 Score = 89.0 bits (219), Expect = 8e-18
 Identities = 34/76 (44%), Positives = 59/76 (77%)
 Frame = +2

Query: 2   KGTPEQPQCGFSNAVVQILRLHGVRDYAAYNVLDDPQLRQGIKDYSNWPTIPQVYLNGEF 181
           KGTP++P+CGFS  +V+IL  H ++ ++++++  D ++RQG+K YSNWPT PQ+Y++GE 
Sbjct: 149 KGTPQEPRCGFSKQMVEILNKHNIQ-FSSFDIFSDEEVRQGLKTYSNWPTYPQLYVSGEL 207

Query: 182 VGGCDILLQMHQNGDL 229
           +GG DI+ ++  + +L
Sbjct: 208 IGGLDIIKELEASDEL 223


  Database: RefSeqCP
    Posted date:  Aug 1, 2006  9:25 PM
  Number of letters in database: 19,266,565
  Number of sequences in database:  33,732
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 33,344,497
Number of Sequences: 33732
Number of extensions: 821747
Number of successful extensions: 3157
Number of sequences better than 1.0e-05: 1
Number of HSP's better than  0.0 without gapping: 2800
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3142
length of database: 19,266,565
effective HSP length: 105
effective length of database: 15,724,705
effective search space used: 4481540925
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqMP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611S-002158
         (1174 letters)

Database: RefSeqMP 
           45,328 sequences; 21,768,885 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_082695.1| glutaredoxin 5 [Mus musculus]                        198   1e-50
Alignment   gi|NP_075629.2| thioredoxin-like 2 [Mus musculus]                     89   7e-18

>ref|NP_082695.1| glutaredoxin 5 [Mus musculus]
          Length = 152

 Score =  198 bits (503), Expect = 1e-50
 Identities = 96/99 (96%), Positives = 98/99 (98%)
 Frame = +2

Query: 2   KGTPEQPQCGFSNAVVQILRLHGVRDYAAYNVLDDPQLRQGIKDYSNWPTIPQVYLNGEF 181
           KGTPEQPQCGFSNAVVQILRLHGVRDYAAYNVLDDP+LRQGIKDYSNWPTIPQVYLNGEF
Sbjct: 55  KGTPEQPQCGFSNAVVQILRLHGVRDYAAYNVLDDPELRQGIKDYSNWPTIPQVYLNGEF 114

Query: 182 VGGCDILLQMHQNGDLVEELKKLGIRSALLDEKTDQDSK 298
           VGGCDILLQMHQNGDLVEELKKLGIRSAL+DEK DQDSK
Sbjct: 115 VGGCDILLQMHQNGDLVEELKKLGIRSALVDEK-DQDSK 152


>ref|NP_075629.2| thioredoxin-like 2 [Mus musculus]
          Length = 337

 Score = 89.4 bits (220), Expect = 7e-18
 Identities = 38/93 (40%), Positives = 67/93 (72%)
 Frame = +2

Query: 2   KGTPEQPQCGFSNAVVQILRLHGVRDYAAYNVLDDPQLRQGIKDYSNWPTIPQVYLNGEF 181
           KGTP++P+CGFS  +V+IL  H ++ ++++++  D ++RQG+K YSNWPT PQ+Y++GE 
Sbjct: 153 KGTPQEPRCGFSKQMVEILHKHNIQ-FSSFDIFSDEEVRQGLKTYSNWPTYPQLYVSGEL 211

Query: 182 VGGCDILLQMHQNGDLVEELKKLGIRSALLDEK 280
           +GG DI+ ++  +    EEL  +  ++  L+E+
Sbjct: 212 IGGLDIIKELEAS----EELDTICPKAPKLEER 240



 Score = 86.3 bits (212), Expect = 6e-17
 Identities = 36/81 (44%), Positives = 59/81 (72%)
 Frame = +2

Query: 2   KGTPEQPQCGFSNAVVQILRLHGVRDYAAYNVLDDPQLRQGIKDYSNWPTIPQVYLNGEF 181
           KG  ++ +CGFS  +++IL   GV +Y  +++L+D ++RQG+K +SNWPT PQ+Y+ G+ 
Sbjct: 255 KGNKQEAKCGFSKQILEILNSTGV-EYETFDILEDEEVRQGLKTFSNWPTYPQLYVRGDL 313

Query: 182 VGGCDILLQMHQNGDLVEELK 244
           VGG DI+ ++  NG+L+  LK
Sbjct: 314 VGGLDIVKELKDNGELLPILK 334


  Database: RefSeqMP
    Posted date:  Aug 2, 2006 12:58 AM
  Number of letters in database: 21,768,885
  Number of sequences in database:  45,328
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 38,263,760
Number of Sequences: 45328
Number of extensions: 940370
Number of successful extensions: 3825
Number of sequences better than 1.0e-05: 2
Number of HSP's better than  0.0 without gapping: 3305
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3807
length of database: 21,768,885
effective HSP length: 105
effective length of database: 17,009,445
effective search space used: 4847691825
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)