Animal-Genome cDNA 20060611S-004057


Search to RefSeqSP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611S-004057
         (1000 letters)

Database: RefSeqSP 
           1040 sequences; 434,620 total letters

Searching...done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_999238.1| 20-beta-hydroxysteroid dehydrogenase [Sus scrofa]     53   1e-08
Alignment   gi|NP_998992.1| carbonyl reductase [Sus scrofa]                       46   1e-06

>ref|NP_999238.1| 20-beta-hydroxysteroid dehydrogenase [Sus scrofa]
          Length = 289

 Score = 53.1 bits (126), Expect = 1e-08
 Identities = 40/137 (29%), Positives = 62/137 (45%), Gaps = 1/137 (0%)
 Frame = +3

Query: 159 KVAVVTGANTGIGKETAKELAKRGAR-VYLACRDVQKGESVAREIQNMTGNQQVLVRKLD 335
           +VA+VTGAN GIG    ++L ++ A  V L  RDV +G++  +++Q           +LD
Sbjct: 6   RVALVTGANKGIGFAIVRDLCRQFAGDVVLTARDVARGQAAVKQLQ--AEGLSPRFHQLD 63

Query: 336 LADTKSIRAFAKGFLAEEKHLHILINNAGVMMCPYSKTADGFETHMGVNXXXXXXXXXXX 515
           + D +SIRA       E   L +L+NNA +     + T    +  + +            
Sbjct: 64  IIDLQSIRALCDFLRKEYGGLDVLVNNAAIAFQLDNPTPFHIQAELTMKTNFMGTRNVCT 123

Query: 516 XXXXKESAPSRVVNVSS 566
                     RVVNVSS
Sbjct: 124 ELLPLIKPQGRVVNVSS 140


>ref|NP_998992.1| carbonyl reductase [Sus scrofa]
          Length = 244

 Score = 46.2 bits (108), Expect = 1e-06
 Identities = 46/145 (31%), Positives = 64/145 (44%), Gaps = 3/145 (2%)
 Frame = +3

Query: 156 GKVAVVTGANTGIGKETAKELAKRGARVYLACRDVQKGESVAREIQNMTGNQQVLVRKLD 335
           G  A+VTGA  GIG++T K L   GARV    R    G+ V+   Q   G + V V   D
Sbjct: 7   GLRALVTGAGKGIGRDTVKALHVSGARVVAVTR--TNGDLVSLS-QECPGIEPVCV---D 60

Query: 336 LADTKSIRAFAKGFLAEEKHLHILINNAGV-MMCPY-SKTADGFETHMGVNXXXXXXXXX 509
           L D ++      G       + +L+NNA V +M P+   T + F+    VN         
Sbjct: 61  LGDWEATERALGGV----GPVDLLVNNAAVALMQPFLDTTKEVFDRSFNVNLRSVFQVSQ 116

Query: 510 XXXXXXKE-SAPSRVVNVSSLAHHM 581
                  E   P  +VNVSS+  H+
Sbjct: 117 IVARSMIERGVPGSIVNVSSMVSHV 141


  Database: RefSeqSP
    Posted date:  Aug 1, 2006  7:14 PM
  Number of letters in database: 434,620
  Number of sequences in database:  1040
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 958,363
Number of Sequences: 1040
Number of extensions: 25278
Number of successful extensions: 77
Number of sequences better than 1.0e-05: 2
Number of HSP's better than  0.0 without gapping: 73
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 75
length of database: 434,620
effective HSP length: 77
effective length of database: 354,540
effective search space used: 90407700
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqBP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611S-004057
         (1000 letters)

Database: RefSeqBP 
           33,508 sequences; 16,112,626 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|XP_870721.1| PREDICTED: similar to Retinol dehydrogenase 11 ...   389   e-108
Alignment   gi|XP_582373.2| PREDICTED: similar to Retinol dehydrogenase 11 ...   383   e-106
Alignment   gi|NP_899207.1| double substrate-specificity short chain dehydr...   354   7e-98
Alignment   gi|XP_592820.2| PREDICTED: similar to retinol dehydrogenase 11 ...   202   4e-52
Alignment   gi|XP_582319.2| PREDICTED: similar to retinol dehydrogenase 14 ...   178   7e-45
Alignment   gi|XP_584642.2| PREDICTED: similar to retinol dehydrogenase 11 ...   157   1e-38
Alignment   gi|XP_584629.2| PREDICTED: similar to Retinol dehydrogenase 13,...   143   2e-34
Alignment   gi|XP_591168.2| PREDICTED: similar to dehydrogenase/reductase (...   105   6e-23
Alignment   gi|XP_583859.2| PREDICTED: similar to short chain dehydrogenase...    99   4e-21
Alignment   gi|XP_584810.2| PREDICTED: similar to retinol dehydrogenase 13 ...    80   2e-15

>ref|XP_870721.1| PREDICTED: similar to Retinol dehydrogenase 11 (Retinal reductase
           1) (RalR1) (Prostate short-chain dehydrogenase/reductase
           1) (Androgen-regulated short-chain
           dehydrogenase/reductase 1) (HCV core-binding protein
           HCBP12) isoform 2 [Bos taurus]
          Length = 314

 Score =  389 bits (999), Expect = e-108
 Identities = 201/302 (66%), Positives = 226/302 (74%), Gaps = 30/302 (9%)
 Frame = +3

Query: 114 MLSSGVCTSTVQLPGKVAVVTGANTGIGKETAKELAKRGARVYLACRDVQKGESVAREIQ 293
           MLSSGVCTST+QLPGKVAVVTGAN GIGKETAKELA+RGARVYLACRDVQ GE VAREIQ
Sbjct: 1   MLSSGVCTSTIQLPGKVAVVTGANAGIGKETAKELARRGARVYLACRDVQNGELVAREIQ 60

Query: 294 NMTGNQQVLVRKLDLADTKSIRAFAKGFLAEEKHLHILINNAGVMMCPYSKTADGFETHM 473
            MTGNQQVLVRKLDLADTKSIRAFAK FL + K++H++ ++   ++C +  ++ G ++  
Sbjct: 61  MMTGNQQVLVRKLDLADTKSIRAFAKRFLEDHKYIHLINSSPHFLICGFPGSSAGKDSAC 120

Query: 474 GVNXXXXXXXXXXXXXXXKESAPSRVVNVSSLAHHMGRIHFHNLQ--------------- 608
                             +ESAPSRVVNVSSLAH +GRIHFHNLQ               
Sbjct: 121 NTGYLGHFLLTHLLLEKLEESAPSRVVNVSSLAHLLGRIHFHNLQGEKFYQSGLAYCHSK 180

Query: 609 ---------------GSGVTTYSVHPGTVDSELVRHSSLLRWIWWLFSFFXQTPQQGAQT 743
                          GSGVT YSVHPGTV+SELVRHS+L+RWIWW+FSFF +TPQQGAQT
Sbjct: 181 LANILFTQELARRLKGSGVTVYSVHPGTVNSELVRHSALMRWIWWIFSFFIKTPQQGAQT 240

Query: 744 SLYCALXEGLEVLSGKHFSDCHVAWVSAQARNETVARRLWDVSCDLLGIPYG*RVMAFGP 923
           SLYCAL EGLEVLSG HFSDCHVAWVSAQARNETVARRLWDVSCDLLGIP    +MA GP
Sbjct: 241 SLYCALTEGLEVLSGNHFSDCHVAWVSAQARNETVARRLWDVSCDLLGIPVDWLMMAAGP 300

Query: 924 KK 929
           K+
Sbjct: 301 KR 302


>ref|XP_582373.2| PREDICTED: similar to Retinol dehydrogenase 11 (Retinal reductase
           1) (RalR1) (Prostate short-chain dehydrogenase/reductase
           1) (Androgen-regulated short-chain
           dehydrogenase/reductase 1) (HCV core-binding protein
           HCBP12) isoform 1 [Bos taurus]
          Length = 308

 Score =  383 bits (983), Expect = e-106
 Identities = 204/302 (67%), Positives = 224/302 (74%), Gaps = 30/302 (9%)
 Frame = +3

Query: 114 MLSSGVCTSTVQLPGKVAVVTGANTGIGKETAKELAKRGARVYLACRDVQKGESVAREIQ 293
           MLSSGVCTST+QLPGKVAVVTGAN GIGKETAKELA+RGARVYLACRDVQ GE VAREIQ
Sbjct: 1   MLSSGVCTSTIQLPGKVAVVTGANAGIGKETAKELARRGARVYLACRDVQNGELVAREIQ 60

Query: 294 NMTGNQQVLVRKLDLADTKSIRAFAKGFLAEEKHLHILINNAGVMMCPYSKTADGFETHM 473
            MTGNQQVLVRKLDLADTKSIRAFAK FL + K++H LIN+ G     +  ++ G ++  
Sbjct: 61  MMTGNQQVLVRKLDLADTKSIRAFAKRFLEDHKYIH-LINSVG-----FPGSSAGKDSAC 114

Query: 474 GVNXXXXXXXXXXXXXXXKESAPSRVVNVSSLAHHMGRIHFHNLQ--------------- 608
                             +ESAPSRVVNVSSLAH +GRIHFHNLQ               
Sbjct: 115 NTGYLGHFLLTHLLLEKLEESAPSRVVNVSSLAHLLGRIHFHNLQGEKFYQSGLAYCHSK 174

Query: 609 ---------------GSGVTTYSVHPGTVDSELVRHSSLLRWIWWLFSFFXQTPQQGAQT 743
                          GSGVT YSVHPGTV+SELVRHS+L+RWIWW+FSFF +TPQQGAQT
Sbjct: 175 LANILFTQELARRLKGSGVTVYSVHPGTVNSELVRHSALMRWIWWIFSFFIKTPQQGAQT 234

Query: 744 SLYCALXEGLEVLSGKHFSDCHVAWVSAQARNETVARRLWDVSCDLLGIPYG*RVMAFGP 923
           SLYCAL EGLEVLSG HFSDCHVAWVSAQARNETVARRLWDVSCDLLGIP    +MA GP
Sbjct: 235 SLYCALTEGLEVLSGNHFSDCHVAWVSAQARNETVARRLWDVSCDLLGIPVDWLMMAAGP 294

Query: 924 KK 929
           K+
Sbjct: 295 KR 296


>ref|NP_899207.1| double substrate-specificity short chain dehydrogenase/reductase 2
           [Bos taurus]
          Length = 316

 Score =  354 bits (908), Expect = 7e-98
 Identities = 185/298 (62%), Positives = 213/298 (71%), Gaps = 30/298 (10%)
 Frame = +3

Query: 87  YIAVPQIRKMLSSGVCTSTVQLPGKVAVVTGANTGIGKETAKELAKRGARVYLACRDVQK 266
           Y+  P IRK  + GVC + VQL GKV V+TGANTGIGKETA+ELA+RGARVY+ACRDV K
Sbjct: 16  YVIAPSIRKFFAGGVCRTDVQLFGKVVVITGANTGIGKETARELARRGARVYIACRDVLK 75

Query: 267 GESVAREIQNMTGNQQVLVRKLDLADTKSIRAFAKGFLAEEKHLHILINNAGVMMCPYSK 446
           GES A EIQ  T N QVLVRKLDL+DTKSIRAFA+GFLAEEK LHILINNAGVM+CPYSK
Sbjct: 76  GESAASEIQADTKNSQVLVRKLDLSDTKSIRAFAEGFLAEEKQLHILINNAGVMLCPYSK 135

Query: 447 TADGFETHMGVNXXXXXXXXXXXXXXXKESAPSRVVNVSSLAHHMGRIHFHNLQG----- 611
           TADGFETH+ VN               KESAP+RVVN+SS+AHH+G+I FH+LQG     
Sbjct: 136 TADGFETHLAVNHLGHFLLTHLLLGRLKESAPARVVNLSSVAHHLGKIRFHDLQGDKYYN 195

Query: 612 -------------------------SGVTTYSVHPGTVDSELVRHSSLLRWIWWLFSFFX 716
                                    +GVTTY+VHPG V S+LVRHS LL  +W LFS F 
Sbjct: 196 LGFAYCHSKLANVLFTRELAKRLKGTGVTTYAVHPGIVRSKLVRHSFLLCLLWRLFSPFL 255

Query: 717 QTPQQGAQTSLYCALXEGLEVLSGKHFSDCHVAWVSAQARNETVARRLWDVSCDLLGI 890
           +T  +GAQTSL+CAL EGLE LSGK+FSDC   WVS +ARN   A RLW+VSC+LLGI
Sbjct: 256 KTTWEGAQTSLHCALAEGLEPLSGKYFSDCKKTWVSPRARNNKTAERLWNVSCELLGI 313


>ref|XP_592820.2| PREDICTED: similar to retinol dehydrogenase 11 (predicted) [Bos
           taurus]
          Length = 377

 Score =  202 bits (513), Expect = 4e-52
 Identities = 125/294 (42%), Positives = 162/294 (55%), Gaps = 38/294 (12%)
 Frame = +3

Query: 132 CTSTVQLPGKVAVVTGANTGIGKETAKELAKRGARVYLACRDVQKGESVAREIQNMTGNQ 311
           C     L G+ AVVTGAN+GIGK TA ELA+RGARV LACR  ++GE+ A +++  +GN 
Sbjct: 28  CRGLASLRGRTAVVTGANSGIGKMTALELARRGARVVLACRSRERGEAAAFDLRQESGNN 87

Query: 312 QVLVRKLDLADTKSIRAFAKGFLAEEKHLHILINNAGVMMCPYSKTADGFETHMGVNXXX 491
           +V+   LDLA   S+RAFA  FL+ E  L ILI+NAG+  C   +T + F   + VN   
Sbjct: 88  EVIFMALDLASLASVRAFATAFLSSEPRLDILIHNAGISSC--GRTREPFNLLLRVNHIG 145

Query: 492 XXXXXXXXXXXXKESAPSRVVNVSSLAHHMGRIHF------------------------- 596
                       K SAPSRVV VSS AH  GR+ F                         
Sbjct: 146 PFLLTHLLLPRLKTSAPSRVVVVSSAAHRRGRLDFTRLDHPVVGWQQELRAYANSKLANV 205

Query: 597 -------HNLQGSGVTTYSVHPGTVDSEL-VRH-----SSLLRWIWWLFSFFXQTPQQGA 737
                    L+G+GVT Y+ HPG V+SEL +RH       LLR + WL     + P+ GA
Sbjct: 206 LFARELATQLEGTGVTCYAAHPGPVNSELFLRHVPGWLRPLLRPLAWL---VLRAPRGGA 262

Query: 738 QTSLYCALXEGLEVLSGKHFSDCHVAWVSAQARNETVARRLWDVSCDLLGIPYG 899
           QT LYCAL EG+E LSG++F++CHV  V   AR++  A RLW+ S  L G+  G
Sbjct: 263 QTPLYCALQEGIEPLSGRYFANCHVEEVPPAARDDRAAHRLWEASRKLAGLGPG 316


>ref|XP_582319.2| PREDICTED: similar to retinol dehydrogenase 14 (all-trans and 9-cis)
            [Bos taurus]
          Length = 420

 Score =  178 bits (451), Expect = 7e-45
 Identities = 106/292 (36%), Positives = 155/292 (53%), Gaps = 47/292 (16%)
 Frame = +3

Query: 156  GKVAVVTGANTGIGKETAKELAKRGARVYLACRDVQKGESVAREIQ-------------N 296
            GK  ++TGAN+G+G+ TA EL + GARV + CRD ++ E  A +++             N
Sbjct: 127  GKTVLITGANSGLGRATAAELLRLGARVIMGCRDRERAEEAAGQLRREVCPAGGPDSGPN 186

Query: 297  MTGNQQVLVRKLDLADTKSIRAFAKGFLAEEKHLHILINNAGVMMCPYSKTADGFETHMG 476
              G  +++V++LDLA   S+R+F +  L EE  L +LINNAGV  CPY KT DGFE   G
Sbjct: 187  SGGAGELVVKELDLASLSSVRSFCQEMLQEEPRLDVLINNAGVFQCPYMKTEDGFEMQFG 246

Query: 477  VNXXXXXXXXXXXXXXXKESAPSRVVNVSSLAHHMGRIHFHN------------------ 602
            VN               K SAPSR+V VSS  +  G I+F +                  
Sbjct: 247  VNHLGHFLLTNLLLGLLKSSAPSRIVVVSSKLYKYGDINFEDLNSEQSYNKSFCYSRSKL 306

Query: 603  ------------LQGSGVTTYSVHPGTVDSELVRHSSLLRWIWWLFSF----FXQTPQQG 734
                        L+G+ VT   +HPG V + L RH  +   +  LF+     F +TP++G
Sbjct: 307  ANILFTRELARRLEGTSVTVNVLHPGIVRTNLGRHIHIPLLVRPLFNLVSWAFFKTPEEG 366

Query: 735  AQTSLYCALXEGLEVLSGKHFSDCHVAWVSAQARNETVARRLWDVSCDLLGI 890
            AQT++Y A    +E +SG++F DC    +  +A +E+VAR+LWD+S  ++GI
Sbjct: 367  AQTAVYLASSPEVEGVSGRYFGDCKEEELLPKAMDESVARKLWDISEVMVGI 418


>ref|XP_584642.2| PREDICTED: similar to retinol dehydrogenase 11 (predicted) [Bos
           taurus]
          Length = 330

 Score =  157 bits (397), Expect = 1e-38
 Identities = 99/283 (34%), Positives = 146/283 (51%), Gaps = 33/283 (11%)
 Frame = +3

Query: 141 TVQLPGKVAVVTGANTGIGKETAKELAKRGARVYLACRDVQKGESVAREIQNMTGNQQVL 320
           +  L GK AVVTGAN+GIGK  ++ELA RGARV LACR  ++G+    EIQ  + + ++L
Sbjct: 44  STDLTGKTAVVTGANSGIGKAVSQELAHRGARVILACRSRERGQQALAEIQATSKSNRLL 103

Query: 321 VRKLDLADTKSIRAFAKGFLAEEKHLHILINNAGVMMCPYSKTADGFETHMGVNXXXXXX 500
           + ++DL+   SIR+FA+  L E   +H+L+NNA V   P + T +G +     N      
Sbjct: 104 LGEVDLSSMASIRSFAQRLLQECPEIHLLVNNAAVCGFPTTLTPEGLDLTFATNYTGPFL 163

Query: 501 XXXXXXXXXKESAPSRVVNVSSLAHHMGRIH----------------------------- 593
                    + +  +RVVNVSS     G I                              
Sbjct: 164 LTNLLQGALQRAGSARVVNVSSFRQSHGYIDEDHLIGAGRPLTFNQNYDCSKLLLASFTG 223

Query: 594 --FHNLQGSGVTTYSVHPGTVDSELVRHSS-LLRWIWWLFSFFXQTPQQGAQTSLYCALX 764
                LQG+GVT  SV PG V +++++H S   R+++WL SFF +  +QGA   LY +L 
Sbjct: 224 KLAQRLQGTGVTVNSVDPGVVYTKIMKHFSWSYRFLFWLLSFFFKDSKQGAVPVLYLSLA 283

Query: 765 EGLEVLSGKHF-SDCHVAWVSAQARNETVARRLWDVSCDLLGI 890
           + L+ +SGKHF S C +      A++  VA+ LW+ S  L  +
Sbjct: 284 KELDGISGKHFSSSCVITLPPEAAQDPHVAQSLWNTSVRLTNL 326


>ref|XP_584629.2| PREDICTED: similar to Retinol dehydrogenase 13, partial [Bos
           taurus]
          Length = 148

 Score =  143 bits (361), Expect = 2e-34
 Identities = 70/126 (55%), Positives = 88/126 (69%)
 Frame = +3

Query: 105 IRKMLSSGVCTSTVQLPGKVAVVTGANTGIGKETAKELAKRGARVYLACRDVQKGESVAR 284
           ++  ++ G C S   +PGK  +VTGANTGIGK+TA ELAKRG  + LACRD++K E+ A+
Sbjct: 21  LKDFVAGGACPSKATIPGKTVIVTGANTGIGKQTALELAKRGGNIILACRDMEKCEAAAK 80

Query: 285 EIQNMTGNQQVLVRKLDLADTKSIRAFAKGFLAEEKHLHILINNAGVMMCPYSKTADGFE 464
           EI+  T N +V  R LDLA  KSIR FA     EE+H+HILINNA VM CP+  T DGFE
Sbjct: 81  EIRGETLNHRVNARHLDLASLKSIREFAAKVTEEEEHVHILINNAAVMRCPHWTTEDGFE 140

Query: 465 THMGVN 482
             +GVN
Sbjct: 141 MQLGVN 146


>ref|XP_591168.2| PREDICTED: similar to dehydrogenase/reductase (SDR family) X-linked
           [Bos taurus]
          Length = 251

 Score =  105 bits (262), Expect = 6e-23
 Identities = 77/230 (33%), Positives = 108/230 (46%), Gaps = 44/230 (19%)
 Frame = +3

Query: 333 DLADTKSIRAFAKGFLAEEKHLHILINNAGVMMCPYSKTADGFETHMGVNXXXXXXXXXX 512
           DLA  +SIR F + F  ++  LH+L+NNAGVMM P   T DGFE H GVN          
Sbjct: 11  DLASMRSIREFVQTFKMKKLPLHVLVNNAGVMMVPQRTTEDGFEEHFGVNYLGHFLLTNL 70

Query: 513 XXXXXKES-AP---SRVVNVSSLAHHMGRIHFHNLQGSGVTTYSVH-------------- 638
                +ES AP   +RVV VSS  H++G ++  +LQ S  T YS H              
Sbjct: 71  LLDTLQESGAPGHSARVVTVSSATHYVGELNLDDLQSS--TYYSAHAAYAQSKLALVLFT 128

Query: 639 --------------------PGTVDSELVRH----SSLLRWI--WWLFSFFXQTPQQGAQ 740
                               PG VD++L R+    + L++ +  WW+F    +TP +GA 
Sbjct: 129 YHLQALLTAQGMPVTASVADPGVVDTDLYRYVFWGTRLVKKLLGWWVF----KTPDEGAW 184

Query: 741 TSLYCALXEGLEVLSGKHFSDCHVAWVSAQARNETVARRLWDVSCDLLGI 890
           TS+Y A+   LE L G++  +           +  + R+LW  SC L GI
Sbjct: 185 TSVYAAVTPALEGLGGRYLYNEKETRSLEATYDPELQRQLWARSCQLTGI 234


>ref|XP_583859.2| PREDICTED: similar to short chain dehydrogenase/reductase [Bos
           taurus]
          Length = 317

 Score = 99.4 bits (246), Expect = 4e-21
 Identities = 55/141 (39%), Positives = 77/141 (54%)
 Frame = +3

Query: 144 VQLPGKVAVVTGANTGIGKETAKELAKRGARVYLACRDVQKGESVAREIQNMTGNQQVLV 323
           VQ+PG+  +VTG N+GIGK TA E+AKRG  V+L CRD  + E    EI   +GNQ + +
Sbjct: 36  VQVPGRAFMVTGGNSGIGKATAMEIAKRGGTVHLVCRDHSRAEGAKAEIIRESGNQNIFL 95

Query: 324 RKLDLADTKSIRAFAKGFLAEEKHLHILINNAGVMMCPYSKTADGFETHMGVNXXXXXXX 503
             +DL+  KS+  F + F  +E  L++LINNAG M+     T DG E +   N       
Sbjct: 96  HIVDLSLPKSVWKFVENF-KQEHTLNVLINNAGCMVNKRELTEDGLEKNFATNTLGVYVL 154

Query: 504 XXXXXXXXKESAPSRVVNVSS 566
                   ++    RV+ VSS
Sbjct: 155 TTALIPVLEKEHDPRVITVSS 175


>ref|XP_584810.2| PREDICTED: similar to retinol dehydrogenase 13 (all-trans and
           9-cis) [Bos taurus]
          Length = 223

 Score = 80.5 bits (197), Expect = 2e-15
 Identities = 56/161 (34%), Positives = 79/161 (49%), Gaps = 40/161 (24%)
 Frame = +3

Query: 528 KESAPSRVVNVSSLAHHMGRIHFHNL-------------------------------QGS 614
           K SAPSR++NVSSLAH  G I F +L                               QG+
Sbjct: 50  KASAPSRIINVSSLAHVAGHIDFEDLNWEKRKYDTKAAYCQSKLAVVVSTKELSRRLQGT 109

Query: 615 GVTTYSVHPGTVDSELVRHSSL---------LRWIWWLFSFFXQTPQQGAQTSLYCALXE 767
           GVT  ++HPG   +EL RH+ +         L  I+WL     ++P+  AQ S+Y A+ E
Sbjct: 110 GVTVNALHPGVARTELGRHTGMHSSAFSSFTLGPIFWLL---VKSPELAAQPSVYLAVAE 166

Query: 768 GLEVLSGKHFSDCHVAWVSAQARNETVARRLWDVSCDLLGI 890
            LE +SGK+F        + +A +E VA+RLW  S  L+G+
Sbjct: 167 ELEGVSGKYFDVLKEKPPAPEAEDEEVAKRLWAESVRLVGL 207


  Database: RefSeqBP
    Posted date:  Aug 1, 2006  7:14 PM
  Number of letters in database: 16,112,626
  Number of sequences in database:  33,508
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 35,330,158
Number of Sequences: 33508
Number of extensions: 956199
Number of successful extensions: 2696
Number of sequences better than 1.0e-05: 10
Number of HSP's better than  0.0 without gapping: 2454
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2668
length of database: 16,112,626
effective HSP length: 102
effective length of database: 12,694,810
effective search space used: 2919806300
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqCP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611S-004057
         (1000 letters)

Database: RefSeqCP 
           33,732 sequences; 19,266,565 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|XP_854354.1| PREDICTED: similar to Retinol dehydrogenase 11 ...   433   e-121
Alignment   gi|XP_547866.2| PREDICTED: similar to retinol dehydrogenase 12 ...   356   2e-98
Alignment   gi|XP_854127.1| PREDICTED: similar to Retinol dehydrogenase 13 ...   208   6e-54
Alignment   gi|XP_548293.2| PREDICTED: similar to retinol dehydrogenase 11 ...   196   2e-50
Alignment   gi|XP_540096.2| PREDICTED: similar to retinol dehydrogenase 14 ...   177   1e-44
Alignment   gi|XP_533000.2| PREDICTED: similar to Retinol dehydrogenase 12 ...   158   7e-39
Alignment   gi|XP_852222.1| PREDICTED: similar to dehydrogenase/reductase (...   140   2e-33
Alignment   gi|XP_857582.1| PREDICTED: similar to retinol dehydrogenase 14 ...   123   2e-28
Alignment   gi|XP_852623.1| PREDICTED: similar to WW domain-containing oxid...   105   9e-23
Alignment   gi|XP_857503.1| PREDICTED: similar to retinol dehydrogenase 14 ...    63   5e-10

>ref|XP_854354.1| PREDICTED: similar to Retinol dehydrogenase 11 (Retinal reductase
           1) (RalR1) (Prostate short-chain dehydrogenase/reductase
           1) (Androgen-regulated short-chain
           dehydrogenase/reductase 1) (HCV core-binding protein
           HCBP12) [Canis familiaris]
          Length = 337

 Score =  433 bits (1114), Expect = e-121
 Identities = 219/296 (73%), Positives = 235/296 (79%), Gaps = 30/296 (10%)
 Frame = +3

Query: 96  VPQIRKMLSSGVCTSTVQLPGKVAVVTGANTGIGKETAKELAKRGARVYLACRDVQKGES 275
           V ++ K+LS GVCTSTVQLPGKVAVVTGANTGIGKETAKELA+RGARVYLACRDV KGE 
Sbjct: 40  VDRLMKILSRGVCTSTVQLPGKVAVVTGANTGIGKETAKELAQRGARVYLACRDVLKGEL 99

Query: 276 VAREIQNMTGNQQVLVRKLDLADTKSIRAFAKGFLAEEKHLHILINNAGVMMCPYSKTAD 455
           VAREIQ MTGN+QVLVRKLDLADTKSIRAFAKGFLAEEKHLHILINNAGVMMCPY+KT D
Sbjct: 100 VAREIQTMTGNKQVLVRKLDLADTKSIRAFAKGFLAEEKHLHILINNAGVMMCPYTKTVD 159

Query: 456 GFETHMGVNXXXXXXXXXXXXXXXKESAPSRVVNVSSLAHHMGRIHFHNLQG-------- 611
           GFE HMGVN               KESAPSR+VNVSSLAHH+GRIHFH+LQG        
Sbjct: 160 GFEMHMGVNHLGHFLLTHLLLEKLKESAPSRIVNVSSLAHHLGRIHFHDLQGEKFYNSGL 219

Query: 612 ----------------------SGVTTYSVHPGTVDSELVRHSSLLRWIWWLFSFFXQTP 725
                                 SG+T YSVHPGTV SELVRHS  ++W+WWLFSFF +TP
Sbjct: 220 AYCHSKLANILFTQELARRLKGSGITAYSVHPGTVKSELVRHSPFMKWMWWLFSFFIKTP 279

Query: 726 QQGAQTSLYCALXEGLEVLSGKHFSDCHVAWVSAQARNETVARRLWDVSCDLLGIP 893
           QQGAQTSLYCA+ EGLEVLSG HFSDC VAWVSAQARNET+ARRLWDVSCDLLGIP
Sbjct: 280 QQGAQTSLYCAITEGLEVLSGHHFSDCSVAWVSAQARNETIARRLWDVSCDLLGIP 335


>ref|XP_547866.2| PREDICTED: similar to retinol dehydrogenase 12 (all-trans and
           9-cis) [Canis familiaris]
          Length = 303

 Score =  356 bits (914), Expect = 2e-98
 Identities = 184/293 (62%), Positives = 214/293 (73%), Gaps = 30/293 (10%)
 Frame = +3

Query: 108 RKMLSSGVCTSTVQLPGKVAVVTGANTGIGKETAKELAKRGARVYLACRDVQKGESVARE 287
           RK  + GVC S VQLPGKV V+TGANTGIGKETA+ELA+RGARVY+ACRDV KGES A E
Sbjct: 10  RKFFAGGVCRSNVQLPGKVVVITGANTGIGKETARELARRGARVYIACRDVLKGESAASE 69

Query: 288 IQNMTGNQQVLVRKLDLADTKSIRAFAKGFLAEEKHLHILINNAGVMMCPYSKTADGFET 467
           I+  T N QVLVRKLDL+DTKSIRAFA+GFLAEEK LHILINNAGVMMCPYSKTADGFET
Sbjct: 70  IRADTKNSQVLVRKLDLSDTKSIRAFAEGFLAEEKQLHILINNAGVMMCPYSKTADGFET 129

Query: 468 HMGVNXXXXXXXXXXXXXXXKESAPSRVVNVSSLAHHMGRIHFHN--------------- 602
           H+GVN               KES P+RVVN+SS+AHH+G+IHFH+               
Sbjct: 130 HLGVNHLGHFLLTHLLLERLKESTPARVVNLSSVAHHIGKIHFHDLQGEKRYSRGFAYCH 189

Query: 603 ---------------LQGSGVTTYSVHPGTVDSELVRHSSLLRWIWWLFSFFXQTPQQGA 737
                          LQG+GVTTY+VHPG V SELVRHS LL  +W +FS F ++ ++GA
Sbjct: 190 SKLANMLFTRELAKRLQGTGVTTYAVHPGVVSSELVRHSFLLCLLWRIFSPFVKSAREGA 249

Query: 738 QTSLYCALXEGLEVLSGKHFSDCHVAWVSAQARNETVARRLWDVSCDLLGIPY 896
           QTSL+CAL EGLE LSGK+FSDC  AWVS +AR+   A RLW+VSC+LLGI +
Sbjct: 250 QTSLHCALAEGLEPLSGKYFSDCKRAWVSPRARDNKTAERLWNVSCELLGIQW 302


>ref|XP_854127.1| PREDICTED: similar to Retinol dehydrogenase 13 [Canis familiaris]
          Length = 334

 Score =  208 bits (530), Expect = 6e-54
 Identities = 123/302 (40%), Positives = 163/302 (53%), Gaps = 40/302 (13%)
 Frame = +3

Query: 105 IRKMLSSGVCTSTVQLPGKVAVVTGANTGIGKETAKELAKRGARVYLACRDVQKGESVAR 284
           +R  ++ G C S   +PGK  +VTGANTGIGK+TA ELA+RG  + LACRD++K E+ A+
Sbjct: 21  LRDYIAGGACPSKATIPGKTVIVTGANTGIGKQTALELARRGGNIILACRDMEKCEAAAK 80

Query: 285 EIQNMTGNQQVLVRKLDLADTKSIRAFAKGFLAEEKHLHILINNAGVMMCPYSKTADGFE 464
           EI+  T N +V    LDLA  KSIR FA   + EE+ +HIL+NNA VM CP+  T DGFE
Sbjct: 81  EIRGETLNHRVSAWHLDLASLKSIREFAAKIIEEEEQVHILVNNAAVMRCPHWTTKDGFE 140

Query: 465 THMGVNXXXXXXXXXXXXXXXKESAPSRVVNVSSLAHHMGRIHF---------------- 596
              GVN               K SAPSR++N+SSLAH  G I F                
Sbjct: 141 MQFGVNHLGHFLLTNLLLDKLKASAPSRIINLSSLAHVAGHIDFDDLNWEKRKYDTKAAY 200

Query: 597 ---------------HNLQGSGVTTYSVHPGTVDSELVRHSSL---------LRWIWWLF 704
                            LQG+GVT  ++HPG   +EL RH+ +         L  I+WL 
Sbjct: 201 CQSKLAVILFTKELSRRLQGTGVTVNALHPGVARTELGRHTGMHSSAFSSFTLGPIFWL- 259

Query: 705 SFFXQTPQQGAQTSLYCALXEGLEVLSGKHFSDCHVAWVSAQARNETVARRLWDVSCDLL 884
               ++PQ  AQ S Y A+ E LE +SGK+F        + +A +E VA+RLW  S  L+
Sbjct: 260 --LVKSPQLAAQPSTYLAVAEELEGVSGKYFDGLKEKAPAPEAEDEEVAQRLWAESARLV 317

Query: 885 GI 890
           G+
Sbjct: 318 GL 319


>ref|XP_548293.2| PREDICTED: similar to retinol dehydrogenase 11 (predicted) [Canis
           familiaris]
          Length = 377

 Score =  196 bits (499), Expect = 2e-50
 Identities = 123/294 (41%), Positives = 160/294 (54%), Gaps = 38/294 (12%)
 Frame = +3

Query: 132 CTSTVQLPGKVAVVTGANTGIGKETAKELAKRGARVYLACRDVQKGESVAREIQNMTGNQ 311
           C     L G+ AVVTGAN+GIGK TA ELA+RGARV LACR  ++GE+ A +++  +GN 
Sbjct: 28  CGGIASLRGRTAVVTGANSGIGKMTALELARRGARVVLACRSRERGEAAAFDLRQESGNN 87

Query: 312 QVLVRKLDLADTKSIRAFAKGFLAEEKHLHILINNAGVMMCPYSKTADGFETHMGVNXXX 491
           +V+   LDLA   S+RAFA  FL+ E  L ILI+NAG+  C   +T   F   + VN   
Sbjct: 88  EVIFMALDLASLASVRAFATAFLSSEPRLDILIHNAGISSC--GRTHKPFNLLLRVNHIG 145

Query: 492 XXXXXXXXXXXXKESAPSRVVNVSSLAHHMGRIHF------------------------- 596
                       K  APSRVV VSS AH  GR+ F                         
Sbjct: 146 PFLLTHLLLPRLKTCAPSRVVVVSSAAHRRGRLDFTRLDRPVVGWQQELRAYADSKLANV 205

Query: 597 -------HNLQGSGVTTYSVHPGTVDSEL-VRH-----SSLLRWIWWLFSFFXQTPQQGA 737
                    L+G+GVT Y+ HPG V+SEL +RH       LLR + WL     + P+ GA
Sbjct: 206 LFARELATQLEGTGVTCYAAHPGPVNSELFLRHVPGWLCPLLRPLAWL---MLRAPRGGA 262

Query: 738 QTSLYCALXEGLEVLSGKHFSDCHVAWVSAQARNETVARRLWDVSCDLLGIPYG 899
           QT LYCAL EG+E LSG++F++CHV  V   AR++  A +LW+ S  L G+  G
Sbjct: 263 QTPLYCALQEGIEPLSGRYFANCHVEEVPPAARDDRAAHQLWEASKRLAGLGPG 316


>ref|XP_540096.2| PREDICTED: similar to retinol dehydrogenase 14 (all-trans and
           9-cis) isoform 1 [Canis familiaris]
          Length = 336

 Score =  177 bits (449), Expect = 1e-44
 Identities = 109/292 (37%), Positives = 154/292 (52%), Gaps = 47/292 (16%)
 Frame = +3

Query: 156 GKVAVVTGANTGIGKETAKELAKRGARVYLACRDVQKGESVA----REIQNMTGNQ---- 311
           GK  ++TGAN+G+G+ TA  L + GARV + CRD  + E  A    RE++   G +    
Sbjct: 43  GKTVLITGANSGLGRATAAALLRLGARVIMGCRDRARAEEAAGQLRRELRQAGGREPGSD 102

Query: 312 -----QVLVRKLDLADTKSIRAFAKGFLAEEKHLHILINNAGVMMCPYSKTADGFETHMG 476
                +++VR+LDLA  +S+RAF +  L EE  L +LINNAG+  CPY KT DGFE   G
Sbjct: 103 VGAAGELVVRELDLASLRSVRAFCQEVLQEEPRLDVLINNAGIFQCPYMKTEDGFEMQFG 162

Query: 477 VNXXXXXXXXXXXXXXXKESAPSRVVNVSSLAHHMGRIHFHN------------------ 602
           VN               K SAPSR+V VSS  +  G I+F +                  
Sbjct: 163 VNHLGHFLLTNLLLGLLKNSAPSRIVVVSSKLYKYGDINFEDLNSEQSYNKSFCYSRSKL 222

Query: 603 ------------LQGSGVTTYSVHPGTVDSELVRHSSLLRWIWWLFSF----FXQTPQQG 734
                       L+G+ VT   +HPG V + L RH  +   +  LF+     F +TP +G
Sbjct: 223 ANILFTRELARRLEGTNVTVNVLHPGIVRTNLGRHIHIPLLVRPLFNLVSWAFFKTPVEG 282

Query: 735 AQTSLYCALXEGLEVLSGKHFSDCHVAWVSAQARNETVARRLWDVSCDLLGI 890
           AQTS+Y A    +E +SGK+F DC    +  +A +E+VAR+LWD+S  ++GI
Sbjct: 283 AQTSVYLASSPEVEGVSGKYFGDCKEEELLPKAMDESVARKLWDISEVMVGI 334


>ref|XP_533000.2| PREDICTED: similar to Retinol dehydrogenase 12 [Canis familiaris]
          Length = 596

 Score =  158 bits (400), Expect = 7e-39
 Identities = 98/283 (34%), Positives = 148/283 (52%), Gaps = 33/283 (11%)
 Frame = +3

Query: 141  TVQLPGKVAVVTGANTGIGKETAKELAKRGARVYLACRDVQKGESVAREIQNMTGNQQVL 320
            +  L GK AVVTGAN+GIGK   +ELA+RGARV LACR+ ++G+    EIQ  +    +L
Sbjct: 310  STDLTGKTAVVTGANSGIGKAVCQELARRGARVILACRNWERGQKALAEIQVASKGTCLL 369

Query: 321  VRKLDLADTKSIRAFAKGFLAEEKHLHILINNAGVMMCPYSKTADGFETHMGVNXXXXXX 500
            + ++DL+   SIR+FA+  L E   +H+L+NNA +   P + T +G +     N      
Sbjct: 370  LGQVDLSSMASIRSFARWLLQEYPEIHLLVNNAAISGFPKTLTPEGLDLTFATNYVGPFL 429

Query: 501  XXXXXXXXXKESAPSRVVNVSSLAHHMGRIH----------------------------- 593
                     + +  +RVVNVSS  H  G +                              
Sbjct: 430  LTNLLQGALQRAGSARVVNVSSFRHAHGYVDEKHLTGAGKPLNLIQSYDCSKLLLTSFTG 489

Query: 594  --FHNLQGSGVTTYSVHPGTVDSELVR-HSSLLRWIWWLFSFFXQTPQQGAQTSLYCALX 764
                 LQG+GVT  SV PG V +E+++ +  L R+++WLFSFF +  +QGA   LY +L 
Sbjct: 490  ELARRLQGTGVTVNSVDPGVVYTEIMKPYPWLYRFLFWLFSFFCKDVKQGAIPVLYLSLA 549

Query: 765  EGLEVLSGKHF-SDCHVAWVSAQARNETVARRLWDVSCDLLGI 890
            + L+ +SGK+F S C +   +  A++  VA+ LW+ S  L  +
Sbjct: 550  KELDGVSGKYFSSSCMITLPTEAAQDPQVAQSLWNASVQLTNL 592


>ref|XP_852222.1| PREDICTED: similar to dehydrogenase/reductase (SDR family) X-linked
           [Canis familiaris]
          Length = 387

 Score =  140 bits (353), Expect = 2e-33
 Identities = 101/288 (35%), Positives = 135/288 (46%), Gaps = 42/288 (14%)
 Frame = +3

Query: 153 PGKVAVVTGANTGIGKETAKELAKRGARVYLACRDVQKGESVAREIQNMTGNQQVLVRKL 332
           P +VA+VTG   GIG  TAK LA+ G  V LA  +      V R+IQ  T N +V     
Sbjct: 94  PERVAIVTGGTDGIGYSTAKHLARLGMHVILAGNNDSSAPDVVRKIQEETLNDKVEFLYC 153

Query: 333 DLADTKSIRAFAKGFLAEEKHLHILINNAGVMMCPYSKTADGFETHMGVNXXXXXXXXXX 512
           DLA  +SIR F + F  ++  LH+L+NNAGVMM P   T DGFE H G+N          
Sbjct: 154 DLASLRSIRQFVQKFKKKKIPLHVLVNNAGVMMVPERTTEDGFEEHFGLNYLGHFLLTNL 213

Query: 513 XXXXXKES-AP---SRVVNVSSLAHHMGRIHFHNL------------------------- 605
                KES AP   +RVV VSS  H++G +   +L                         
Sbjct: 214 LLDTLKESGAPGRCARVVTVSSATHYIGELDMDDLQGSRCYSPHAAYAQSKLALVLFTYH 273

Query: 606 -------QGSGVTTYSVHPGTVDSELVRH----SSLLRWI--WWLFSFFXQTPQQGAQTS 746
                  QGS VT   V PG V++ L RH    + L++ +  WW F    +TP +GA TS
Sbjct: 274 LQRLLAAQGSPVTANVVDPGVVNTNLYRHVFWGTRLIKKLFGWWFF----KTPDEGAWTS 329

Query: 747 LYCALXEGLEVLSGKHFSDCHVAWVSAQARNETVARRLWDVSCDLLGI 890
           +Y A+   LE L G++  +       A   +  +   LW  SC + GI
Sbjct: 330 VYAAVTPDLEGLGGRYLYNEKETKSLAVTYDLDLQTELWARSCQMTGI 377


>ref|XP_857582.1| PREDICTED: similar to retinol dehydrogenase 14 (all-trans and
           9-cis) isoform 4 [Canis familiaris]
          Length = 307

 Score =  123 bits (309), Expect = 2e-28
 Identities = 91/292 (31%), Positives = 134/292 (45%), Gaps = 47/292 (16%)
 Frame = +3

Query: 156 GKVAVVTGANTGIGKETAKELAKRGARVYLACRDVQKGESVA----REIQNMTGNQ---- 311
           GK  ++TGAN+G+G+ TA  L + GARV + CRD  + E  A    RE++   G +    
Sbjct: 43  GKTVLITGANSGLGRATAAALLRLGARVIMGCRDRARAEEAAGQLRRELRQAGGREPGSD 102

Query: 312 -----QVLVRKLDLADTKSIRAFAKGFLAEEKHLHILINNAGVMMCPYSKTADGFETHMG 476
                +++VR+LDLA  +S+RAF +  L                               G
Sbjct: 103 VGAAGELVVRELDLASLRSVRAFCQEVL-----------------------------QFG 133

Query: 477 VNXXXXXXXXXXXXXXXKESAPSRVVNVSSLAHHMGRIHFHNL----------------- 605
           VN               K SAPSR+V VSS  +  G I+F +L                 
Sbjct: 134 VNHLGHFLLTNLLLGLLKNSAPSRIVVVSSKLYKYGDINFEDLNSEQSYNKSFCYSRSKL 193

Query: 606 -------------QGSGVTTYSVHPGTVDSELVRHSSLLRWIWWLFSF----FXQTPQQG 734
                        +G+ VT   +HPG V + L RH  +   +  LF+     F +TP +G
Sbjct: 194 ANILFTRELARRLEGTNVTVNVLHPGIVRTNLGRHIHIPLLVRPLFNLVSWAFFKTPVEG 253

Query: 735 AQTSLYCALXEGLEVLSGKHFSDCHVAWVSAQARNETVARRLWDVSCDLLGI 890
           AQTS+Y A    +E +SGK+F DC    +  +A +E+VAR+LWD+S  ++GI
Sbjct: 254 AQTSVYLASSPEVEGVSGKYFGDCKEEELLPKAMDESVARKLWDISEVMVGI 305


>ref|XP_852623.1| PREDICTED: similar to WW domain-containing oxidoreductase isoform 1
           [Canis familiaris]
          Length = 383

 Score =  105 bits (261), Expect = 9e-23
 Identities = 77/243 (31%), Positives = 108/243 (44%), Gaps = 38/243 (15%)
 Frame = +3

Query: 156 GKVAVVTGANTGIGKETAKELAKRGARVYLACRDVQKGESVAREIQNMTGNQQVLVRKLD 335
           GKV VVTGAN+GIG ETAK  A  GA V LACR++ +      +I       +V    LD
Sbjct: 124 GKVVVVTGANSGIGFETAKSFALHGAHVILACRNMTRANEAVSQILGEWHKAKVEAMTLD 183

Query: 336 LADTKSIRAFAKGFLAEEKHLHILINNAGVMMCPYSKTADGFETHMGVNXXXXXXXXXXX 515
           LA  +S++ FA+ F A+   LH+L+ NA     P+S T DG ET   VN           
Sbjct: 184 LALLRSVQHFAQAFKAKNVSLHVLVCNAAAFALPWSLTKDGLETTFQVNHLGHFYLVQLL 243

Query: 516 XXXXKESAPSRVVNVSSLAHHM-------GRIHFHNLQGS-------------------- 614
                 SAP+RVV VSS +H         G++ F  L  S                    
Sbjct: 244 QDVLCRSAPARVVVVSSESHRFTDINDSSGKLDFSRLSPSKSDYWAMLAYNRSKLCNILF 303

Query: 615 -----------GVTTYSVHPGTVDSELVRHSSLLRWIWWLFSFFXQTPQQGAQTSLYCAL 761
                      GVT+ +VHPG      + +SS+ R  WW+++      +   ++ L  + 
Sbjct: 304 SNELHRRLSPRGVTSNAVHPGN-----MMYSSIHR-NWWVYTLLFTLARPFTKSMLLVSC 357

Query: 762 XEG 770
            +G
Sbjct: 358 SDG 360


>ref|XP_857503.1| PREDICTED: similar to retinol dehydrogenase 14 (all-trans and
           9-cis) isoform 3 [Canis familiaris]
          Length = 153

 Score = 62.8 bits (151), Expect = 5e-10
 Identities = 35/92 (38%), Positives = 53/92 (57%), Gaps = 13/92 (14%)
 Frame = +3

Query: 156 GKVAVVTGANTGIGKETAKELAKRGARVYLACRDVQKGESVA----REIQNMTGNQ---- 311
           GK  ++TGAN+G+G+ TA  L + GARV + CRD  + E  A    RE++   G +    
Sbjct: 43  GKTVLITGANSGLGRATAAALLRLGARVIMGCRDRARAEEAAGQLRRELRQAGGREPGSD 102

Query: 312 -----QVLVRKLDLADTKSIRAFAKGFLAEEK 392
                +++VR+LDLA  +S+RAF +  L   K
Sbjct: 103 VGAAGELVVRELDLASLRSVRAFCQEVLQGRK 134


  Database: RefSeqCP
    Posted date:  Aug 1, 2006  9:25 PM
  Number of letters in database: 19,266,565
  Number of sequences in database:  33,732
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 41,349,429
Number of Sequences: 33732
Number of extensions: 1111502
Number of successful extensions: 3069
Number of sequences better than 1.0e-05: 10
Number of HSP's better than  0.0 without gapping: 2797
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3038
length of database: 19,266,565
effective HSP length: 103
effective length of database: 15,792,169
effective search space used: 3616406701
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqHP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611S-004057
         (1000 letters)

Database: RefSeqHP 
           39,411 sequences; 17,774,539 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_057110.2| androgen-regulated short-chain dehydrogenase/re...   453   e-127
Alignment   gi|NP_689656.1| retinol dehydrogenase 12 (all-trans and 9-cis) ...   361   e-100
Alignment   gi|NP_065956.1| retinol dehydrogenase 14 (all-trans and 9-cis) ...   178   7e-45
Alignment   gi|NP_653284.1| hypothetical protein LOC147015 [Homo sapiens]        170   2e-42
Alignment   gi|NP_612421.1| retinol dehydrogenase 13 (all-trans and 9-cis) ...   145   4e-35
Alignment   gi|NP_057457.1| WW domain-containing oxidoreductase isoform 1 [...   138   8e-33
Alignment   gi|NP_660160.1| dehydrogenase/reductase (SDR family) X-linked [...   137   1e-32
Alignment   gi|XP_371503.3| PREDICTED: similar to short-chain dehydrogenase...    91   1e-18
Alignment   gi|XP_947127.1| PREDICTED: similar to short-chain dehydrogenase...    91   1e-18
Alignment   gi|NP_057113.1| dehydrogenase/reductase (SDR family) member 7 [...    60   2e-09

>ref|NP_057110.2| androgen-regulated short-chain dehydrogenase/reductase 1 [Homo
           sapiens]
          Length = 318

 Score =  453 bits (1165), Expect = e-127
 Identities = 226/299 (75%), Positives = 242/299 (80%), Gaps = 30/299 (10%)
 Frame = +3

Query: 87  YIAVPQIRKMLSSGVCTSTVQLPGKVAVVTGANTGIGKETAKELAKRGARVYLACRDVQK 266
           Y+A PQIRKMLSSGVCTSTVQLPGKV VVTGANTGIGKETAKELA+RGARVYLACRDV+K
Sbjct: 18  YMAAPQIRKMLSSGVCTSTVQLPGKVVVVTGANTGIGKETAKELAQRGARVYLACRDVEK 77

Query: 267 GESVAREIQNMTGNQQVLVRKLDLADTKSIRAFAKGFLAEEKHLHILINNAGVMMCPYSK 446
           GE VA+EIQ  TGNQQVLVRKLDL+DTKSIRAFAKGFLAEEKHLH+LINNAGVMMCPYSK
Sbjct: 78  GELVAKEIQTTTGNQQVLVRKLDLSDTKSIRAFAKGFLAEEKHLHVLINNAGVMMCPYSK 137

Query: 447 TADGFETHMGVNXXXXXXXXXXXXXXXKESAPSRVVNVSSLAHHMGRIHFHNLQG----- 611
           TADGFE H+GVN               KESAPSR+VNVSSLAHH+GRIHFHNLQG     
Sbjct: 138 TADGFEMHIGVNHLGHFLLTHLLLEKLKESAPSRIVNVSSLAHHLGRIHFHNLQGEKFYN 197

Query: 612 -------------------------SGVTTYSVHPGTVDSELVRHSSLLRWIWWLFSFFX 716
                                    SGVTTYSVHPGTV SELVRHSS +RW+WWLFSFF 
Sbjct: 198 AGLAYCHSKLANILFTQELARRLKGSGVTTYSVHPGTVQSELVRHSSFMRWMWWLFSFFI 257

Query: 717 QTPQQGAQTSLYCALXEGLEVLSGKHFSDCHVAWVSAQARNETVARRLWDVSCDLLGIP 893
           +TPQQGAQTSL+CAL EGLE+LSG HFSDCHVAWVS QARNET+ARRLWDVSCDLLG+P
Sbjct: 258 KTPQQGAQTSLHCALTEGLEILSGNHFSDCHVAWVSVQARNETIARRLWDVSCDLLGLP 316


>ref|NP_689656.1| retinol dehydrogenase 12 (all-trans and 9-cis) [Homo sapiens]
          Length = 316

 Score =  361 bits (927), Expect = e-100
 Identities = 189/298 (63%), Positives = 215/298 (72%), Gaps = 30/298 (10%)
 Frame = +3

Query: 87  YIAVPQIRKMLSSGVCTSTVQLPGKVAVVTGANTGIGKETAKELAKRGARVYLACRDVQK 266
           Y+  P IRK  + GVC + VQLPGKV V+TGANTGIGKETA+ELA RGARVY+ACRDV K
Sbjct: 16  YMVAPSIRKFFAGGVCRTNVQLPGKVVVITGANTGIGKETARELASRGARVYIACRDVLK 75

Query: 267 GESVAREIQNMTGNQQVLVRKLDLADTKSIRAFAKGFLAEEKHLHILINNAGVMMCPYSK 446
           GES A EI+  T N QVLVRKLDL+DTKSIRAFA+GFLAEEK LHILINNAGVMMCPYSK
Sbjct: 76  GESAASEIRVDTKNSQVLVRKLDLSDTKSIRAFAEGFLAEEKQLHILINNAGVMMCPYSK 135

Query: 447 TADGFETHMGVNXXXXXXXXXXXXXXXKESAPSRVVNVSSLAHHMGRIHFHN-------- 602
           TADGFETH+GVN               K SAP+RVVNVSS+AHH+G+I FH+        
Sbjct: 136 TADGFETHLGVNHLGHFLLTYLLLEQLKVSAPARVVNVSSVAHHIGKIPFHDLQSEKRYS 195

Query: 603 ----------------------LQGSGVTTYSVHPGTVDSELVRHSSLLRWIWWLFSFFX 716
                                 LQG+GVTTY+VHPG V SELVRHSSLL  +W LFS F 
Sbjct: 196 RGFAYCHSKLANVLFTRELAKRLQGTGVTTYAVHPGVVRSELVRHSSLLCLLWRLFSPFV 255

Query: 717 QTPQQGAQTSLYCALXEGLEVLSGKHFSDCHVAWVSAQARNETVARRLWDVSCDLLGI 890
           +T ++GAQTSL+CAL EGLE LSGK+FSDC   WVS +ARN   A RLW+VSC+LLGI
Sbjct: 256 KTAREGAQTSLHCALAEGLEPLSGKYFSDCKRTWVSPRARNNKTAERLWNVSCELLGI 313


>ref|NP_065956.1| retinol dehydrogenase 14 (all-trans and 9-cis) [Homo sapiens]
          Length = 336

 Score =  178 bits (451), Expect = 7e-45
 Identities = 106/292 (36%), Positives = 154/292 (52%), Gaps = 47/292 (16%)
 Frame = +3

Query: 156 GKVAVVTGANTGIGKETAKELAKRGARVYLACRDVQKGESVAREIQN------------- 296
           GK  ++TGAN+G+G+ TA EL + GARV + CRD  + E  A +++              
Sbjct: 43  GKTVLITGANSGLGRATAAELLRLGARVIMGCRDRARAEEAAGQLRRELRQAAECGPEPG 102

Query: 297 MTGNQQVLVRKLDLADTKSIRAFAKGFLAEEKHLHILINNAGVMMCPYSKTADGFETHMG 476
           ++G  +++VR+LDLA  +S+RAF +  L EE  L +LINNAG+  CPY KT DGFE   G
Sbjct: 103 VSGVGELIVRELDLASLRSVRAFCQEMLQEEPRLDVLINNAGIFQCPYMKTEDGFEMQFG 162

Query: 477 VNXXXXXXXXXXXXXXXKESAPSRVVNVSSLAHHMGRIHF-------------------- 596
           VN               K SAPSR+V VSS  +  G I+F                    
Sbjct: 163 VNHLGHFLLTNLLLGLLKSSAPSRIVVVSSKLYKYGDINFDDLNSEQSYNKSFCYSRSKL 222

Query: 597 ----------HNLQGSGVTTYSVHPGTVDSELVRHSSLLRWIWWLFSF----FXQTPQQG 734
                       L+G+ VT   +HPG V + L RH  +   +  LF+     F +TP +G
Sbjct: 223 ANILFTRELARRLEGTNVTVNVLHPGIVRTNLGRHIHIPLLVKPLFNLVSWAFFKTPVEG 282

Query: 735 AQTSLYCALXEGLEVLSGKHFSDCHVAWVSAQARNETVARRLWDVSCDLLGI 890
           AQTS+Y A    +E +SG++F DC    +  +A +E+VAR+LWD+S  ++G+
Sbjct: 283 AQTSIYLASSPEVEGVSGRYFGDCKEEELLPKAMDESVARKLWDISEVMVGL 334


>ref|NP_653284.1| hypothetical protein LOC147015 [Homo sapiens]
          Length = 327

 Score =  170 bits (430), Expect = 2e-42
 Identities = 108/270 (40%), Positives = 145/270 (53%), Gaps = 38/270 (14%)
 Frame = +3

Query: 204 TAKELAKRGARVYLACRDVQKGESVAREIQNMTGNQQVLVRKLDLADTKSIRAFAKGFLA 383
           TA ELA+RGARV LACR  ++GE+ A +++  +GN +V+   LDLA   S+RAFA  FL+
Sbjct: 2   TALELARRGARVVLACRSQERGEAAAFDLRQESGNNEVIFMALDLASLASVRAFATAFLS 61

Query: 384 EEKHLHILINNAGVMMCPYSKTADGFETHMGVNXXXXXXXXXXXXXXXKESAPSRVVNVS 563
            E  L ILI+NAG+  C   +T + F   + VN               K  APSRVV V+
Sbjct: 62  SEPRLDILIHNAGISSC--GRTREAFNLLLRVNHIGPFLLTHLLLPCLKACAPSRVVVVA 119

Query: 564 SLAHHMGRIHF--------------------------------HNLQGSGVTTYSVHPGT 647
           S AH  GR+ F                                + L+ +GVT Y+ HPG 
Sbjct: 120 SAAHCRGRLDFKRLDRPVVGWRQELRAYADTKLANVLFARELANQLEATGVTCYAAHPGP 179

Query: 648 VDSEL-VRH-----SSLLRWIWWLFSFFXQTPQQGAQTSLYCALXEGLEVLSGKHFSDCH 809
           V+SEL +RH       LLR + WL     + P+ GAQT LYCAL EG+E LSG++F++CH
Sbjct: 180 VNSELFLRHVPGWLRPLLRPLAWL---VLRAPRGGAQTPLYCALQEGIEPLSGRYFANCH 236

Query: 810 VAWVSAQARNETVARRLWDVSCDLLGIPYG 899
           V  V   AR++  A RLW+ S  L G+  G
Sbjct: 237 VEEVPPAARDDRAAHRLWEASKRLAGLGPG 266


>ref|NP_612421.1| retinol dehydrogenase 13 (all-trans and 9-cis) [Homo sapiens]
          Length = 260

 Score =  145 bits (367), Expect = 4e-35
 Identities = 96/251 (38%), Positives = 125/251 (49%), Gaps = 40/251 (15%)
 Frame = +3

Query: 258 VQKGESVAREIQNMTGNQQVLVRKLDLADTKSIRAFAKGFLAEEKHLHILINNAGVMMCP 437
           ++K E+ A++I+  T N  V  R LDLA  KSIR FA   + EE+ + ILINNAGVM CP
Sbjct: 1   MEKCEAAAKDIRGETLNHHVNARHLDLASLKSIREFAAKIIEEEERVDILINNAGVMRCP 60

Query: 438 YSKTADGFETHMGVNXXXXXXXXXXXXXXXKESAPSRVVNVSSLAHHMGRIHF------- 596
           +  T DGFE   GVN               K SAPSR++N+SSLAH  G I F       
Sbjct: 61  HWTTEDGFEMQFGVNHLGHFLLTNLLLDKLKASAPSRIINLSSLAHVAGHIDFDDLNWQT 120

Query: 597 ------------------------HNLQGSGVTTYSVHPGTVDSELVRH---------SS 677
                                     LQGSGVT  ++HPG   +EL RH         S+
Sbjct: 121 RKYNTKAAYCQSKLAIVLFTKELSRRLQGSGVTVNALHPGVARTELGRHTGIHGSTFSST 180

Query: 678 LLRWIWWLFSFFXQTPQQGAQTSLYCALXEGLEVLSGKHFSDCHVAWVSAQARNETVARR 857
            L  I+WL     ++P+  AQ S Y A+ E L  +SGK+F        + +A +E VARR
Sbjct: 181 TLGPIFWL---LVKSPELAAQPSTYLAVAEELADVSGKYFDGLKQKAPAPEAEDEEVARR 237

Query: 858 LWDVSCDLLGI 890
           LW  S  L+G+
Sbjct: 238 LWAESARLVGL 248


>ref|NP_057457.1| WW domain-containing oxidoreductase isoform 1 [Homo sapiens]
          Length = 414

 Score =  138 bits (347), Expect = 8e-33
 Identities = 94/284 (33%), Positives = 132/284 (46%), Gaps = 45/284 (15%)
 Frame = +3

Query: 156 GKVAVVTGANTGIGKETAKELAKRGARVYLACRDVQKGESVAREIQNMTGNQQVLVRKLD 335
           GKV VVTGAN+GIG ETAK  A  GA V LACR++ +       I       +V    LD
Sbjct: 124 GKVVVVTGANSGIGFETAKSFALHGAHVILACRNMARASEAVSRILEEWHKAKVEAMTLD 183

Query: 336 LADTKSIRAFAKGFLAEEKHLHILINNAGVMMCPYSKTADGFETHMGVNXXXXXXXXXXX 515
           LA  +S++ FA+ F A+   LH+L+ NA     P+S T DG ET   VN           
Sbjct: 184 LALLRSVQHFAEAFKAKNVPLHVLVCNAATFALPWSLTKDGLETTFQVNHLGHFYLVQLL 243

Query: 516 XXXXKESAPSRVVNVSSLAHH-------MGRIHFHNLQGS-------------------- 614
                 SAP+RV+ VSS +H        +G++ F  L  +                    
Sbjct: 244 QDVLCRSAPARVIVVSSESHRFTDINDSLGKLDFSRLSPTKNDYWAMLAYNRSKLCNILF 303

Query: 615 -----------GVTTYSVHPGTVDSELVRHSSLLRWIWWLFSF-------FXQTPQQGAQ 740
                      GVT+ +VHPG +    +  S      WW+++        F ++ QQGA 
Sbjct: 304 SNELHRRLSPRGVTSNAVHPGNMMYSNIHRS------WWVYTLLFTLARPFTKSMQQGAA 357

Query: 741 TSLYCALXEGLEVLSGKHFSDCHVAWVSAQARNETVARRLWDVS 872
           T++YCA    LE L G +F++C     S +A++E  AR LW +S
Sbjct: 358 TTVYCAAVPELEGLGGMYFNNCCRCMPSPEAQSEETARTLWALS 401


>ref|NP_660160.1| dehydrogenase/reductase (SDR family) X-linked [Homo sapiens]
          Length = 330

 Score =  137 bits (346), Expect = 1e-32
 Identities = 94/290 (32%), Positives = 134/290 (46%), Gaps = 44/290 (15%)
 Frame = +3

Query: 153 PGKVAVVTGANTGIGKETAKELAKRGARVYLACRDVQKGESVAREIQNMTGNQQVLVRKL 332
           P +VA+VTG   GIG  TAK LA+ G  V +A  +  K + V  +I+  T N +V     
Sbjct: 42  PDRVAIVTGGTDGIGYSTAKHLARLGMHVIIAGNNDSKAKQVVSKIKEETLNDKVEFLYC 101

Query: 333 DLADTKSIRAFAKGFLAEEKHLHILINNAGVMMCPYSKTADGFETHMGVNXXXXXXXXXX 512
           DLA   SIR F + F  ++  LH+LINNAGVMM P  KT DGFE H G+N          
Sbjct: 102 DLASMTSIRQFVQKFKMKKIPLHVLINNAGVMMVPQRKTRDGFEEHFGLNYLGHFLLTNL 161

Query: 513 XXXXXKESA----PSRVVNVSSLAHHMGRIHFHNLQ------------------------ 608
                KES      +RVV VSS  H++  ++  +LQ                        
Sbjct: 162 LLDTLKESGSPGHSARVVTVSSATHYVAELNMDDLQSSACYSPHAAYAQSKLALVLFTYH 221

Query: 609 --------GSGVTTYSVHPGTVDSELVRH--------SSLLRWIWWLFSFFXQTPQQGAQ 740
                   GS VT   V PG V+++L +H          LL W+        +TP +GA 
Sbjct: 222 LQRLLAAEGSHVTANVVDPGVVNTDLYKHVFWATRLAKKLLGWL------LFKTPDEGAW 275

Query: 741 TSLYCALXEGLEVLSGKHFSDCHVAWVSAQARNETVARRLWDVSCDLLGI 890
           TS+Y A+   LE + G++  +           N+ + ++LW  SC++ G+
Sbjct: 276 TSIYAAVTPELEGVGGRYLYNEKETKSLHVTYNQKLQQQLWSKSCEMTGV 325


>ref|XP_371503.3| PREDICTED: similar to short-chain dehydrogenase/reductase 1 [Homo
           sapiens]
          Length = 891

 Score = 91.3 bits (225), Expect = 1e-18
 Identities = 50/120 (41%), Positives = 78/120 (65%), Gaps = 3/120 (2%)
 Frame = +3

Query: 114 MLSSGVCTSTVQ--LPGKVAVVTGANTGIGKETAKELAKRGARVYLACRDVQKGESVARE 287
           +LSSGV     +  L GK+A+VTGAN+GIGK  +++LA+ GA+V L C+  + G+    E
Sbjct: 586 LLSSGVPEQEDKEDLTGKIAIVTGANSGIGKVVSQDLARCGAQVILTCQSRECGQQALAE 645

Query: 288 IQNMTGNQQVLVRKLDLADTKSIRAFAKGFLAEEKHLHILINNAGVM-MCPYSKTADGFE 464
           IQ  + + ++L+ ++DL+   SIR+FA+  L E   +H+L+NNAGV  M P + T  G +
Sbjct: 646 IQAASNSNRLLLGEVDLSSMTSIRSFARRLLQENPEIHLLVNNAGVSGMIPKTLTPGGLD 705


>ref|XP_947127.1| PREDICTED: similar to short-chain dehydrogenase/reductase 1 [Homo
           sapiens]
          Length = 916

 Score = 91.3 bits (225), Expect = 1e-18
 Identities = 50/120 (41%), Positives = 78/120 (65%), Gaps = 3/120 (2%)
 Frame = +3

Query: 114 MLSSGVCTSTVQ--LPGKVAVVTGANTGIGKETAKELAKRGARVYLACRDVQKGESVARE 287
           +LSSGV     +  L GK+A+VTGAN+GIGK  +++LA+ GA+V L C+  + G+    E
Sbjct: 611 LLSSGVPEQEDKEDLTGKIAIVTGANSGIGKVVSQDLARCGAQVILTCQSRECGQQALAE 670

Query: 288 IQNMTGNQQVLVRKLDLADTKSIRAFAKGFLAEEKHLHILINNAGVM-MCPYSKTADGFE 464
           IQ  + + ++L+ ++DL+   SIR+FA+  L E   +H+L+NNAGV  M P + T  G +
Sbjct: 671 IQAASNSNRLLLGEVDLSSMTSIRSFARRLLQENPEIHLLVNNAGVSGMIPKTLTPGGLD 730


>ref|NP_057113.1| dehydrogenase/reductase (SDR family) member 7 [Homo sapiens]
          Length = 339

 Score = 60.5 bits (145), Expect = 2e-09
 Identities = 57/201 (28%), Positives = 88/201 (43%), Gaps = 25/201 (12%)
 Frame = +3

Query: 147 QLPGKVAVVTGANTGIGKETAKELAKRGARVYLACRDVQKGESVAREIQNMTGN---QQV 317
           +L   V  VTGA++GIG+E A +L+K G  + L+ R V + E V R      GN   + +
Sbjct: 47  ELTDMVVWVTGASSGIGEELAYQLSKLGVSLVLSARRVHELERVKRRCLE-NGNLKEKDI 105

Query: 318 LVRKLDLADTKSIRAFAKGFLAEEKHLHILINNAGV---MMCPYSKTADGFETHMGVNXX 488
           LV  LDL DT S  A  K  L E   + IL+NN G+    +C    + D +   + +N  
Sbjct: 106 LVLPLDLTDTGSHEAATKAVLQEFGRIDILVNNGGMSQRSLC-MDTSLDVYRKLIELNYL 164

Query: 489 XXXXXXXXXXXXXKESAPSRVVNVSSL--------------AHHMGRIHFHNLQGS---- 614
                         E    ++V V+S+              + H  R  F+ L+      
Sbjct: 165 GTVSLTKCVLPHMIERKQGKIVTVNSILGIISVPLSIGYCASKHALRGFFNGLRTELATY 224

Query: 615 -GVTTYSVHPGTVDSELVRHS 674
            G+   ++ PG V S +V +S
Sbjct: 225 PGIIVSNICPGPVQSNIVENS 245


  Database: RefSeqHP
    Posted date:  Aug 2, 2006 12:57 AM
  Number of letters in database: 17,774,539
  Number of sequences in database:  39,411
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 40,066,735
Number of Sequences: 39411
Number of extensions: 1112000
Number of successful extensions: 3092
Number of sequences better than 1.0e-05: 10
Number of HSP's better than  0.0 without gapping: 2746
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3070
length of database: 17,774,539
effective HSP length: 102
effective length of database: 13,754,617
effective search space used: 3163561910
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqMP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611S-004057
         (1000 letters)

Database: RefSeqMP 
           45,328 sequences; 21,768,885 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_067532.2| short-chain dehydrogenase/reductase 1 [Mus musc...   416   e-116
Alignment   gi|NP_084293.1| retinol dehydrogenase 12 [Mus musculus]              345   6e-95
Alignment   gi|NP_780581.1| retinol dehydrogenase 13 (all-trans and 9-cis) ...   212   4e-55
Alignment   gi|NP_076186.1| alcohol dehydrogenase PAN2 [Mus musculus]            177   1e-44
Alignment   gi|NP_001028498.1| dehydrogenase/reductase (SDR family) X chrom...   142   5e-34
Alignment   gi|NP_062519.2| WW-domain oxidoreductase [Mus musculus]              138   8e-33
Alignment   gi|NP_899109.1| hypothetical protein LOC70451 [Mus musculus]         138   1e-32
Alignment   gi|NP_079798.1| retinal short-chain dehydrogenase/reductase 4 [...    65   1e-10
Alignment   gi|NP_663403.1| hypothetical protein LOC216820 [Mus musculus]         59   1e-08
Alignment   gi|NP_032304.1| hydroxyprostaglandin dehydrogenase 15 (NAD) [Mu...    55   1e-07

>ref|NP_067532.2| short-chain dehydrogenase/reductase 1 [Mus musculus]
          Length = 316

 Score =  416 bits (1069), Expect = e-116
 Identities = 209/299 (69%), Positives = 229/299 (76%), Gaps = 30/299 (10%)
 Frame = +3

Query: 87  YIAVPQIRKMLSSGVCTSTVQLPGKVAVVTGANTGIGKETAKELAKRGARVYLACRDVQK 266
           Y+  P+IRKMLSSGVCTS VQLPGKVA+VTGANTGIGKETAK+LA+RGARVYLACRDV K
Sbjct: 15  YLVTPKIRKMLSSGVCTSNVQLPGKVAIVTGANTGIGKETAKDLAQRGARVYLACRDVDK 74

Query: 267 GESVAREIQNMTGNQQVLVRKLDLADTKSIRAFAKGFLAEEKHLHILINNAGVMMCPYSK 446
           GE  AREIQ +TGN QV VRKLDLADTKSIRAFAK FLAEEKHLH+LINNAGVMMCPYSK
Sbjct: 75  GELAAREIQAVTGNSQVFVRKLDLADTKSIRAFAKDFLAEEKHLHLLINNAGVMMCPYSK 134

Query: 447 TADGFETHMGVNXXXXXXXXXXXXXXXKESAPSRVVNVSSLAHHMGRIHFHNLQ------ 608
           TADGFE H+GVN               KESAPSR+VN+SSL HH+GRIHFHNLQ      
Sbjct: 135 TADGFEMHIGVNHLGHFLLTHLLLEKLKESAPSRIVNLSSLGHHLGRIHFHNLQGEKFYS 194

Query: 609 ------------------------GSGVTTYSVHPGTVDSELVRHSSLLRWIWWLFSFFX 716
                                   GSGVTTYSVHPGTV SEL R+SS++RW+W LF  F 
Sbjct: 195 AGLAYCHSKLANILFTKELAKRLKGSGVTTYSVHPGTVHSELTRYSSIMRWLWQLFFVFI 254

Query: 717 QTPQQGAQTSLYCALXEGLEVLSGKHFSDCHVAWVSAQARNETVARRLWDVSCDLLGIP 893
           +TPQ+GAQTSLYCAL EGLE LSG HFSDC +AWVS Q RNE +ARRLWDVSCDLLG+P
Sbjct: 255 KTPQEGAQTSLYCALTEGLESLSGSHFSDCQLAWVSYQGRNEIIARRLWDVSCDLLGLP 313


>ref|NP_084293.1| retinol dehydrogenase 12 [Mus musculus]
          Length = 316

 Score =  345 bits (884), Expect = 6e-95
 Identities = 180/300 (60%), Positives = 212/300 (70%), Gaps = 30/300 (10%)
 Frame = +3

Query: 87  YIAVPQIRKMLSSGVCTSTVQLPGKVAVVTGANTGIGKETAKELAKRGARVYLACRDVQK 266
           Y+  P IRK  + GVCT+ VQ+PGKV V+TGANTGIGKETA+ELA+RGARVY+ACRDV K
Sbjct: 16  YLTAPSIRKFFAGGVCTTNVQIPGKVVVITGANTGIGKETARELARRGARVYIACRDVLK 75

Query: 267 GESVAREIQNMTGNQQVLVRKLDLADTKSIRAFAKGFLAEEKHLHILINNAGVMMCPYSK 446
           GES A EI+  T N QVLVRKLDL+DTKSIRAFA+ FLAEEK LHILINNAGVMMCPYSK
Sbjct: 76  GESAASEIRADTKNSQVLVRKLDLSDTKSIRAFAERFLAEEKKLHILINNAGVMMCPYSK 135

Query: 447 TADGFETHMGVNXXXXXXXXXXXXXXXKESAPSRVVNVSSLAHHMGRIHFHN-------- 602
           T DGFETH GVN               KESAP+RVVN+SS+AH +G+I FH+        
Sbjct: 136 TTDGFETHFGVNHLGHFLLTYLLLERLKESAPARVVNLSSIAHLIGKIRFHDLQGQKRYC 195

Query: 603 ----------------------LQGSGVTTYSVHPGTVDSELVRHSSLLRWIWWLFSFFX 716
                                 LQG+GVT Y+VHPG V SE+ R+S LL  +W LFS F 
Sbjct: 196 SAFAYGHSKLANLLFTRELAKRLQGTGVTAYAVHPGVVLSEITRNSYLLCLLWRLFSPFF 255

Query: 717 QTPQQGAQTSLYCALXEGLEVLSGKHFSDCHVAWVSAQARNETVARRLWDVSCDLLGIPY 896
           ++  QGAQTSL+CAL E LE LSGK+FSDC   WVS++ARN+  A RLW+VSC+LLGI +
Sbjct: 256 KSTSQGAQTSLHCALAEDLEPLSGKYFSDCKRMWVSSRARNKKTAERLWNVSCELLGIQW 315


>ref|NP_780581.1| retinol dehydrogenase 13 (all-trans and 9-cis) [Mus musculus]
          Length = 334

 Score =  212 bits (540), Expect = 4e-55
 Identities = 125/303 (41%), Positives = 163/303 (53%), Gaps = 41/303 (13%)
 Frame = +3

Query: 105 IRKMLSSGVCTSTVQLPGKVAVVTGANTGIGKETAKELAKRGARVYLACRDVQKGESVAR 284
           ++  ++ G C S   +PGK  +VTGANTGIGK+TA ELAKRG  V LACRD++K E  A+
Sbjct: 21  LKDYVAGGACPSKATIPGKTVIVTGANTGIGKQTALELAKRGGNVILACRDMEKCEVAAK 80

Query: 285 EIQNMTGNQQVLVRKLDLADTKSIRAFAKGFLAEEKHLHILINNAGVMMCPYSKTADGFE 464
           +I+  T N +V   +LDLA  KSIR FA+  + EE+ + IL+NNA VM CP+  T DGFE
Sbjct: 81  DIRGETLNPRVRAERLDLASLKSIREFARKVIKEEERVDILVNNAAVMRCPHWTTEDGFE 140

Query: 465 THMGVNXXXXXXXXXXXXXXXKESAPSRVVNVSSLAHHMGRIHF---------------- 596
              GVN               K SAPSR++N+SSLAH  G I F                
Sbjct: 141 MQFGVNYLGHFLLTNLLLDKLKASAPSRIINLSSLAHVAGHIDFEDLNWQMKKYDTKAAY 200

Query: 597 ---------------HNLQGSGVTTYSVHPGTVDSELVRHSSLLR----------WIWWL 701
                          H LQGSGVT  ++HPG   +EL RH+ +            + W L
Sbjct: 201 CQSKLAVVLFTKELSHRLQGSGVTVNALHPGVARTELGRHTGMHNSAFSGFMLGPFFWLL 260

Query: 702 FSFFXQTPQQGAQTSLYCALXEGLEVLSGKHFSDCHVAWVSAQARNETVARRLWDVSCDL 881
           F    ++PQ  AQ S Y A+ E LE +SGK+F        S +A +E VARRLW  S  L
Sbjct: 261 F----KSPQLAAQPSTYLAVAEELENVSGKYFDGLREKAPSPEAEDEEVARRLWTESARL 316

Query: 882 LGI 890
           +G+
Sbjct: 317 VGL 319


>ref|NP_076186.1| alcohol dehydrogenase PAN2 [Mus musculus]
          Length = 334

 Score =  177 bits (450), Expect = 1e-44
 Identities = 109/289 (37%), Positives = 156/289 (53%), Gaps = 44/289 (15%)
 Frame = +3

Query: 156 GKVAVVTGANTGIGKETAKELAKRGARVYLACRDVQKGESVAREIQNMT----------G 305
           GK  ++TGAN+G+G+ TA EL + GARV + CRD  + E  A +++              
Sbjct: 44  GKTVLITGANSGLGRATAAELLRLGARVIMGCRDRARAEEAAGQLRQELCQAGGAGPDGT 103

Query: 306 NQQVLVRKLDLADTKSIRAFAKGFLAEEKHLHILINNAGVMMCPYSKTADGFETHMGVNX 485
           + Q++V++LDLA  +S+RAF +  L EE  L +LINNAGV  CPY+KT DGFE   GVN 
Sbjct: 104 DGQLVVKELDLASLRSVRAFCQELLQEEPRLDVLINNAGVFHCPYTKTEDGFEMQFGVNH 163

Query: 486 XXXXXXXXXXXXXXKESAPSRVVNVSSLAHHMGRIHFHN--------------------- 602
                         K SAPSR+V VSS  +  G I+F +                     
Sbjct: 164 LGHFLLTNLLLGLLKSSAPSRIVVVSSKLYKYGEINFEDLNSEQSYNKSFCYSRSKLANI 223

Query: 603 ---------LQGSGVTTYSVHPGTVDSELVRH---SSLLRWIWWLFSF-FXQTPQQGAQT 743
                    L+G+ VT   +HPG V + L RH     L R ++ L S+ F +TP +GAQT
Sbjct: 224 LFTRELARRLEGTNVTVNVLHPGIVRTNLGRHIHIPLLARPLFNLVSWAFFKTPLEGAQT 283

Query: 744 SLYCALXEGLEVLSGKHFSDCHVAWVSAQARNETVARRLWDVSCDLLGI 890
           S+Y A    +E +SG++F DC    +  +A +E+VAR+LWD+S  ++GI
Sbjct: 284 SIYLACSPDVEGVSGRYFGDCKEEELLPKAMDESVARKLWDISEVMVGI 332


>ref|NP_001028498.1| dehydrogenase/reductase (SDR family) X chromosome [Mus musculus]
          Length = 335

 Score =  142 bits (358), Expect = 5e-34
 Identities = 95/286 (33%), Positives = 137/286 (47%), Gaps = 41/286 (14%)
 Frame = +3

Query: 153 PGKVAVVTGANTGIGKETAKELAKRGARVYLACRDVQKGESVAREIQNMTGNQQVLVRKL 332
           PG+VA+VTGA  GIG+ TA++LA+ G  V +A  D  +G+ V   I+   G+ +     L
Sbjct: 42  PGRVAIVTGATAGIGRSTARQLARLGMCVVVAGNDEHRGQEVVSSIRAEMGSDRAHFLPL 101

Query: 333 DLADTKSIRAFAKGFLAEEKHLHILINNAGVMMCPYSKTADGFETHMGVNXXXXXXXXX- 509
           DLA   S+R FA+ F A    LH+L+NNAGVM+ P ++T DGFE H+GVN          
Sbjct: 102 DLASLASVRGFARDFQALGLPLHLLVNNAGVMLEPRAETEDGFERHLGVNFLGHFLLTLL 161

Query: 510 ---XXXXXXKESAPSRVVNVSSLAHHMGRIHFHNL------------------------- 605
                     E   SRVV V S  H++G +   +L                         
Sbjct: 162 LLPALRASGAEGRGSRVVTVGSATHYVGTVDMADLHGRHAYSPYAAYAQSKLALALFALQ 221

Query: 606 -------QGSGVTTYSVHPGTVDSELVRHSSLL-----RWIWWLFSFFXQTPQQGAQTSL 749
                  +G  VT+    PG VD+EL RH+  +     R++ WL     ++P++GA T +
Sbjct: 222 LQRILDARGDPVTSNMADPGVVDTELYRHAGWVLRTAKRFLGWL---VFKSPEEGAWTLV 278

Query: 750 YCALXEGLEVLSGKHFSDCHVAWVSAQARNETVARRLWDVSCDLLG 887
           Y A    LE + G++  D   A     AR++ + RRLW     L G
Sbjct: 279 YAAAAPELEGVGGRYLRDEAEAEPLGTARDQELQRRLWAEGLRLTG 324


>ref|NP_062519.2| WW-domain oxidoreductase [Mus musculus]
          Length = 414

 Score =  138 bits (348), Expect = 8e-33
 Identities = 98/289 (33%), Positives = 139/289 (48%), Gaps = 43/289 (14%)
 Frame = +3

Query: 156 GKVAVVTGANTGIGKETAKELAKRGARVYLACRDVQKGESVAREIQNMTGNQQVLVRKLD 335
           GKV +VTGAN+GIG ETAK  A  GA V LACR++ +       I       +V    LD
Sbjct: 124 GKVVLVTGANSGIGFETAKSFALHGAHVILACRNLSRASEAVSRILEEWHKAKVEAMTLD 183

Query: 336 LADTKSIRAFAKGFLAEEKHLHILINNAGVMMCPYSKTADGFETHMGVNXXXXXXXXXXX 515
           LA  +S++ FA+ F A+   LH+L+ NAG    P+  T DG ET   VN           
Sbjct: 184 LAVLRSVQHFAEAFKAKNVSLHVLVCNAGTFALPWGLTKDGLETTFQVNHLGHFYLVQLL 243

Query: 516 XXXXKESAPSRVVNVSSLAHHMGRIH---------------------------------F 596
                 S+P+RV+ VSS +H    I+                                 F
Sbjct: 244 QDVLCRSSPARVIVVSSESHRFTDINDSSGKLDLSRLSPPRSDYWAMLAYNRSKLCNILF 303

Query: 597 HN-----LQGSGVTTYSVHPGT-VDSELVRHSSLLRWIWWLFSFFXQTPQQGAQTSLYCA 758
            N     L   GVT+ +VHPG  + S + R+S + + ++ L   F ++ QQGA T++YCA
Sbjct: 304 SNELHRRLSPRGVTSNAVHPGNMMYSAIHRNSWVYKLLFTLARPFTKSMQQGAATTVYCA 363

Query: 759 LXEGLEVLSGKHFSDCHVAWVSAQARNETVARRLWDVS----CDLLGIP 893
           +   LE L G +F++C     S +A++E  AR LW++S     D LG P
Sbjct: 364 VAPELEGLGGMYFNNCCRCLPSEEAQSEETARALWELSERLIQDRLGSP 412


>ref|NP_899109.1| hypothetical protein LOC70451 [Mus musculus]
          Length = 260

 Score =  138 bits (347), Expect = 1e-32
 Identities = 89/230 (38%), Positives = 119/230 (51%), Gaps = 38/230 (16%)
 Frame = +3

Query: 132 CTSTVQLPGKVAVVTGANTGIGKETAKELAKRGARVYLACRDVQKGESVAREIQNMTGNQ 311
           C     L G+  VVTGAN+GIGK TA ELA+RGARV LACR  ++GE+ A +++  +GN 
Sbjct: 28  CGGIGSLRGRTVVVTGANSGIGKMTALELARRGARVVLACRSRERGEAAAFDLRQESGNN 87

Query: 312 QVLVRKLDLADTKSIRAFAKGFLAEEKHLHILINNAGVMMCPYSKTADGFETHMGVNXXX 491
           +V+   LDLA   S++AFA  FL+ E  L +LI+NAG+  C   +T + F   + VN   
Sbjct: 88  EVIFMALDLASLASVQAFATAFLSSEPRLDVLIHNAGISSC--GRTRETFNLLLRVNHVG 145

Query: 492 XXXXXXXXXXXXKESAPSRVVNVSSLAHHMGRIHF------------------------- 596
                       +  APSRVV VSS AH  GR+ F                         
Sbjct: 146 PFLLTHLLLPRLRSCAPSRVVIVSSAAHRRGRLDFTRLDCPVVGWQQELRAYADSKLANV 205

Query: 597 -------HNLQGSGVTTYSVHPGTVDSEL-VRH-----SSLLRWIWWLFS 707
                    L+G+GVT Y+ HPG V+SEL +RH       +LR + WL S
Sbjct: 206 LFARELATQLEGTGVTCYAAHPGPVNSELFLRHLRGWLRPILRPLAWLCS 255


>ref|NP_079798.1| retinal short-chain dehydrogenase/reductase 4 [Mus musculus]
          Length = 288

 Score = 65.1 bits (157), Expect = 1e-10
 Identities = 59/195 (30%), Positives = 87/195 (44%), Gaps = 24/195 (12%)
 Frame = +3

Query: 162 VAVVTGANTGIGKETAKELAKRGARVYLACRDVQKGESVAREIQNMTGN---QQVLVRKL 332
           V  VTGA++GIG+E A +L+K G  + L+ R  Q+ E V R      GN   + +LV  L
Sbjct: 2   VVWVTGASSGIGEELAFQLSKLGVSLVLSARRAQELERVKRRCLE-NGNLKEKDILVLPL 60

Query: 333 DLADTKSIRAFAKGFLAEEKHLHILINNAG--VMMCPYSKTADGFETHMGVNXXXXXXXX 506
           DL DT S  A  K  L E   + IL+NN G            D F+  + +N        
Sbjct: 61  DLTDTSSHEAATKAVLQEFGKIDILVNNGGRSQRSLVLETNLDVFKELINLNYIGTVSLT 120

Query: 507 XXXXXXXKESAPSRVVNVSSLA--------------HHMGRIHFHNL-----QGSGVTTY 629
                   E    ++V V+S+A               H  R  F+ L     Q  G+T  
Sbjct: 121 KCVLPHMIERKQGKIVTVNSIAGIASVSLSSGYCASKHALRGFFNALHSELGQYPGITFC 180

Query: 630 SVHPGTVDSELVRHS 674
           +V+PG V S++V+++
Sbjct: 181 NVYPGPVQSDIVKNA 195


>ref|NP_663403.1| hypothetical protein LOC216820 [Mus musculus]
          Length = 323

 Score = 58.5 bits (140), Expect = 1e-08
 Identities = 38/98 (38%), Positives = 54/98 (55%), Gaps = 2/98 (2%)
 Frame = +3

Query: 138 STVQLPGKVAVVTGANTGIGKETAKELAKRGARVYLACRDVQKGESVAREIQNMTGNQ-- 311
           S   L   V VVTGA +G+G+E AK     GA++ L  R+V+  E ++RE+   +  Q  
Sbjct: 46  SKAYLRNAVVVVTGATSGLGRECAKVFHAAGAKLVLCGRNVKALEELSRELAGSSQGQTH 105

Query: 312 QVLVRKLDLADTKSIRAFAKGFLAEEKHLHILINNAGV 425
           Q  V   DLAD  +I A A   L    ++ +LINNAG+
Sbjct: 106 QPFVVTFDLADPGTIAAAAAEILQCFGYVDVLINNAGI 143


>ref|NP_032304.1| hydroxyprostaglandin dehydrogenase 15 (NAD) [Mus musculus]
          Length = 266

 Score = 55.1 bits (131), Expect = 1e-07
 Identities = 34/90 (37%), Positives = 48/90 (53%)
 Frame = +3

Query: 156 GKVAVVTGANTGIGKETAKELAKRGARVYLACRDVQKGESVAREIQNMTGNQQVLVRKLD 335
           GKVA+VTGA  GIGK  A+ L   GA+V L   +++ G      +      Q+ L  + D
Sbjct: 5   GKVALVTGAAQGIGKAFAEALLLHGAKVALVDWNLEAGVKCKAALDEQFEPQKTLFVQCD 64

Query: 336 LADTKSIRAFAKGFLAEEKHLHILINNAGV 425
           +AD K +R   +  +     L IL+NNAGV
Sbjct: 65  VADQKQLRDTFRKVVDHFGRLDILVNNAGV 94


  Database: RefSeqMP
    Posted date:  Aug 2, 2006 12:58 AM
  Number of letters in database: 21,768,885
  Number of sequences in database:  45,328
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 47,643,201
Number of Sequences: 45328
Number of extensions: 1278513
Number of successful extensions: 3419
Number of sequences better than 1.0e-05: 10
Number of HSP's better than  0.0 without gapping: 3128
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3392
length of database: 21,768,885
effective HSP length: 104
effective length of database: 17,054,773
effective search space used: 3888488244
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)