Animal-Genome cDNA 20060611S-002811


Search to RefSeqSP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611S-002811
         (1193 letters)

Database: RefSeqSP 
           1040 sequences; 434,620 total letters

Searching...done

 ***** No hits found ******

  Database: RefSeqSP
    Posted date:  Aug 1, 2006  7:14 PM
  Number of letters in database: 434,620
  Number of sequences in database:  1040
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,105,267
Number of Sequences: 1040
Number of extensions: 31949
Number of successful extensions: 95
Number of sequences better than 1.0e-05: 0
Number of HSP's better than  0.0 without gapping: 82
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 95
length of database: 434,620
effective HSP length: 79
effective length of database: 352,460
effective search space used: 112082280
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqBP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611S-002811
         (1193 letters)

Database: RefSeqBP 
           33,508 sequences; 16,112,626 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|XP_582303.1| PREDICTED: similar to CG14407-PA [Bos taurus]        199   4e-51
Alignment   gi|NP_001030273.1| thioredoxin-like [Bos taurus]                      87   3e-17
Alignment   gi|XP_583096.1| PREDICTED: hypothetical protein XP_583096 [Bos ...    70   3e-12
Alignment   gi|XP_873370.1| PREDICTED: similar to Thioredoxin-like protein ...    59   6e-09

>ref|XP_582303.1| PREDICTED: similar to CG14407-PA [Bos taurus]
          Length = 158

 Score =  199 bits (506), Expect = 4e-51
 Identities = 95/98 (96%), Positives = 96/98 (97%)
 Frame = +1

Query: 202 GTPEQPQCGFSNAVVQILRLHGVRDYAAYNVLDDPQLRQGIKDYSNWPTIPQVYLNGEFV 381
           GTPEQPQCGFSNAVVQILRLHGVRDYAAYNVLDDPQLRQGIKDYSNWPTIPQVYLNGEFV
Sbjct: 61  GTPEQPQCGFSNAVVQILRLHGVRDYAAYNVLDDPQLRQGIKDYSNWPTIPQVYLNGEFV 120

Query: 382 GGCDILLQMHQNGDLVEELKKLGIRSALLDEKTDQDSK 495
           GGCDILLQMHQNGDLVEELKKLGIRSALLD+  DQDSK
Sbjct: 121 GGCDILLQMHQNGDLVEELKKLGIRSALLDDTKDQDSK 158


>ref|NP_001030273.1| thioredoxin-like [Bos taurus]
          Length = 334

 Score = 87.0 bits (214), Expect = 3e-17
 Identities = 36/80 (45%), Positives = 59/80 (73%)
 Frame = +1

Query: 202 GTPEQPQCGFSNAVVQILRLHGVRDYAAYNVLDDPQLRQGIKDYSNWPTIPQVYLNGEFV 381
           G  ++ +CGFS  +++IL   G+ +Y  +++L+D ++RQG+K YSNWPT PQ+Y+ GE V
Sbjct: 253 GNKQEAKCGFSRQILEILNSTGI-EYETFDILEDEEVRQGLKAYSNWPTYPQLYVKGELV 311

Query: 382 GGCDILLQMHQNGDLVEELK 441
           GG DI+ ++ +NG+L+  LK
Sbjct: 312 GGLDIVKELKENGELLPILK 331



 Score = 84.7 bits (208), Expect = 1e-16
 Identities = 32/75 (42%), Positives = 58/75 (77%)
 Frame = +1

Query: 202 GTPEQPQCGFSNAVVQILRLHGVRDYAAYNVLDDPQLRQGIKDYSNWPTIPQVYLNGEFV 381
           GTP++P+CGFS  +V+IL  H ++ ++++++  D ++RQG+K YS+WPT PQ+Y++GE +
Sbjct: 151 GTPQEPRCGFSKQMVEILNKHNIQ-FSSFDIFSDEEVRQGLKTYSSWPTYPQLYVSGELI 209

Query: 382 GGCDILLQMHQNGDL 426
           GG DI+ ++  + +L
Sbjct: 210 GGLDIIKELEASKEL 224


>ref|XP_583096.1| PREDICTED: hypothetical protein XP_583096 [Bos taurus]
          Length = 254

 Score = 70.5 bits (171), Expect = 3e-12
 Identities = 52/126 (41%), Positives = 56/126 (44%)
 Frame = -3

Query: 387 APHELAVEVHLRDGGPVGIVFNALPELXXXXXXXXXXXXXXXQPQDLHHGVAEATLGLLW 208
           A H LAVEVHLRD G   IVFN L EL               + QDLHHGVAEATLG   
Sbjct: 119 ALHGLAVEVHLRDSG---IVFNTLLELAVVQHVVGQVVTDAVELQDLHHGVAEATLGCSG 175

Query: 207 RPLEEDHHLVLLHQRVQMLXXXXXXXXXXXXXRDPQTTAYAAPPAEQSRRRPAQGRAHPR 28
            P  +   L       +               +D Q     AP  EQS    AQG AHPR
Sbjct: 176 VPPRKSTTLSFFTNASRCSQEPLPPKRSAPHAQDLQAATCTAPTVEQSCCHLAQGPAHPR 235

Query: 27  TLAGAL 10
            LA AL
Sbjct: 236 VLARAL 241



 Score = 55.5 bits (132), Expect = 8e-08
 Identities = 24/30 (80%), Positives = 27/30 (90%)
 Frame = -1

Query: 218 GCSGVPLRKTTTLSFFTSVSRCSAEPLPPE 129
           GCSGVP RK+TTLSFFT+ SRCS EPLPP+
Sbjct: 172 GCSGVPPRKSTTLSFFTNASRCSQEPLPPK 201


>ref|XP_873370.1| PREDICTED: similar to Thioredoxin-like protein 2 (PKC-interacting
           cousin of thioredoxin) (PKC-theta-interacting protein)
           (PKCq-interacting protein) (HUSSY-22) [Bos taurus]
          Length = 164

 Score = 59.3 bits (142), Expect = 6e-09
 Identities = 32/99 (32%), Positives = 50/99 (50%), Gaps = 1/99 (1%)
 Frame = +1

Query: 202 GTPEQPQCGFSNAVVQILRLHGVRDYAAYNVLDDPQLRQGIKDYSNWPTIPQVYLNGEFV 381
           GTP++P+CGF+                        ++RQ +K YSNWPT PQ+Y++GE +
Sbjct: 49  GTPQEPRCGFN------------------------EVRQALKTYSNWPTYPQLYVSGELI 84

Query: 382 GGCDILLQMHQNGDLVEELKKL-GIRSALLDEKTDQDSK 495
           GG DI+ ++  + +L     K   +   L DE+  Q  K
Sbjct: 85  GGLDIIKELEASKELDMICPKAPKLEERLKDEEVQQGLK 123


  Database: RefSeqBP
    Posted date:  Aug 1, 2006  7:14 PM
  Number of letters in database: 16,112,626
  Number of sequences in database:  33,508
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 42,275,363
Number of Sequences: 33508
Number of extensions: 1268734
Number of successful extensions: 4345
Number of sequences better than 1.0e-05: 4
Number of HSP's better than  0.0 without gapping: 3626
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4311
length of database: 16,112,626
effective HSP length: 104
effective length of database: 12,627,794
effective search space used: 3699943642
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqHP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611S-002811
         (1193 letters)

Database: RefSeqHP 
           39,411 sequences; 17,774,539 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_057501.2| glutaredoxin 5 [Homo sapiens]                        199   3e-51
Alignment   gi|NP_006532.2| thioredoxin-like [Homo sapiens]                       86   5e-17

>ref|NP_057501.2| glutaredoxin 5 [Homo sapiens]
          Length = 157

 Score =  199 bits (507), Expect = 3e-51
 Identities = 95/98 (96%), Positives = 96/98 (97%)
 Frame = +1

Query: 202 GTPEQPQCGFSNAVVQILRLHGVRDYAAYNVLDDPQLRQGIKDYSNWPTIPQVYLNGEFV 381
           GTPEQPQCGFSNAVVQILRLHGVRDYAAYNVLDDP+LRQGIKDYSNWPTIPQVYLNGEFV
Sbjct: 60  GTPEQPQCGFSNAVVQILRLHGVRDYAAYNVLDDPELRQGIKDYSNWPTIPQVYLNGEFV 119

Query: 382 GGCDILLQMHQNGDLVEELKKLGIRSALLDEKTDQDSK 495
           GGCDILLQMHQNGDLVEELKKLGI SALLDEK DQDSK
Sbjct: 120 GGCDILLQMHQNGDLVEELKKLGIHSALLDEKKDQDSK 157


>ref|NP_006532.2| thioredoxin-like [Homo sapiens]
          Length = 335

 Score = 86.3 bits (212), Expect = 5e-17
 Identities = 36/80 (45%), Positives = 59/80 (73%)
 Frame = +1

Query: 202 GTPEQPQCGFSNAVVQILRLHGVRDYAAYNVLDDPQLRQGIKDYSNWPTIPQVYLNGEFV 381
           G  ++ +CGFS  +++IL   GV +Y  +++L+D ++RQG+K YSNWPT PQ+Y+ GE V
Sbjct: 254 GNKQEAKCGFSKQILEILNSTGV-EYETFDILEDEEVRQGLKAYSNWPTYPQLYVKGELV 312

Query: 382 GGCDILLQMHQNGDLVEELK 441
           GG DI+ ++ +NG+L+  L+
Sbjct: 313 GGLDIVKELKENGELLPILR 332



 Score = 85.1 bits (209), Expect = 1e-16
 Identities = 36/92 (39%), Positives = 66/92 (71%)
 Frame = +1

Query: 202 GTPEQPQCGFSNAVVQILRLHGVRDYAAYNVLDDPQLRQGIKDYSNWPTIPQVYLNGEFV 381
           GTP++P+CGFS  +V+IL  H ++ ++++++  D ++RQG+K YS+WPT PQ+Y++GE +
Sbjct: 152 GTPQEPRCGFSKQMVEILHKHNIQ-FSSFDIFSDEEVRQGLKAYSSWPTYPQLYVSGELI 210

Query: 382 GGCDILLQMHQNGDLVEELKKLGIRSALLDEK 477
           GG DI+ ++  +    EEL  +  ++  L+E+
Sbjct: 211 GGLDIIKELEAS----EELDTICPKAPKLEER 238


  Database: RefSeqHP
    Posted date:  Aug 2, 2006 12:57 AM
  Number of letters in database: 17,774,539
  Number of sequences in database:  39,411
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 48,236,016
Number of Sequences: 39411
Number of extensions: 1517914
Number of successful extensions: 5002
Number of sequences better than 1.0e-05: 2
Number of HSP's better than  0.0 without gapping: 4032
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4989
length of database: 17,774,539
effective HSP length: 104
effective length of database: 13,675,795
effective search space used: 4007007935
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqCP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611S-002811
         (1193 letters)

Database: RefSeqCP 
           33,732 sequences; 19,266,565 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|XP_535061.2| PREDICTED: similar to Thioredoxin-like 2 protei...    87   2e-17

>ref|XP_535061.2| PREDICTED: similar to Thioredoxin-like 2 protein (PKC-interacting
           cousin of thioredoxin) (PKCq-interacting protein)
           (PKC-theta-interacting protein) [Canis familiaris]
          Length = 333

 Score = 87.4 bits (215), Expect = 2e-17
 Identities = 37/80 (46%), Positives = 58/80 (72%)
 Frame = +1

Query: 202 GTPEQPQCGFSNAVVQILRLHGVRDYAAYNVLDDPQLRQGIKDYSNWPTIPQVYLNGEFV 381
           G  ++ +CGFS  +++IL   GV +Y  +++L+D ++RQG+K YSNWPT PQ+Y+ GE V
Sbjct: 252 GNKQEAKCGFSKQILEILNSTGV-EYETFDILEDEEVRQGLKTYSNWPTYPQLYVKGELV 310

Query: 382 GGCDILLQMHQNGDLVEELK 441
           GG DI+ ++  NG+L+  LK
Sbjct: 311 GGLDIVKELKDNGELLPVLK 330



 Score = 87.0 bits (214), Expect = 3e-17
 Identities = 33/75 (44%), Positives = 58/75 (77%)
 Frame = +1

Query: 202 GTPEQPQCGFSNAVVQILRLHGVRDYAAYNVLDDPQLRQGIKDYSNWPTIPQVYLNGEFV 381
           GTP++P+CGFS  +V+IL  H ++ ++++++  D ++RQG+K YSNWPT PQ+Y++GE +
Sbjct: 150 GTPQEPRCGFSKQMVEILNKHNIQ-FSSFDIFSDEEVRQGLKTYSNWPTYPQLYVSGELI 208

Query: 382 GGCDILLQMHQNGDL 426
           GG DI+ ++  + +L
Sbjct: 209 GGLDIIKELEASDEL 223


  Database: RefSeqCP
    Posted date:  Aug 1, 2006  9:25 PM
  Number of letters in database: 19,266,565
  Number of sequences in database:  33,732
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 49,699,820
Number of Sequences: 33732
Number of extensions: 1505561
Number of successful extensions: 5235
Number of sequences better than 1.0e-05: 1
Number of HSP's better than  0.0 without gapping: 4289
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5214
length of database: 19,266,565
effective HSP length: 105
effective length of database: 15,724,705
effective search space used: 4591613860
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqMP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611S-002811
         (1193 letters)

Database: RefSeqMP 
           45,328 sequences; 21,768,885 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_082695.1| glutaredoxin 5 [Mus musculus]                        196   4e-50
Alignment   gi|NP_075629.2| thioredoxin-like 2 [Mus musculus]                     87   3e-17

>ref|NP_082695.1| glutaredoxin 5 [Mus musculus]
          Length = 152

 Score =  196 bits (498), Expect = 4e-50
 Identities = 95/98 (96%), Positives = 97/98 (98%)
 Frame = +1

Query: 202 GTPEQPQCGFSNAVVQILRLHGVRDYAAYNVLDDPQLRQGIKDYSNWPTIPQVYLNGEFV 381
           GTPEQPQCGFSNAVVQILRLHGVRDYAAYNVLDDP+LRQGIKDYSNWPTIPQVYLNGEFV
Sbjct: 56  GTPEQPQCGFSNAVVQILRLHGVRDYAAYNVLDDPELRQGIKDYSNWPTIPQVYLNGEFV 115

Query: 382 GGCDILLQMHQNGDLVEELKKLGIRSALLDEKTDQDSK 495
           GGCDILLQMHQNGDLVEELKKLGIRSAL+DEK DQDSK
Sbjct: 116 GGCDILLQMHQNGDLVEELKKLGIRSALVDEK-DQDSK 152


>ref|NP_075629.2| thioredoxin-like 2 [Mus musculus]
          Length = 337

 Score = 87.4 bits (215), Expect = 3e-17
 Identities = 37/92 (40%), Positives = 66/92 (71%)
 Frame = +1

Query: 202 GTPEQPQCGFSNAVVQILRLHGVRDYAAYNVLDDPQLRQGIKDYSNWPTIPQVYLNGEFV 381
           GTP++P+CGFS  +V+IL  H ++ ++++++  D ++RQG+K YSNWPT PQ+Y++GE +
Sbjct: 154 GTPQEPRCGFSKQMVEILHKHNIQ-FSSFDIFSDEEVRQGLKTYSNWPTYPQLYVSGELI 212

Query: 382 GGCDILLQMHQNGDLVEELKKLGIRSALLDEK 477
           GG DI+ ++  +    EEL  +  ++  L+E+
Sbjct: 213 GGLDIIKELEAS----EELDTICPKAPKLEER 240



 Score = 84.3 bits (207), Expect = 2e-16
 Identities = 35/80 (43%), Positives = 58/80 (72%)
 Frame = +1

Query: 202 GTPEQPQCGFSNAVVQILRLHGVRDYAAYNVLDDPQLRQGIKDYSNWPTIPQVYLNGEFV 381
           G  ++ +CGFS  +++IL   GV +Y  +++L+D ++RQG+K +SNWPT PQ+Y+ G+ V
Sbjct: 256 GNKQEAKCGFSKQILEILNSTGV-EYETFDILEDEEVRQGLKTFSNWPTYPQLYVRGDLV 314

Query: 382 GGCDILLQMHQNGDLVEELK 441
           GG DI+ ++  NG+L+  LK
Sbjct: 315 GGLDIVKELKDNGELLPILK 334


  Database: RefSeqMP
    Posted date:  Aug 2, 2006 12:58 AM
  Number of letters in database: 21,768,885
  Number of sequences in database:  45,328
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 56,145,961
Number of Sequences: 45328
Number of extensions: 1647604
Number of successful extensions: 5767
Number of sequences better than 1.0e-05: 2
Number of HSP's better than  0.0 without gapping: 4694
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5743
length of database: 21,768,885
effective HSP length: 106
effective length of database: 16,964,117
effective search space used: 4936558047
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)