Animal-Genome cDNA 20060611S-003249


Search to RefSeqSP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611S-003249
         (967 letters)

Database: RefSeqSP 
           1040 sequences; 434,620 total letters

Searching...done

 ***** No hits found ******

  Database: RefSeqSP
    Posted date:  Aug 1, 2006  7:14 PM
  Number of letters in database: 434,620
  Number of sequences in database:  1040
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 851,948
Number of Sequences: 1040
Number of extensions: 20209
Number of successful extensions: 53
Number of sequences better than 1.0e-05: 0
Number of HSP's better than  0.0 without gapping: 51
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 53
length of database: 434,620
effective HSP length: 77
effective length of database: 354,540
effective search space used: 86507760
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqBP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611S-003249
         (967 letters)

Database: RefSeqBP 
           33,508 sequences; 16,112,626 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|XP_584500.2| PREDICTED: similar to NAD-dependent malic enzym...   417   e-117
Alignment   gi|XP_604169.2| PREDICTED: similar to malic enzyme 3, NADP(+)-d...   240   1e-63
Alignment   gi|XP_613987.2| PREDICTED: similar to NADP-dependent malic enzy...   148   3e-39
Alignment   gi|XP_596455.2| PREDICTED: similar to NADP-dependent malic enzy...    77   3e-14

>ref|XP_584500.2| PREDICTED: similar to NAD-dependent malic enzyme, mitochondrial
           precursor (NAD-ME) (Malic enzyme 2), partial [Bos
           taurus]
          Length = 513

 Score =  417 bits (1073), Expect = e-117
 Identities = 202/236 (85%), Positives = 213/236 (90%)
 Frame = +1

Query: 1   RILGLGDLGVYGMGIPVGKLCLYTACAGIRPDRCLPVCIDVGTDNPALLKDPFYMGLYQK 180
           RILGLGDLGVYGMGIPVGKLCLYTACAGIRPDRCLPVCIDVGTDNPALLKDPFYMGLYQK
Sbjct: 240 RILGLGDLGVYGMGIPVGKLCLYTACAGIRPDRCLPVCIDVGTDNPALLKDPFYMGLYQK 299

Query: 181 RDRSQRYDDLIDEFMKAITDRYGRNILIQFEDFGNHNAFRFLRKYREKYCTFNDDIQGTX 360
           RDRSQRYDDLIDEFMKAITDRYG+N LIQFEDFGNHNAFRFLRKYREKYCTFNDDIQGT 
Sbjct: 300 RDRSQRYDDLIDEFMKAITDRYGQNTLIQFEDFGNHNAFRFLRKYREKYCTFNDDIQGTA 359

Query: 361 XXXXXXXXXXQKVIGKSISEHKILFLGAGEAALGIANLIVMAMVENGLSEEEAQKKIWMV 540
                     QKVIGK IS+H+ILFLGAGEAALGIANLIVMAMVENGLSEEEA+KKIWMV
Sbjct: 360 AVALAGLLAAQKVIGKPISDHRILFLGAGEAALGIANLIVMAMVENGLSEEEARKKIWMV 419

Query: 541 DKFGLLFKGRKAKINRHQEPFAHPAPNNIPDNFEKSVNILNPSPIIGISGTCRLFS 708
           DKFGLLFKGRKAKI  HQE FAH AP ++PD FE++VNIL PS IIG++G  RLF+
Sbjct: 420 DKFGLLFKGRKAKIESHQEAFAHSAPESLPDTFEEAVNILKPSAIIGVAGAGRLFT 475


>ref|XP_604169.2| PREDICTED: similar to malic enzyme 3, NADP(+)-dependent,
           mitochondrial [Bos taurus]
          Length = 564

 Score =  240 bits (613), Expect = 1e-63
 Identities = 124/238 (52%), Positives = 160/238 (67%), Gaps = 2/238 (0%)
 Frame = +1

Query: 1   RILGLGDLGVYGMGIPVGKLCLYTACAGIRPDRCLPVCIDVGTDNPALLKDPFYMGLYQK 180
           RILGLGDLG YGMGIPVGKL LYTAC G+ P +CLPV +DVGT+N  LL+DP Y+GL  +
Sbjct: 128 RILGLGDLGCYGMGIPVGKLALYTACGGVNPRQCLPVLLDVGTNNEELLRDPLYIGLKHR 187

Query: 181 RDRSQRYDDLIDEFMKAITDRYGRNILIQFEDFGNHNAFRFLRKYREKYCTFNDDIQGTX 360
           R R Q YDDL+DEFM+A+TD++G N LIQFEDF N NAFR L KYR KYC FNDDIQGT 
Sbjct: 188 RVRGQEYDDLLDEFMQAVTDKFGINCLIQFEDFANANAFRLLNKYRNKYCMFNDDIQGTA 247

Query: 361 XXXXXXXXXXQKVIGKSISEHKILFLGAGEAALGIANLIVMAMVENGLSEEEAQKKIWMV 540
                      ++    +S H  +F GAGEAA+GIA+L+VMA+ + G+S +E     WM 
Sbjct: 248 SVAVAGILAALRITKNKLSNHVFVFQGAGEAAMGIAHLLVMALEKEGISRQE----YWM- 302

Query: 541 DKFGLLFKGRKAKINRHQEPFA--HPAPNNIPDNFEKSVNILNPSPIIGISGTCRLFS 708
             F L  +GR + +N  +E FA  HP  N++    E+ V ++ P+ IIG++     F+
Sbjct: 303 --FFLSLQGR-SHLNHEKEMFAQDHPEVNSL----EEVVRLVKPTAIIGVAAIAGAFT 353


>ref|XP_613987.2| PREDICTED: similar to NADP-dependent malic enzyme (NADP-ME) (Malic
           enzyme 1) [Bos taurus]
          Length = 472

 Score =  148 bits (374), Expect(2) = 3e-39
 Identities = 78/162 (48%), Positives = 104/162 (64%)
 Frame = +1

Query: 223 MKAITDRYGRNILIQFEDFGNHNAFRFLRKYREKYCTFNDDIQGTXXXXXXXXXXXQKVI 402
           +  ++ RYG N LIQFEDF N NAFR LRKY+ +YCTFNDDIQGT            ++ 
Sbjct: 130 VNVLSHRYGMNCLIQFEDFANINAFRLLRKYQNQYCTFNDDIQGTASVAVAGILAALRIT 189

Query: 403 GKSISEHKILFLGAGEAALGIANLIVMAMVENGLSEEEAQKKIWMVDKFGLLFKGRKAKI 582
              +S+  +LF GAGEAALGIA+LIVMAM + GLS+E+A +KIW+VD  GL+ KGR A +
Sbjct: 190 KNKLSDQTVLFQGAGEAALGIAHLIVMAMEKEGLSKEQAIEKIWLVDSKGLIVKGR-AAL 248

Query: 583 NRHQEPFAHPAPNNIPDNFEKSVNILNPSPIIGISGTCRLFS 708
            + +E FAH   +    N E  V  + P+ +IG++     FS
Sbjct: 249 TQEKEEFAH--EHKEMKNLEAIVQDIKPTALIGVAAIGGAFS 288



 Score = 32.3 bits (72), Expect(2) = 3e-39
 Identities = 19/59 (32%), Positives = 27/59 (45%)
 Frame = +3

Query: 750 PINFGFINPTLQVVFSS**TYTLSRGRVLYPIAISFSPSNLFLLVVSYPLYNNLSHFFP 926
           PI F   NPT +   ++   Y L++GR ++     F P  L      YP   N S+ FP
Sbjct: 302 PIIFALSNPTSKAECTAEQCYKLTKGRAIFASGSPFDPVTLPSGKTLYPGQGNNSYVFP 360


>ref|XP_596455.2| PREDICTED: similar to NADP-dependent malic enzyme (NADP-ME) (Malic
           enzyme 1) [Bos taurus]
          Length = 157

 Score = 76.6 bits (187), Expect = 3e-14
 Identities = 34/45 (75%), Positives = 38/45 (84%)
 Frame = +1

Query: 1   RILGLGDLGVYGMGIPVGKLCLYTACAGIRPDRCLPVCIDVGTDN 135
           RILGLGDLG  GMGIPVGKL LYTAC G+ P +CLPV +DVGT+N
Sbjct: 106 RILGLGDLGCNGMGIPVGKLALYTACGGMNPQQCLPVMLDVGTEN 150


  Database: RefSeqBP
    Posted date:  Aug 1, 2006  7:14 PM
  Number of letters in database: 16,112,626
  Number of sequences in database:  33,508
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 30,157,257
Number of Sequences: 33508
Number of extensions: 700408
Number of successful extensions: 1686
Number of sequences better than 1.0e-05: 4
Number of HSP's better than  0.0 without gapping: 1544
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1685
length of database: 16,112,626
effective HSP length: 102
effective length of database: 12,694,810
effective search space used: 2780163390
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqHP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611S-003249
         (967 letters)

Database: RefSeqHP 
           39,411 sequences; 17,774,539 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_002387.1| malic enzyme 2, NAD(+)-dependent, mitochondrial...   405   e-116
Alignment   gi|NP_002386.1| cytosolic malic enzyme 1 [Homo sapiens]              257   1e-71
Alignment   gi|NP_001014811.1| malic enzyme 3, NADP(+)-dependent, mitochond...   257   9e-69
Alignment   gi|NP_006671.2| malic enzyme 3, NADP(+)-dependent, mitochondria...   257   9e-69
Alignment   gi|XP_934770.1| PREDICTED: similar to NAD-dependent malic enzym...   179   2e-45
Alignment   gi|XP_944182.1| PREDICTED: similar to NAD-dependent malic enzym...   179   2e-45

>ref|NP_002387.1| malic enzyme 2, NAD(+)-dependent, mitochondrial [Homo sapiens]
          Length = 584

 Score =  405 bits (1042), Expect(2) = e-116
 Identities = 197/236 (83%), Positives = 209/236 (88%)
 Frame = +1

Query: 1   RILGLGDLGVYGMGIPVGKLCLYTACAGIRPDRCLPVCIDVGTDNPALLKDPFYMGLYQK 180
           RILGLGDLGVYGMGIPVGKLCLYTACAGIRPDRCLPVCIDVGTDN ALLKDPFYMGLYQK
Sbjct: 165 RILGLGDLGVYGMGIPVGKLCLYTACAGIRPDRCLPVCIDVGTDNIALLKDPFYMGLYQK 224

Query: 181 RDRSQRYDDLIDEFMKAITDRYGRNILIQFEDFGNHNAFRFLRKYREKYCTFNDDIQGTX 360
           RDR+Q+YDDLIDEFMKAITDRYGRN LIQFEDFGNHNAFRFLRKYREKYCTFNDDIQGT 
Sbjct: 225 RDRTQQYDDLIDEFMKAITDRYGRNTLIQFEDFGNHNAFRFLRKYREKYCTFNDDIQGTA 284

Query: 361 XXXXXXXXXXQKVIGKSISEHKILFLGAGEAALGIANLIVMAMVENGLSEEEAQKKIWMV 540
                     QKVI K ISEHKILFLGAGEAALGIANLIVM+MVENGLSE+EAQKKIWM 
Sbjct: 285 AVALAGLLAAQKVISKPISEHKILFLGAGEAALGIANLIVMSMVENGLSEQEAQKKIWMF 344

Query: 541 DKFGLLFKGRKAKINRHQEPFAHPAPNNIPDNFEKSVNILNPSPIIGISGTCRLFS 708
           DK+GLL KGRKAKI+ +QEPF H AP +IPD FE +VNIL PS IIG++G  RLF+
Sbjct: 345 DKYGLLVKGRKAKIDSYQEPFTHSAPESIPDTFEDAVNILKPSTIIGVAGAGRLFT 400



 Score = 32.0 bits (71), Expect(2) = e-116
 Identities = 20/59 (33%), Positives = 26/59 (44%)
 Frame = +3

Query: 750 PINFGFINPTLQVVFSS**TYTLSRGRVLYPIAISFSPSNLFLLVVSYPLYNNLSHFFP 926
           P+ F   NPT Q   ++   YTL+ GR L+     F P  L    V  P   N  + FP
Sbjct: 414 PVIFALSNPTAQAECTAEEAYTLTEGRCLFASGSPFGPVKLTDGRVFTPGQGNNVYIFP 472


>ref|NP_002386.1| cytosolic malic enzyme 1 [Homo sapiens]
          Length = 572

 Score =  257 bits (656), Expect(2) = 1e-71
 Identities = 130/236 (55%), Positives = 161/236 (68%)
 Frame = +1

Query: 1   RILGLGDLGVYGMGIPVGKLCLYTACAGIRPDRCLPVCIDVGTDNPALLKDPFYMGLYQK 180
           RILGLGDLG  GMGIPVGKL LYTAC G+ P  CLPV +DVGT+N  LLKDP Y+GL Q+
Sbjct: 155 RILGLGDLGCNGMGIPVGKLALYTACGGMNPQECLPVILDVGTENEELLKDPLYIGLRQR 214

Query: 181 RDRSQRYDDLIDEFMKAITDRYGRNILIQFEDFGNHNAFRFLRKYREKYCTFNDDIQGTX 360
           R R   YDD +DEFM+A++ +YG N LIQFEDF N NAFR L KYR +YCTFNDDIQGT 
Sbjct: 215 RVRGSEYDDFLDEFMEAVSSKYGMNCLIQFEDFANVNAFRLLNKYRNQYCTFNDDIQGTA 274

Query: 361 XXXXXXXXXXQKVIGKSISEHKILFLGAGEAALGIANLIVMAMVENGLSEEEAQKKIWMV 540
                      ++    +S+  ILF GAGEAALGIA+LIVMA+ + GL +E+A KKIW+V
Sbjct: 275 SVAVAGLLAALRITKNKLSDQTILFQGAGEAALGIAHLIVMALEKEGLPKEKAIKKIWLV 334

Query: 541 DKFGLLFKGRKAKINRHQEPFAHPAPNNIPDNFEKSVNILNPSPIIGISGTCRLFS 708
           D  GL+ KGR A + + +E FAH   +    N E  V  + P+ +IG++     FS
Sbjct: 335 DSKGLIVKGR-ASLTQEKEKFAH--EHEEMKNLEAIVQEIKPTALIGVAAIGGAFS 387



 Score = 32.3 bits (72), Expect(2) = 1e-71
 Identities = 19/59 (32%), Positives = 27/59 (45%)
 Frame = +3

Query: 750 PINFGFINPTLQVVFSS**TYTLSRGRVLYPIAISFSPSNLFLLVVSYPLYNNLSHFFP 926
           PI F   NPT +   S+   Y +++GR ++     F P  L      YP   N S+ FP
Sbjct: 401 PIIFALSNPTSKAECSAEQCYKITKGRAIFASGSPFDPVTLPNGQTLYPGQGNNSYVFP 459


>ref|NP_001014811.1| malic enzyme 3, NADP(+)-dependent, mitochondrial [Homo sapiens]
          Length = 604

 Score =  257 bits (657), Expect = 9e-69
 Identities = 127/238 (53%), Positives = 165/238 (69%), Gaps = 2/238 (0%)
 Frame = +1

Query: 1   RILGLGDLGVYGMGIPVGKLCLYTACAGIRPDRCLPVCIDVGTDNPALLKDPFYMGLYQK 180
           RILGLGDLG YGMGIPVGKL LYTAC G+ P +CLPV +DVGT+N  LL+DP Y+GL  +
Sbjct: 190 RILGLGDLGCYGMGIPVGKLALYTACGGVNPQQCLPVLLDVGTNNEELLRDPLYIGLKHQ 249

Query: 181 RDRSQRYDDLIDEFMKAITDRYGRNILIQFEDFGNHNAFRFLRKYREKYCTFNDDIQGTX 360
           R   + YDDL+DEFM+A+TD++G N LIQFEDF N NAFR L KYR KYC FNDDIQGT 
Sbjct: 250 RVHGKAYDDLLDEFMQAVTDKFGINCLIQFEDFANANAFRLLNKYRNKYCMFNDDIQGTA 309

Query: 361 XXXXXXXXXXQKVIGKSISEHKILFLGAGEAALGIANLIVMAMVENGLSEEEAQKKIWMV 540
                      ++    +S H  +F GAGEAA+GIA+L+VMA+ + G+ + EA +KIWMV
Sbjct: 310 SVAVAGILAALRITKNKLSNHVFVFQGAGEAAMGIAHLLVMALEKEGVPKAEATRKIWMV 369

Query: 541 DKFGLLFKGRKAKINRHQEPFA--HPAPNNIPDNFEKSVNILNPSPIIGISGTCRLFS 708
           D  GL+ KGR + +N  +E FA  HP  N++    E+ V ++ P+ IIG++     F+
Sbjct: 370 DSKGLIVKGR-SHLNHEKEMFAQDHPEVNSL----EEVVRLVKPTAIIGVAAIAGAFT 422


>ref|NP_006671.2| malic enzyme 3, NADP(+)-dependent, mitochondrial [Homo sapiens]
          Length = 604

 Score =  257 bits (657), Expect = 9e-69
 Identities = 127/238 (53%), Positives = 165/238 (69%), Gaps = 2/238 (0%)
 Frame = +1

Query: 1   RILGLGDLGVYGMGIPVGKLCLYTACAGIRPDRCLPVCIDVGTDNPALLKDPFYMGLYQK 180
           RILGLGDLG YGMGIPVGKL LYTAC G+ P +CLPV +DVGT+N  LL+DP Y+GL  +
Sbjct: 190 RILGLGDLGCYGMGIPVGKLALYTACGGVNPQQCLPVLLDVGTNNEELLRDPLYIGLKHQ 249

Query: 181 RDRSQRYDDLIDEFMKAITDRYGRNILIQFEDFGNHNAFRFLRKYREKYCTFNDDIQGTX 360
           R   + YDDL+DEFM+A+TD++G N LIQFEDF N NAFR L KYR KYC FNDDIQGT 
Sbjct: 250 RVHGKAYDDLLDEFMQAVTDKFGINCLIQFEDFANANAFRLLNKYRNKYCMFNDDIQGTA 309

Query: 361 XXXXXXXXXXQKVIGKSISEHKILFLGAGEAALGIANLIVMAMVENGLSEEEAQKKIWMV 540
                      ++    +S H  +F GAGEAA+GIA+L+VMA+ + G+ + EA +KIWMV
Sbjct: 310 SVAVAGILAALRITKNKLSNHVFVFQGAGEAAMGIAHLLVMALEKEGVPKAEATRKIWMV 369

Query: 541 DKFGLLFKGRKAKINRHQEPFA--HPAPNNIPDNFEKSVNILNPSPIIGISGTCRLFS 708
           D  GL+ KGR + +N  +E FA  HP  N++    E+ V ++ P+ IIG++     F+
Sbjct: 370 DSKGLIVKGR-SHLNHEKEMFAQDHPEVNSL----EEVVRLVKPTAIIGVAAIAGAFT 422


>ref|XP_934770.1| PREDICTED: similar to NAD-dependent malic enzyme, mitochondrial
           precursor (NAD-ME) (Malic enzyme 2) [Homo sapiens]
          Length = 196

 Score =  179 bits (455), Expect = 2e-45
 Identities = 86/106 (81%), Positives = 92/106 (86%)
 Frame = +1

Query: 1   RILGLGDLGVYGMGIPVGKLCLYTACAGIRPDRCLPVCIDVGTDNPALLKDPFYMGLYQK 180
           RILG GDLGVYGMGIPVGK+CLYT C GI PDRCL VCIDVG DN ALLK  FYMGLYQK
Sbjct: 91  RILGHGDLGVYGMGIPVGKICLYTVCPGIWPDRCLLVCIDVGADNIALLKGTFYMGLYQK 150

Query: 181 RDRSQRYDDLIDEFMKAITDRYGRNILIQFEDFGNHNAFRFLRKYR 318
           RDR+Q+ DD IDEFMKAITDRYG N L+QFE FG+HNAFRFLRKY+
Sbjct: 151 RDRTQQSDDPIDEFMKAITDRYGWNTLLQFEGFGHHNAFRFLRKYQ 196


>ref|XP_944182.1| PREDICTED: similar to NAD-dependent malic enzyme, mitochondrial
           precursor (NAD-ME) (Malic enzyme 2) [Homo sapiens]
          Length = 196

 Score =  179 bits (455), Expect = 2e-45
 Identities = 86/106 (81%), Positives = 92/106 (86%)
 Frame = +1

Query: 1   RILGLGDLGVYGMGIPVGKLCLYTACAGIRPDRCLPVCIDVGTDNPALLKDPFYMGLYQK 180
           RILG GDLGVYGMGIPVGK+CLYT C GI PDRCL VCIDVG DN ALLK  FYMGLYQK
Sbjct: 91  RILGHGDLGVYGMGIPVGKICLYTVCPGIWPDRCLLVCIDVGADNIALLKGTFYMGLYQK 150

Query: 181 RDRSQRYDDLIDEFMKAITDRYGRNILIQFEDFGNHNAFRFLRKYR 318
           RDR+Q+ DD IDEFMKAITDRYG N L+QFE FG+HNAFRFLRKY+
Sbjct: 151 RDRTQQSDDPIDEFMKAITDRYGWNTLLQFEGFGHHNAFRFLRKYQ 196


  Database: RefSeqHP
    Posted date:  Aug 2, 2006 12:57 AM
  Number of letters in database: 17,774,539
  Number of sequences in database:  39,411
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 33,489,737
Number of Sequences: 39411
Number of extensions: 780570
Number of successful extensions: 1895
Number of sequences better than 1.0e-05: 6
Number of HSP's better than  0.0 without gapping: 1763
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1894
length of database: 17,774,539
effective HSP length: 102
effective length of database: 13,754,617
effective search space used: 3012261123
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqCP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611S-003249
         (967 letters)

Database: RefSeqCP 
           33,732 sequences; 19,266,565 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|XP_849530.1| PREDICTED: similar to NAD-dependent malic enzym...   424   e-120
Alignment   gi|XP_533402.2| PREDICTED: similar to NAD-dependent malic enzym...   424   e-120
Alignment   gi|XP_532217.2| PREDICTED: similar to NADP-dependent malic enzy...   260   2e-72
Alignment   gi|XP_542269.2| PREDICTED: similar to malic enzyme 3, NADP(+)-d...   258   8e-69
Alignment   gi|XP_848770.1| PREDICTED: similar to malic enzyme 3, NADP(+)-d...   258   8e-69
Alignment   gi|XP_857051.1| PREDICTED: similar to malic enzyme 3, NADP(+)-d...   256   2e-68
Alignment   gi|XP_857177.1| PREDICTED: similar to malic enzyme 3, NADP(+)-d...   255   5e-68
Alignment   gi|XP_857135.1| PREDICTED: similar to malic enzyme 3, NADP(+)-d...   253   2e-67
Alignment   gi|XP_857227.1| PREDICTED: similar to malic enzyme 3, NADP(+)-d...   246   2e-65

>ref|XP_849530.1| PREDICTED: similar to NAD-dependent malic enzyme, mitochondrial
           precursor (NAD-ME) (Malic enzyme 2) isoform 2 [Canis
           familiaris]
          Length = 584

 Score =  424 bits (1089), Expect(2) = e-120
 Identities = 207/236 (87%), Positives = 212/236 (89%)
 Frame = +1

Query: 1   RILGLGDLGVYGMGIPVGKLCLYTACAGIRPDRCLPVCIDVGTDNPALLKDPFYMGLYQK 180
           RILGLGDLGVYGMGIPVGKLCLYTACAGIRPDRCLPVCIDVGTDNPALLKDPFYMGLYQK
Sbjct: 165 RILGLGDLGVYGMGIPVGKLCLYTACAGIRPDRCLPVCIDVGTDNPALLKDPFYMGLYQK 224

Query: 181 RDRSQRYDDLIDEFMKAITDRYGRNILIQFEDFGNHNAFRFLRKYREKYCTFNDDIQGTX 360
           RDRSQRYDDLIDEFMKAITDRYG+N LIQFEDFGNHNAFRFLRKYREKYCTFNDDIQGT 
Sbjct: 225 RDRSQRYDDLIDEFMKAITDRYGQNTLIQFEDFGNHNAFRFLRKYREKYCTFNDDIQGTA 284

Query: 361 XXXXXXXXXXQKVIGKSISEHKILFLGAGEAALGIANLIVMAMVENGLSEEEAQKKIWMV 540
                     QKVIGKS SEHKILFLGAGEAALGIANLIVMAMVENGLSEEEAQKKIWMV
Sbjct: 285 AVALAGLLAAQKVIGKSFSEHKILFLGAGEAALGIANLIVMAMVENGLSEEEAQKKIWMV 344

Query: 541 DKFGLLFKGRKAKINRHQEPFAHPAPNNIPDNFEKSVNILNPSPIIGISGTCRLFS 708
           DKFGLLFKGRKAKI  HQEPFAH AP  IPD FE +VNIL PS IIG++G  RLF+
Sbjct: 345 DKFGLLFKGRKAKIENHQEPFAHSAPGIIPDTFEDAVNILRPSAIIGVAGAGRLFT 400



 Score = 29.3 bits (64), Expect(2) = e-120
 Identities = 18/59 (30%), Positives = 25/59 (42%)
 Frame = +3

Query: 750 PINFGFINPTLQVVFSS**TYTLSRGRVLYPIAISFSPSNLFLLVVSYPLYNNLSHFFP 926
           P+ F   NPT     ++   YTL+ GR L+     F P  L    +  P   N  + FP
Sbjct: 414 PVIFALSNPTAMAECTAEEAYTLTEGRCLFASGSPFEPVKLSDGQLFTPGQGNNVYIFP 472


>ref|XP_533402.2| PREDICTED: similar to NAD-dependent malic enzyme, mitochondrial
           precursor (NAD-ME) (Malic enzyme 2) isoform 1 [Canis
           familiaris]
          Length = 499

 Score =  424 bits (1089), Expect(2) = e-120
 Identities = 207/236 (87%), Positives = 212/236 (89%)
 Frame = +1

Query: 1   RILGLGDLGVYGMGIPVGKLCLYTACAGIRPDRCLPVCIDVGTDNPALLKDPFYMGLYQK 180
           RILGLGDLGVYGMGIPVGKLCLYTACAGIRPDRCLPVCIDVGTDNPALLKDPFYMGLYQK
Sbjct: 80  RILGLGDLGVYGMGIPVGKLCLYTACAGIRPDRCLPVCIDVGTDNPALLKDPFYMGLYQK 139

Query: 181 RDRSQRYDDLIDEFMKAITDRYGRNILIQFEDFGNHNAFRFLRKYREKYCTFNDDIQGTX 360
           RDRSQRYDDLIDEFMKAITDRYG+N LIQFEDFGNHNAFRFLRKYREKYCTFNDDIQGT 
Sbjct: 140 RDRSQRYDDLIDEFMKAITDRYGQNTLIQFEDFGNHNAFRFLRKYREKYCTFNDDIQGTA 199

Query: 361 XXXXXXXXXXQKVIGKSISEHKILFLGAGEAALGIANLIVMAMVENGLSEEEAQKKIWMV 540
                     QKVIGKS SEHKILFLGAGEAALGIANLIVMAMVENGLSEEEAQKKIWMV
Sbjct: 200 AVALAGLLAAQKVIGKSFSEHKILFLGAGEAALGIANLIVMAMVENGLSEEEAQKKIWMV 259

Query: 541 DKFGLLFKGRKAKINRHQEPFAHPAPNNIPDNFEKSVNILNPSPIIGISGTCRLFS 708
           DKFGLLFKGRKAKI  HQEPFAH AP  IPD FE +VNIL PS IIG++G  RLF+
Sbjct: 260 DKFGLLFKGRKAKIENHQEPFAHSAPGIIPDTFEDAVNILRPSAIIGVAGAGRLFT 315



 Score = 29.3 bits (64), Expect(2) = e-120
 Identities = 18/59 (30%), Positives = 25/59 (42%)
 Frame = +3

Query: 750 PINFGFINPTLQVVFSS**TYTLSRGRVLYPIAISFSPSNLFLLVVSYPLYNNLSHFFP 926
           P+ F   NPT     ++   YTL+ GR L+     F P  L    +  P   N  + FP
Sbjct: 329 PVIFALSNPTAMAECTAEEAYTLTEGRCLFASGSPFEPVKLSDGQLFTPGQGNNVYIFP 387


>ref|XP_532217.2| PREDICTED: similar to NADP-dependent malic enzyme (NADP-ME) (Malic
           enzyme 1) [Canis familiaris]
          Length = 634

 Score =  260 bits (665), Expect(2) = 2e-72
 Identities = 131/236 (55%), Positives = 163/236 (69%)
 Frame = +1

Query: 1   RILGLGDLGVYGMGIPVGKLCLYTACAGIRPDRCLPVCIDVGTDNPALLKDPFYMGLYQK 180
           RILGLGDLG  GMGIPVGKL LYTAC G+ P  CLPV +DVGT+N ALLKDP Y+GL Q+
Sbjct: 217 RILGLGDLGCNGMGIPVGKLALYTACGGMNPQECLPVILDVGTENEALLKDPLYIGLRQR 276

Query: 181 RDRSQRYDDLIDEFMKAITDRYGRNILIQFEDFGNHNAFRFLRKYREKYCTFNDDIQGTX 360
           R R   YDD +DEFM+A++ +YG N LIQFEDF N NAFR L+KY+ +YCTFNDDIQGT 
Sbjct: 277 RVRGPEYDDFLDEFMEAVSSKYGMNCLIQFEDFANINAFRLLKKYQNRYCTFNDDIQGTA 336

Query: 361 XXXXXXXXXXQKVIGKSISEHKILFLGAGEAALGIANLIVMAMVENGLSEEEAQKKIWMV 540
                      ++    +S+ KILF GAGEAALGIA+LIVMAM + GL +E+A K IW+V
Sbjct: 337 SVAVAGILAALRITKNKLSDQKILFQGAGEAALGIAHLIVMAMEKEGLPKEKAMKNIWLV 396

Query: 541 DKFGLLFKGRKAKINRHQEPFAHPAPNNIPDNFEKSVNILNPSPIIGISGTCRLFS 708
           D  GL+ KGR A + + +E FAH   +    N E  V  + P+ +IG++     FS
Sbjct: 397 DSKGLIVKGR-AALTQEKEQFAH--EHEEMKNLEAIVQEIKPTALIGVAAIGGAFS 449



 Score = 31.6 bits (70), Expect(2) = 2e-72
 Identities = 19/59 (32%), Positives = 27/59 (45%)
 Frame = +3

Query: 750 PINFGFINPTLQVVFSS**TYTLSRGRVLYPIAISFSPSNLFLLVVSYPLYNNLSHFFP 926
           PI F   NPT +   ++   Y L++GR ++     F P  L      YP   N S+ FP
Sbjct: 463 PIIFALSNPTSKAECTAEQCYKLTKGRAIFASGSPFDPVTLPNGRTLYPGQGNNSYVFP 521


>ref|XP_542269.2| PREDICTED: similar to malic enzyme 3, NADP(+)-dependent,
           mitochondrial isoform 1 [Canis familiaris]
          Length = 569

 Score =  258 bits (658), Expect = 8e-69
 Identities = 126/236 (53%), Positives = 163/236 (69%)
 Frame = +1

Query: 1   RILGLGDLGVYGMGIPVGKLCLYTACAGIRPDRCLPVCIDVGTDNPALLKDPFYMGLYQK 180
           RILGLGDLG YGMGIPVGKL LYTAC G+ P +CLPV +DVGT+N  LL+DP Y+GL  +
Sbjct: 155 RILGLGDLGCYGMGIPVGKLALYTACGGVSPQQCLPVLLDVGTNNEELLRDPLYIGLKHQ 214

Query: 181 RDRSQRYDDLIDEFMKAITDRYGRNILIQFEDFGNHNAFRFLRKYREKYCTFNDDIQGTX 360
           R R + YDDL+DEFM+A+TD++G N LIQFEDF N NAFR L KYR KYC FNDDIQGT 
Sbjct: 215 RVRGKEYDDLLDEFMQAVTDKFGINCLIQFEDFANANAFRLLNKYRNKYCMFNDDIQGTA 274

Query: 361 XXXXXXXXXXQKVIGKSISEHKILFLGAGEAALGIANLIVMAMVENGLSEEEAQKKIWMV 540
                      ++    +S H  +F GAGEAA+GIA+L+VMA+ + G+ + EA +KIWMV
Sbjct: 275 SVAVAGILAALRITKNKLSNHVFVFQGAGEAAMGIAHLLVMALEKEGVPKAEATRKIWMV 334

Query: 541 DKFGLLFKGRKAKINRHQEPFAHPAPNNIPDNFEKSVNILNPSPIIGISGTCRLFS 708
           D  GL+ KGR + +N  +E FA   P     + E+ V ++ P+ IIG++     F+
Sbjct: 335 DSKGLIVKGR-SHLNHEKEMFAQDHPE--VKSLEEVVRLVKPTAIIGVAAIAGAFT 387


>ref|XP_848770.1| PREDICTED: similar to malic enzyme 3, NADP(+)-dependent,
           mitochondrial isoform 2 [Canis familiaris]
          Length = 604

 Score =  258 bits (658), Expect = 8e-69
 Identities = 126/236 (53%), Positives = 163/236 (69%)
 Frame = +1

Query: 1   RILGLGDLGVYGMGIPVGKLCLYTACAGIRPDRCLPVCIDVGTDNPALLKDPFYMGLYQK 180
           RILGLGDLG YGMGIPVGKL LYTAC G+ P +CLPV +DVGT+N  LL+DP Y+GL  +
Sbjct: 190 RILGLGDLGCYGMGIPVGKLALYTACGGVSPQQCLPVLLDVGTNNEELLRDPLYIGLKHQ 249

Query: 181 RDRSQRYDDLIDEFMKAITDRYGRNILIQFEDFGNHNAFRFLRKYREKYCTFNDDIQGTX 360
           R R + YDDL+DEFM+A+TD++G N LIQFEDF N NAFR L KYR KYC FNDDIQGT 
Sbjct: 250 RVRGKEYDDLLDEFMQAVTDKFGINCLIQFEDFANANAFRLLNKYRNKYCMFNDDIQGTA 309

Query: 361 XXXXXXXXXXQKVIGKSISEHKILFLGAGEAALGIANLIVMAMVENGLSEEEAQKKIWMV 540
                      ++    +S H  +F GAGEAA+GIA+L+VMA+ + G+ + EA +KIWMV
Sbjct: 310 SVAVAGILAALRITKNKLSNHVFVFQGAGEAAMGIAHLLVMALEKEGVPKAEATRKIWMV 369

Query: 541 DKFGLLFKGRKAKINRHQEPFAHPAPNNIPDNFEKSVNILNPSPIIGISGTCRLFS 708
           D  GL+ KGR + +N  +E FA   P     + E+ V ++ P+ IIG++     F+
Sbjct: 370 DSKGLIVKGR-SHLNHEKEMFAQDHPE--VKSLEEVVRLVKPTAIIGVAAIAGAFT 422


>ref|XP_857051.1| PREDICTED: similar to malic enzyme 3, NADP(+)-dependent,
           mitochondrial isoform 3 [Canis familiaris]
          Length = 361

 Score =  256 bits (655), Expect = 2e-68
 Identities = 126/233 (54%), Positives = 161/233 (69%)
 Frame = +1

Query: 1   RILGLGDLGVYGMGIPVGKLCLYTACAGIRPDRCLPVCIDVGTDNPALLKDPFYMGLYQK 180
           RILGLGDLG YGMGIPVGKL LYTAC G+ P +CLPV +DVGT+N  LL+DP Y+GL  +
Sbjct: 128 RILGLGDLGCYGMGIPVGKLALYTACGGVSPQQCLPVLLDVGTNNEELLRDPLYIGLKHQ 187

Query: 181 RDRSQRYDDLIDEFMKAITDRYGRNILIQFEDFGNHNAFRFLRKYREKYCTFNDDIQGTX 360
           R R + YDDL+DEFM+A+TD++G N LIQFEDF N NAFR L KYR KYC FNDDIQGT 
Sbjct: 188 RVRGKEYDDLLDEFMQAVTDKFGINCLIQFEDFANANAFRLLNKYRNKYCMFNDDIQGTA 247

Query: 361 XXXXXXXXXXQKVIGKSISEHKILFLGAGEAALGIANLIVMAMVENGLSEEEAQKKIWMV 540
                      ++    +S H  +F GAGEAA+GIA+L+VMA+ + G+ + EA +KIWMV
Sbjct: 248 SVAVAGILAALRITKNKLSNHVFVFQGAGEAAMGIAHLLVMALEKEGVPKAEATRKIWMV 307

Query: 541 DKFGLLFKGRKAKINRHQEPFAHPAPNNIPDNFEKSVNILNPSPIIGISGTCR 699
           D  GL+ KGR + +N  +E FA   P     + E+ V ++ P+ IIG    C+
Sbjct: 308 DSKGLIVKGR-SHLNHEKEMFAQDHPE--VKSLEEVVRLVKPTAIIGPRDLCQ 357


>ref|XP_857177.1| PREDICTED: similar to malic enzyme 3, NADP(+)-dependent,
           mitochondrial isoform 6 [Canis familiaris]
          Length = 513

 Score =  255 bits (651), Expect = 5e-68
 Identities = 125/227 (55%), Positives = 159/227 (70%)
 Frame = +1

Query: 1   RILGLGDLGVYGMGIPVGKLCLYTACAGIRPDRCLPVCIDVGTDNPALLKDPFYMGLYQK 180
           RILGLGDLG YGMGIPVGKL LYTAC G+ P +CLPV +DVGT+N  LL+DP Y+GL  +
Sbjct: 128 RILGLGDLGCYGMGIPVGKLALYTACGGVSPQQCLPVLLDVGTNNEELLRDPLYIGLKHQ 187

Query: 181 RDRSQRYDDLIDEFMKAITDRYGRNILIQFEDFGNHNAFRFLRKYREKYCTFNDDIQGTX 360
           R R + YDDL+DEFM+A+TD++G N LIQFEDF N NAFR L KYR KYC FNDDIQGT 
Sbjct: 188 RVRGKEYDDLLDEFMQAVTDKFGINCLIQFEDFANANAFRLLNKYRNKYCMFNDDIQGTA 247

Query: 361 XXXXXXXXXXQKVIGKSISEHKILFLGAGEAALGIANLIVMAMVENGLSEEEAQKKIWMV 540
                      ++    +S H  +F GAGEAA+GIA+L+VMA+ + G+ + EA +KIWMV
Sbjct: 248 SVAVAGILAALRITKNKLSNHVFVFQGAGEAAMGIAHLLVMALEKEGVPKAEATRKIWMV 307

Query: 541 DKFGLLFKGRKAKINRHQEPFAHPAPNNIPDNFEKSVNILNPSPIIG 681
           D  GL+ KGR + +N  +E FA   P     + E+ V ++ P+ IIG
Sbjct: 308 DSKGLIVKGR-SHLNHEKEMFAQDHPE--VKSLEEVVRLVKPTAIIG 351


>ref|XP_857135.1| PREDICTED: similar to malic enzyme 3, NADP(+)-dependent,
           mitochondrial isoform 5 [Canis familiaris]
          Length = 573

 Score =  253 bits (646), Expect = 2e-67
 Identities = 124/238 (52%), Positives = 162/238 (68%), Gaps = 2/238 (0%)
 Frame = +1

Query: 1   RILGLGDLGVYGMGIPVGKLCLYTACAGIRPDRCLPVCIDVGTDNPALLKDPFYMGLYQK 180
           RILGLGDLG YGMGIPVGKL LYTAC G+ P +CLPV +DVGT+N  LL+DP Y+GL  +
Sbjct: 128 RILGLGDLGCYGMGIPVGKLALYTACGGVSPQQCLPVLLDVGTNNEELLRDPLYIGLKHQ 187

Query: 181 RDRSQRYDDLIDEFMKAITDRYGRNILIQFEDFGNHNAFRFLRKYREKYCTFNDDIQGTX 360
           R R + YDDL+DEFM+A+TD++G N LIQFEDF N NAFR L KYR KYC FNDDIQGT 
Sbjct: 188 RVRGKEYDDLLDEFMQAVTDKFGINCLIQFEDFANANAFRLLNKYRNKYCMFNDDIQGTA 247

Query: 361 XXXXXXXXXXQKVIGKSISEHKILFLGAGEAALGIANLIVMAMVENGLSEEEAQKKIWMV 540
                      ++    +S H  +F GAGEAA+GIA+L+VMA+ + G+ + EA +KIWMV
Sbjct: 248 SVAVAGILAALRITKNKLSNHVFVFQGAGEAAMGIAHLLVMALEKEGVPKAEATRKIWMV 307

Query: 541 DKFGLLFK--GRKAKINRHQEPFAHPAPNNIPDNFEKSVNILNPSPIIGISGTCRLFS 708
           D  GL+ K    ++ +N  +E FA   P     + E+ V ++ P+ IIG++     F+
Sbjct: 308 DSKGLIVKVLSGRSHLNHEKEMFAQDHPE--VKSLEEVVRLVKPTAIIGVAAIAGAFT 363


>ref|XP_857227.1| PREDICTED: similar to malic enzyme 3, NADP(+)-dependent,
           mitochondrial isoform 7 [Canis familiaris]
          Length = 562

 Score =  246 bits (628), Expect = 2e-65
 Identities = 125/255 (49%), Positives = 161/255 (63%), Gaps = 19/255 (7%)
 Frame = +1

Query: 1   RILGLGDLGVYGMGIPVGKLCLYTACAGIRPDRCLPVCIDVGTDNPALLKDPFYMGLYQK 180
           RILGLGDLG YGMGIPVGKL LYTAC G+ P +CLPV +DVGT+N  LL+DP Y+GL  +
Sbjct: 128 RILGLGDLGCYGMGIPVGKLALYTACGGVSPQQCLPVLLDVGTNNEELLRDPLYIGLKHQ 187

Query: 181 RDRSQRYDDLIDEFMKAITDRYGRNILIQFEDFGNHNAFRFLRKYREKYCTFNDDIQGTX 360
           R R + YDDL+DEFM+A+TD++G N LIQFEDF N NAFR L KYR KYC FNDDIQGT 
Sbjct: 188 RVRGKEYDDLLDEFMQAVTDKFGINCLIQFEDFANANAFRLLNKYRNKYCMFNDDIQGTA 247

Query: 361 XXXXXXXXXXQKVIGKSISEHKILFLGAGEAALGIANLIVMAMVENGLSEEEAQKKIWMV 540
                      ++    +S H  +F GAGEAA+GIA+L+VMA+ + G+ + EA +KIWMV
Sbjct: 248 SVAVAGILAALRITKNKLSNHVFVFQGAGEAAMGIAHLLVMALEKEGVPKAEATRKIWMV 307

Query: 541 DKFGLLFK-------------------GRKAKINRHQEPFAHPAPNNIPDNFEKSVNILN 663
           D  GL+ K                     K  +N  +E FA   P     + E+ V ++ 
Sbjct: 308 DSKGLIVKVLSSSYQCLACNECVIMPADPKDHLNHEKEMFAQDHPE--VKSLEEVVRLVK 365

Query: 664 PSPIIGISGTCRLFS 708
           P+ IIG++     F+
Sbjct: 366 PTAIIGVAAIAGAFT 380


  Database: RefSeqCP
    Posted date:  Aug 1, 2006  9:25 PM
  Number of letters in database: 19,266,565
  Number of sequences in database:  33,732
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 35,567,554
Number of Sequences: 33732
Number of extensions: 827697
Number of successful extensions: 1763
Number of sequences better than 1.0e-05: 9
Number of HSP's better than  0.0 without gapping: 1653
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1761
length of database: 19,266,565
effective HSP length: 103
effective length of database: 15,792,169
effective search space used: 3442692842
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqMP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611S-003249
         (967 letters)

Database: RefSeqMP 
           45,328 sequences; 21,768,885 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_663469.1| malic enzyme 2, NAD(+)-dependent, mitochondrial...   378   e-108
Alignment   gi|XP_001004679.1| PREDICTED: similar to NADP-dependent malic e...   261   5e-72
Alignment   gi|XP_001004685.1| PREDICTED: similar to NADP-dependent malic e...   255   3e-70
Alignment   gi|NP_032641.1| malic enzyme, supernatant [Mus musculus]             255   1e-69
Alignment   gi|NP_852072.1| malic enzyme 3, NADP(+)-dependent, mitochondria...   258   8e-69
Alignment   gi|XP_001004683.1| PREDICTED: similar to NADP-dependent malic e...   236   1e-64
Alignment   gi|XP_001004682.1| PREDICTED: similar to NADP-dependent malic e...    55   2e-10

>ref|NP_663469.1| malic enzyme 2, NAD(+)-dependent, mitochondrial [Mus musculus]
          Length = 589

 Score =  378 bits (971), Expect(2) = e-108
 Identities = 183/236 (77%), Positives = 203/236 (86%)
 Frame = +1

Query: 1   RILGLGDLGVYGMGIPVGKLCLYTACAGIRPDRCLPVCIDVGTDNPALLKDPFYMGLYQK 180
           RILGLGDLGVYGMGIPVGKLCLYTACAGI+P++CLPVCIDVGTDN ALLKDPFYMGLYQK
Sbjct: 165 RILGLGDLGVYGMGIPVGKLCLYTACAGIQPEKCLPVCIDVGTDNMALLKDPFYMGLYQK 224

Query: 181 RDRSQRYDDLIDEFMKAITDRYGRNILIQFEDFGNHNAFRFLRKYREKYCTFNDDIQGTX 360
           RDRSQ YDDL+DEFMKAITDRYGRN LIQFEDFGNHNAFRFLRKY++KYCTFNDDIQGT 
Sbjct: 225 RDRSQLYDDLMDEFMKAITDRYGRNTLIQFEDFGNHNAFRFLRKYQQKYCTFNDDIQGTA 284

Query: 361 XXXXXXXXXXQKVIGKSISEHKILFLGAGEAALGIANLIVMAMVENGLSEEEAQKKIWMV 540
                     Q+VI K +SEHKILFLGAGEAALGIANLIV++MVE+GLSEEEAQ+KIWM 
Sbjct: 285 AVALSGLLAAQRVINKPVSEHKILFLGAGEAALGIANLIVLSMVESGLSEEEAQRKIWMF 344

Query: 541 DKFGLLFKGRKAKINRHQEPFAHPAPNNIPDNFEKSVNILNPSPIIGISGTCRLFS 708
           DK GLL KGR A I+ +QEP+AH AP +IP  FE +VN L PS IIG++G   LF+
Sbjct: 345 DKSGLLVKGRTASIDSNQEPYAHAAPESIPATFEDAVNKLKPSVIIGVAGAGPLFT 400



 Score = 33.1 bits (74), Expect(2) = e-108
 Identities = 21/59 (35%), Positives = 27/59 (45%)
 Frame = +3

Query: 750 PINFGFINPTLQVVFSS**TYTLSRGRVLYPIAISFSPSNLFLLVVSYPLYNNLSHFFP 926
           PI F   NPT Q   ++   YTL+ GR L+     F P  L    V  P   N ++ FP
Sbjct: 414 PIIFALSNPTAQAECTAEDAYTLTEGRCLFASGSPFEPVKLQDGRVFTPGQGNNAYIFP 472


>ref|XP_001004679.1| PREDICTED: similar to NADP-dependent malic enzyme (NADP-ME) (Malic
           enzyme 1) isoform 1 [Mus musculus]
          Length = 554

 Score =  261 bits (666), Expect(2) = 5e-72
 Identities = 125/229 (54%), Positives = 160/229 (69%)
 Frame = +1

Query: 1   RILGLGDLGVYGMGIPVGKLCLYTACAGIRPDRCLPVCIDVGTDNPALLKDPFYMGLYQK 180
           RILGLGDLG  GMGIPVGKL LYTAC G+ P +CLP+ +DVGT+N  LLKDP Y+GL  +
Sbjct: 135 RILGLGDLGCNGMGIPVGKLALYTACGGVNPQQCLPITLDVGTENEELLKDPLYIGLRHR 194

Query: 181 RDRSQRYDDLIDEFMKAITDRYGRNILIQFEDFGNHNAFRFLRKYREKYCTFNDDIQGTX 360
           R R   YD  +DEFM+A + +YG N LIQFEDF N NAFR L KYR KYCTFNDDIQGT 
Sbjct: 195 RVRGPEYDAFLDEFMEAASSKYGMNCLIQFEDFANRNAFRLLNKYRNKYCTFNDDIQGTA 254

Query: 361 XXXXXXXXXXQKVIGKSISEHKILFLGAGEAALGIANLIVMAMVENGLSEEEAQKKIWMV 540
                      ++    +S+  +LF GAGEAALGIA+L+VMAM + GLS+E A+KKIW+V
Sbjct: 255 SVAVAGLLAALRITKNKLSDQTVLFQGAGEAALGIAHLVVMAMEKEGLSKENARKKIWLV 314

Query: 541 DKFGLLFKGRKAKINRHQEPFAHPAPNNIPDNFEKSVNILNPSPIIGIS 687
           D  GL+ K RK K+  + +P+   AP+++  N E  V  + P+ +IG++
Sbjct: 315 DSKGLIVKVRK-KVTTYLKPYTGAAPDSLHSNLEAIVQKIKPTALIGVA 362



 Score = 29.6 bits (65), Expect(2) = 5e-72
 Identities = 18/59 (30%), Positives = 27/59 (45%)
 Frame = +3

Query: 750 PINFGFINPTLQVVFSS**TYTLSRGRVLYPIAISFSPSNLFLLVVSYPLYNNLSHFFP 926
           PI F   NPT +   S+   Y +++GR ++     F P  L      +P   N S+ FP
Sbjct: 383 PIIFALSNPTSKAECSAEQCYKVTKGRAIFASGSPFDPVTLPDGRTLFPGQGNNSYVFP 441


>ref|XP_001004685.1| PREDICTED: similar to NADP-dependent malic enzyme (NADP-ME) (Malic
           enzyme 1) isoform 4 [Mus musculus]
          Length = 552

 Score =  255 bits (651), Expect(2) = 3e-70
 Identities = 126/229 (55%), Positives = 157/229 (68%)
 Frame = +1

Query: 1   RILGLGDLGVYGMGIPVGKLCLYTACAGIRPDRCLPVCIDVGTDNPALLKDPFYMGLYQK 180
           RILGLGDLG  GMGIPVGKL LYTAC G+ P +CLP+ +DVGT+N  LLKDP Y+GL  +
Sbjct: 135 RILGLGDLGCNGMGIPVGKLALYTACGGVNPQQCLPITLDVGTENEELLKDPLYIGLRHR 194

Query: 181 RDRSQRYDDLIDEFMKAITDRYGRNILIQFEDFGNHNAFRFLRKYREKYCTFNDDIQGTX 360
           R R   YD  +DEFM+A + +YG N LIQFEDF N NAFR L KYR KYCTFNDDIQGT 
Sbjct: 195 RVRGPEYDAFLDEFMEAASSKYGMNCLIQFEDFANRNAFRLLNKYRNKYCTFNDDIQGTA 254

Query: 361 XXXXXXXXXXQKVIGKSISEHKILFLGAGEAALGIANLIVMAMVENGLSEEEAQKKIWMV 540
                      ++    +S+  +LF GAGEAALGIA+L+VMAM + GLS+E A+KKIW+V
Sbjct: 255 SVAVAGLLAALRITKNKLSDQTVLFQGAGEAALGIAHLVVMAMEKEGLSKENARKKIWLV 314

Query: 541 DKFGLLFKGRKAKINRHQEPFAHPAPNNIPDNFEKSVNILNPSPIIGIS 687
           D  GL+ KGR A +   +E FAH   +    N E  V  + P+ +IG++
Sbjct: 315 DSKGLIVKGR-ASLTEEKEVFAH--EHEEMKNLEAIVQKIKPTALIGVA 360



 Score = 29.6 bits (65), Expect(2) = 3e-70
 Identities = 18/59 (30%), Positives = 27/59 (45%)
 Frame = +3

Query: 750 PINFGFINPTLQVVFSS**TYTLSRGRVLYPIAISFSPSNLFLLVVSYPLYNNLSHFFP 926
           PI F   NPT +   S+   Y +++GR ++     F P  L      +P   N S+ FP
Sbjct: 381 PIIFALSNPTSKAECSAEQCYKVTKGRAIFASGSPFDPVTLPDGRTLFPGQGNNSYVFP 439


>ref|NP_032641.1| malic enzyme, supernatant [Mus musculus]
          Length = 572

 Score =  255 bits (651), Expect(2) = 1e-69
 Identities = 126/229 (55%), Positives = 157/229 (68%)
 Frame = +1

Query: 1   RILGLGDLGVYGMGIPVGKLCLYTACAGIRPDRCLPVCIDVGTDNPALLKDPFYMGLYQK 180
           RILGLGDLG  GMGIPVGKL LYTAC G+ P +CLP+ +DVGT+N  LLKDP Y+GL  +
Sbjct: 155 RILGLGDLGCNGMGIPVGKLALYTACGGVNPQQCLPITLDVGTENEELLKDPLYIGLRHR 214

Query: 181 RDRSQRYDDLIDEFMKAITDRYGRNILIQFEDFGNHNAFRFLRKYREKYCTFNDDIQGTX 360
           R R   YD  +DEFM+A + +YG N LIQFEDF N NAFR L KYR KYCTFNDDIQGT 
Sbjct: 215 RVRGPEYDAFLDEFMEAASSKYGMNCLIQFEDFANRNAFRLLNKYRNKYCTFNDDIQGTA 274

Query: 361 XXXXXXXXXXQKVIGKSISEHKILFLGAGEAALGIANLIVMAMVENGLSEEEAQKKIWMV 540
                      ++    +S+  +LF GAGEAALGIA+L+VMAM + GLS+E A+KKIW+V
Sbjct: 275 SVAVAGLLAALRITKNKLSDQTVLFQGAGEAALGIAHLVVMAMEKEGLSKENARKKIWLV 334

Query: 541 DKFGLLFKGRKAKINRHQEPFAHPAPNNIPDNFEKSVNILNPSPIIGIS 687
           D  GL+ KGR A +   +E FAH   +    N E  V  + P+ +IG++
Sbjct: 335 DSKGLIVKGR-ASLTEEKEVFAH--EHEEMKNLEAIVQKIKPTALIGVA 380



 Score = 27.7 bits (60), Expect(2) = 1e-69
 Identities = 17/59 (28%), Positives = 27/59 (45%)
 Frame = +3

Query: 750 PINFGFINPTLQVVFSS**TYTLSRGRVLYPIAISFSPSNLFLLVVSYPLYNNLSHFFP 926
           PI F   +PT +   S+   Y +++GR ++     F P  L      +P   N S+ FP
Sbjct: 401 PIIFALSSPTSKAECSADECYKVTKGRAIFASGSPFDPVTLPDGRTLFPGQGNNSYVFP 459


>ref|NP_852072.1| malic enzyme 3, NADP(+)-dependent, mitochondrial [Mus musculus]
          Length = 604

 Score =  258 bits (658), Expect = 8e-69
 Identities = 128/238 (53%), Positives = 165/238 (69%), Gaps = 2/238 (0%)
 Frame = +1

Query: 1   RILGLGDLGVYGMGIPVGKLCLYTACAGIRPDRCLPVCIDVGTDNPALLKDPFYMGLYQK 180
           RILGLGDLG YGMGIPVGKL LYTAC G+ P +CLPV +DVGT+N  LL+DP Y+GL  +
Sbjct: 190 RILGLGDLGCYGMGIPVGKLALYTACGGVNPQQCLPVLLDVGTNNEELLRDPLYIGLKHQ 249

Query: 181 RDRSQRYDDLIDEFMKAITDRYGRNILIQFEDFGNHNAFRFLRKYREKYCTFNDDIQGTX 360
           R R + YDDL+DEFM+A+TD++G N LIQFEDF N NAFR L KYR KYC FNDDIQGT 
Sbjct: 250 RVRGEEYDDLLDEFMQAVTDKFGINCLIQFEDFANANAFRLLNKYRNKYCMFNDDIQGTA 309

Query: 361 XXXXXXXXXXQKVIGKSISEHKILFLGAGEAALGIANLIVMAMVENGLSEEEAQKKIWMV 540
                      ++    +S H  +F GA EAA+GIA+L+VMA+ + G+ + EA KKIWMV
Sbjct: 310 SVAVAGILAALRITKNRLSNHVFVFQGADEAAMGIAHLLVMALEKEGIPKTEAIKKIWMV 369

Query: 541 DKFGLLFKGRKAKINRHQEPFA--HPAPNNIPDNFEKSVNILNPSPIIGISGTCRLFS 708
           D  GL+ KGR + +N  +E FA  HP  N++    E+ V ++ P+ IIG++     F+
Sbjct: 370 DSKGLIVKGR-SHLNHEKEMFAQDHPEVNSL----EEVVRLVKPTAIIGVAAIAGAFT 422


>ref|XP_001004683.1| PREDICTED: similar to NADP-dependent malic enzyme (NADP-ME) (Malic
           enzyme 1) isoform 3 [Mus musculus]
          Length = 406

 Score =  236 bits (603), Expect(2) = 1e-64
 Identities = 116/217 (53%), Positives = 147/217 (67%)
 Frame = +1

Query: 37  MGIPVGKLCLYTACAGIRPDRCLPVCIDVGTDNPALLKDPFYMGLYQKRDRSQRYDDLID 216
           MGIPVGKL LYTAC G+ P +CLP+ +DVGT+N  LLKDP Y+GL  +R R   YD  +D
Sbjct: 1   MGIPVGKLALYTACGGVNPQQCLPITLDVGTENEELLKDPLYIGLRHRRVRGPEYDAFLD 60

Query: 217 EFMKAITDRYGRNILIQFEDFGNHNAFRFLRKYREKYCTFNDDIQGTXXXXXXXXXXXQK 396
           EFM+A + +YG N LIQFEDF N NAFR L KYR KYCTFNDDIQGT            +
Sbjct: 61  EFMEAASSKYGMNCLIQFEDFANRNAFRLLNKYRNKYCTFNDDIQGTASVAVAGLLAALR 120

Query: 397 VIGKSISEHKILFLGAGEAALGIANLIVMAMVENGLSEEEAQKKIWMVDKFGLLFKGRKA 576
           +    +S+  +LF GAGEAALGIA+L+VMAM + GLS+E A+KKIW+VD  GL+ KGR A
Sbjct: 121 ITKNKLSDQTVLFQGAGEAALGIAHLVVMAMEKEGLSKENARKKIWLVDSKGLIVKGR-A 179

Query: 577 KINRHQEPFAHPAPNNIPDNFEKSVNILNPSPIIGIS 687
            +   +E FAH   +    N E  V  + P+ +IG++
Sbjct: 180 SLTEEKEVFAH--EHEEMKNLEAIVQKIKPTALIGVA 214



 Score = 29.6 bits (65), Expect(2) = 1e-64
 Identities = 18/59 (30%), Positives = 27/59 (45%)
 Frame = +3

Query: 750 PINFGFINPTLQVVFSS**TYTLSRGRVLYPIAISFSPSNLFLLVVSYPLYNNLSHFFP 926
           PI F   NPT +   S+   Y +++GR ++     F P  L      +P   N S+ FP
Sbjct: 235 PIIFALSNPTSKAECSAEQCYKVTKGRAIFASGSPFDPVTLPDGRTLFPGQGNNSYVFP 293


>ref|XP_001004682.1| PREDICTED: similar to NADP-dependent malic enzyme (NADP-ME) (Malic
           enzyme 1) isoform 2 [Mus musculus]
          Length = 258

 Score = 54.7 bits (130), Expect(2) = 2e-10
 Identities = 30/69 (43%), Positives = 43/69 (62%)
 Frame = +1

Query: 481 MAMVENGLSEEEAQKKIWMVDKFGLLFKGRKAKINRHQEPFAHPAPNNIPDNFEKSVNIL 660
           MAM + GLS+E A+KKIW+VD  GL+ KGR A +   +E FAH   +    N E  V  +
Sbjct: 1   MAMEKEGLSKENARKKIWLVDSKGLIVKGR-ASLTEEKEVFAH--EHEEMKNLEAIVQKI 57

Query: 661 NPSPIIGIS 687
            P+ +IG++
Sbjct: 58  KPTALIGVA 66



 Score = 29.6 bits (65), Expect(2) = 2e-10
 Identities = 18/59 (30%), Positives = 27/59 (45%)
 Frame = +3

Query: 750 PINFGFINPTLQVVFSS**TYTLSRGRVLYPIAISFSPSNLFLLVVSYPLYNNLSHFFP 926
           PI F   NPT +   S+   Y +++GR ++     F P  L      +P   N S+ FP
Sbjct: 87  PIIFALSNPTSKAECSAEQCYKVTKGRAIFASGSPFDPVTLPDGRTLFPGQGNNSYVFP 145


  Database: RefSeqMP
    Posted date:  Aug 2, 2006 12:58 AM
  Number of letters in database: 21,768,885
  Number of sequences in database:  45,328
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 40,771,688
Number of Sequences: 45328
Number of extensions: 940114
Number of successful extensions: 2411
Number of sequences better than 1.0e-05: 7
Number of HSP's better than  0.0 without gapping: 2193
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2410
length of database: 21,768,885
effective HSP length: 104
effective length of database: 17,054,773
effective search space used: 3700885741
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)