Animal-Genome cDNA 20060611S-013913


Search to RefSeqSP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611S-013913
         (1039 letters)

Database: RefSeqSP 
           1040 sequences; 434,620 total letters

Searching...done

 ***** No hits found ******

  Database: RefSeqSP
    Posted date:  Aug 1, 2006  7:14 PM
  Number of letters in database: 434,620
  Number of sequences in database:  1040
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 619,245
Number of Sequences: 1040
Number of extensions: 11774
Number of successful extensions: 24
Number of sequences better than 1.0e-05: 0
Number of HSP's better than  0.0 without gapping: 24
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 24
length of database: 434,620
effective HSP length: 77
effective length of database: 354,540
effective search space used: 95016720
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqBP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611S-013913
         (1039 letters)

Database: RefSeqBP 
           33,508 sequences; 16,112,626 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_776447.1| clathrin, light polypeptide (Lca) [Bos taurus]       111   1e-24
Alignment   gi|NP_776702.1| clathrin, light polypeptide B (light chain B) [...    58   1e-08

>ref|NP_776447.1| clathrin, light polypeptide (Lca) [Bos taurus]
          Length = 243

 Score =  111 bits (277), Expect = 1e-24
 Identities = 59/83 (71%), Positives = 62/83 (74%), Gaps = 1/83 (1%)
 Frame = +2

Query: 68  MADLDPFGAPAG-PSLGNGVAGEEDPAAAFLAQQESEIAGIENDEAFAILDXXXXXXXXX 244
           MA+LDPFG PAG P+LGNGVAGEEDPAAAFLAQQESEIAGIENDEAFAILD         
Sbjct: 1   MAELDPFGVPAGGPALGNGVAGEEDPAAAFLAQQESEIAGIENDEAFAILDGGAPGSQPH 60

Query: 245 XXXXXXXDAVDGVMNGEYYQVQN 313
                  DAVDGV NG+YYQ  N
Sbjct: 61  GEPPGIPDAVDGVTNGDYYQESN 83


>ref|NP_776702.1| clathrin, light polypeptide B (light chain B) [Bos taurus]
          Length = 210

 Score = 58.2 bits (139), Expect = 1e-08
 Identities = 33/78 (42%), Positives = 39/78 (50%)
 Frame = +2

Query: 80  DPFGAPAGPSLGNGVAGEEDPAAAFLAQQESEIAGIENDEAFAILDXXXXXXXXXXXXXX 259
           D FG  +    G   A EEDPAAAFLAQQESEIAGIENDE F                  
Sbjct: 3   DDFGFFSSSESGAPEAAEEDPAAAFLAQQESEIAGIENDEGFGAPAGSQGGLAQPGPASG 62

Query: 260 XXDAVDGVMNGEYYQVQN 313
             + +   +NG+ +Q  N
Sbjct: 63  ASEDMGATVNGDVFQEAN 80


  Database: RefSeqBP
    Posted date:  Aug 1, 2006  7:14 PM
  Number of letters in database: 16,112,626
  Number of sequences in database:  33,508
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 22,962,842
Number of Sequences: 33508
Number of extensions: 439527
Number of successful extensions: 1466
Number of sequences better than 1.0e-05: 2
Number of HSP's better than  0.0 without gapping: 1365
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1464
length of database: 16,112,626
effective HSP length: 102
effective length of database: 12,694,810
effective search space used: 3084838830
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqHP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611S-013913
         (1039 letters)

Database: RefSeqHP 
           39,411 sequences; 17,774,539 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_001824.1| clathrin, light polypeptide A isoform a [Homo s...   109   4e-24
Alignment   gi|NP_009027.1| clathrin, light polypeptide A isoform b [Homo s...   109   4e-24
Alignment   gi|NP_009028.1| clathrin, light polypeptide isoform b [Homo sap...    55   7e-08
Alignment   gi|NP_001825.1| clathrin, light polypeptide isoform a [Homo sap...    55   7e-08

>ref|NP_001824.1| clathrin, light polypeptide A isoform a [Homo sapiens]
          Length = 218

 Score =  109 bits (272), Expect = 4e-24
 Identities = 62/88 (70%), Positives = 64/88 (72%), Gaps = 6/88 (6%)
 Frame = +2

Query: 68  MADLDPFGAPAG----PSLGNGVAG--EEDPAAAFLAQQESEIAGIENDEAFAILDXXXX 229
           MA+LDPFGAPAG    P+LGNGVAG  EEDPAAAFLAQQESEIAGIENDEAFAILD    
Sbjct: 1   MAELDPFGAPAGAPGGPALGNGVAGAGEEDPAAAFLAQQESEIAGIENDEAFAILDGGAP 60

Query: 230 XXXXXXXXXXXXDAVDGVMNGEYYQVQN 313
                       DAVDGVMNGEYYQ  N
Sbjct: 61  GPQPHGEPPGGPDAVDGVMNGEYYQESN 88


>ref|NP_009027.1| clathrin, light polypeptide A isoform b [Homo sapiens]
          Length = 248

 Score =  109 bits (272), Expect = 4e-24
 Identities = 62/88 (70%), Positives = 64/88 (72%), Gaps = 6/88 (6%)
 Frame = +2

Query: 68  MADLDPFGAPAG----PSLGNGVAG--EEDPAAAFLAQQESEIAGIENDEAFAILDXXXX 229
           MA+LDPFGAPAG    P+LGNGVAG  EEDPAAAFLAQQESEIAGIENDEAFAILD    
Sbjct: 1   MAELDPFGAPAGAPGGPALGNGVAGAGEEDPAAAFLAQQESEIAGIENDEAFAILDGGAP 60

Query: 230 XXXXXXXXXXXXDAVDGVMNGEYYQVQN 313
                       DAVDGVMNGEYYQ  N
Sbjct: 61  GPQPHGEPPGGPDAVDGVMNGEYYQESN 88


>ref|NP_009028.1| clathrin, light polypeptide isoform b [Homo sapiens]
          Length = 229

 Score = 55.5 bits (132), Expect = 7e-08
 Identities = 29/42 (69%), Positives = 30/42 (71%)
 Frame = +2

Query: 80  DPFGAPAGPSLGNGVAGEEDPAAAFLAQQESEIAGIENDEAF 205
           D FG  +    G   A EEDPAAAFLAQQESEIAGIENDE F
Sbjct: 3   DDFGFFSSSESGAPEAAEEDPAAAFLAQQESEIAGIENDEGF 44


>ref|NP_001825.1| clathrin, light polypeptide isoform a [Homo sapiens]
          Length = 211

 Score = 55.5 bits (132), Expect = 7e-08
 Identities = 29/42 (69%), Positives = 30/42 (71%)
 Frame = +2

Query: 80  DPFGAPAGPSLGNGVAGEEDPAAAFLAQQESEIAGIENDEAF 205
           D FG  +    G   A EEDPAAAFLAQQESEIAGIENDE F
Sbjct: 3   DDFGFFSSSESGAPEAAEEDPAAAFLAQQESEIAGIENDEGF 44


  Database: RefSeqHP
    Posted date:  Aug 2, 2006 12:57 AM
  Number of letters in database: 17,774,539
  Number of sequences in database:  39,411
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 25,854,027
Number of Sequences: 39411
Number of extensions: 501195
Number of successful extensions: 1689
Number of sequences better than 1.0e-05: 4
Number of HSP's better than  0.0 without gapping: 1568
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1683
length of database: 17,774,539
effective HSP length: 103
effective length of database: 13,715,206
effective search space used: 3319079852
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqMP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611S-013913
         (1039 letters)

Database: RefSeqMP 
           45,328 sequences; 21,768,885 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_058040.1| clathrin, light polypeptide (Lca) [Mus musculus]     103   4e-22
Alignment   gi|NP_083146.1| clathrin, light polypeptide (Lcb) [Mus musculus]      52   1e-06

>ref|NP_058040.1| clathrin, light polypeptide (Lca) [Mus musculus]
          Length = 235

 Score =  103 bits (256), Expect = 4e-22
 Identities = 59/88 (67%), Positives = 62/88 (70%), Gaps = 6/88 (6%)
 Frame = +2

Query: 68  MADLDPFG----APAGPSLGNGVAG--EEDPAAAFLAQQESEIAGIENDEAFAILDXXXX 229
           MA+LDPFG    AP GP+LGNGVAG  EEDPAAAFLA +ESEIAGIENDEAFAILD    
Sbjct: 1   MAELDPFGDPAGAPGGPALGNGVAGAGEEDPAAAFLAHEESEIAGIENDEAFAILD-GGA 59

Query: 230 XXXXXXXXXXXXDAVDGVMNGEYYQVQN 313
                       DAVDGVMNGEYYQ  N
Sbjct: 60  PGRATRRAGGGPDAVDGVMNGEYYQESN 87


>ref|NP_083146.1| clathrin, light polypeptide (Lcb) [Mus musculus]
          Length = 211

 Score = 52.0 bits (123), Expect = 1e-06
 Identities = 32/79 (40%), Positives = 39/79 (49%), Gaps = 1/79 (1%)
 Frame = +2

Query: 80  DPFGAPAGPSLGNGVAGEEDPAAAFLAQQESEIAGIENDEAF-AILDXXXXXXXXXXXXX 256
           + FG  +    G   A EEDPAAAFLAQQESEIAGIEND  F A                
Sbjct: 3   EDFGFFSSSESGAPEAAEEDPAAAFLAQQESEIAGIENDPGFGAPAASQVASAQPGLASG 62

Query: 257 XXXDAVDGVMNGEYYQVQN 313
              + +   +NG+ +Q  N
Sbjct: 63  AGSEDMSTTVNGDVFQEAN 81


  Database: RefSeqMP
    Posted date:  Aug 2, 2006 12:58 AM
  Number of letters in database: 21,768,885
  Number of sequences in database:  45,328
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 30,636,943
Number of Sequences: 45328
Number of extensions: 578448
Number of successful extensions: 1851
Number of sequences better than 1.0e-05: 2
Number of HSP's better than  0.0 without gapping: 1744
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1848
length of database: 21,768,885
effective HSP length: 104
effective length of database: 17,054,773
effective search space used: 4110200293
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqCP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611S-013913
         (1039 letters)

Database: RefSeqCP 
           33,732 sequences; 19,266,565 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|XP_866825.1| PREDICTED: similar to Clathrin light chain A (L...   109   5e-24
Alignment   gi|XP_866787.1| PREDICTED: similar to clathrin, light polypepti...   109   5e-24
Alignment   gi|XP_531996.2| PREDICTED: similar to Clathrin light chain A (L...   109   5e-24
Alignment   gi|XP_866761.1| PREDICTED: similar to Clathrin light chain A (L...   109   5e-24
Alignment   gi|XP_866812.1| PREDICTED: similar to Clathrin light chain A (L...    89   9e-18
Alignment   gi|XP_866801.1| PREDICTED: similar to Clathrin light chain A (L...    89   9e-18
Alignment   gi|XP_866066.1| PREDICTED: similar to clathrin, light polypepti...    56   5e-08
Alignment   gi|XP_866115.1| PREDICTED: similar to clathrin, light polypepti...    55   9e-08
Alignment   gi|XP_546220.2| PREDICTED: similar to Clathrin light chain B (L...    55   9e-08
Alignment   gi|XP_866083.1| PREDICTED: similar to clathrin, light polypepti...    55   9e-08

>ref|XP_866825.1| PREDICTED: similar to Clathrin light chain A (Lca) isoform 6 [Canis
           familiaris]
          Length = 230

 Score =  109 bits (272), Expect = 5e-24
 Identities = 62/88 (70%), Positives = 64/88 (72%), Gaps = 6/88 (6%)
 Frame = +2

Query: 68  MADLDPFGAPA----GPSLGNGVAG--EEDPAAAFLAQQESEIAGIENDEAFAILDXXXX 229
           MA+LDPFGAPA    GP+LGNGVAG  EEDPAAAFLAQQESEIAGIENDEAFAILD    
Sbjct: 1   MAELDPFGAPASAPGGPALGNGVAGAGEEDPAAAFLAQQESEIAGIENDEAFAILDGGAP 60

Query: 230 XXXXXXXXXXXXDAVDGVMNGEYYQVQN 313
                       DAVDGVMNGEYYQ  N
Sbjct: 61  GPQPHGEPPGVPDAVDGVMNGEYYQESN 88


>ref|XP_866787.1| PREDICTED: similar to clathrin, light polypeptide A isoform a
           isoform 3 [Canis familiaris]
          Length = 218

 Score =  109 bits (272), Expect = 5e-24
 Identities = 62/88 (70%), Positives = 64/88 (72%), Gaps = 6/88 (6%)
 Frame = +2

Query: 68  MADLDPFGAPA----GPSLGNGVAG--EEDPAAAFLAQQESEIAGIENDEAFAILDXXXX 229
           MA+LDPFGAPA    GP+LGNGVAG  EEDPAAAFLAQQESEIAGIENDEAFAILD    
Sbjct: 1   MAELDPFGAPASAPGGPALGNGVAGAGEEDPAAAFLAQQESEIAGIENDEAFAILDGGAP 60

Query: 230 XXXXXXXXXXXXDAVDGVMNGEYYQVQN 313
                       DAVDGVMNGEYYQ  N
Sbjct: 61  GPQPHGEPPGVPDAVDGVMNGEYYQESN 88


>ref|XP_531996.2| PREDICTED: similar to Clathrin light chain A (Lca) isoform 1 [Canis
           familiaris]
          Length = 248

 Score =  109 bits (272), Expect = 5e-24
 Identities = 62/88 (70%), Positives = 64/88 (72%), Gaps = 6/88 (6%)
 Frame = +2

Query: 68  MADLDPFGAPA----GPSLGNGVAG--EEDPAAAFLAQQESEIAGIENDEAFAILDXXXX 229
           MA+LDPFGAPA    GP+LGNGVAG  EEDPAAAFLAQQESEIAGIENDEAFAILD    
Sbjct: 1   MAELDPFGAPASAPGGPALGNGVAGAGEEDPAAAFLAQQESEIAGIENDEAFAILDGGAP 60

Query: 230 XXXXXXXXXXXXDAVDGVMNGEYYQVQN 313
                       DAVDGVMNGEYYQ  N
Sbjct: 61  GPQPHGEPPGVPDAVDGVMNGEYYQESN 88


>ref|XP_866761.1| PREDICTED: similar to Clathrin light chain A (Lca) isoform 2 [Canis
           familiaris]
          Length = 236

 Score =  109 bits (272), Expect = 5e-24
 Identities = 62/88 (70%), Positives = 64/88 (72%), Gaps = 6/88 (6%)
 Frame = +2

Query: 68  MADLDPFGAPA----GPSLGNGVAG--EEDPAAAFLAQQESEIAGIENDEAFAILDXXXX 229
           MA+LDPFGAPA    GP+LGNGVAG  EEDPAAAFLAQQESEIAGIENDEAFAILD    
Sbjct: 1   MAELDPFGAPASAPGGPALGNGVAGAGEEDPAAAFLAQQESEIAGIENDEAFAILDGGAP 60

Query: 230 XXXXXXXXXXXXDAVDGVMNGEYYQVQN 313
                       DAVDGVMNGEYYQ  N
Sbjct: 61  GPQPHGEPPGVPDAVDGVMNGEYYQESN 88


>ref|XP_866812.1| PREDICTED: similar to Clathrin light chain A (Lca) isoform 5 [Canis
           familiaris]
          Length = 196

 Score = 88.6 bits (218), Expect = 9e-18
 Identities = 48/56 (85%), Positives = 50/56 (89%), Gaps = 6/56 (10%)
 Frame = +2

Query: 68  MADLDPFGAPA----GPSLGNGVAG--EEDPAAAFLAQQESEIAGIENDEAFAILD 217
           MA+LDPFGAPA    GP+LGNGVAG  EEDPAAAFLAQQESEIAGIENDEAFAILD
Sbjct: 1   MAELDPFGAPASAPGGPALGNGVAGAGEEDPAAAFLAQQESEIAGIENDEAFAILD 56


>ref|XP_866801.1| PREDICTED: similar to Clathrin light chain A (Lca) isoform 4 [Canis
           familiaris]
          Length = 178

 Score = 88.6 bits (218), Expect = 9e-18
 Identities = 48/56 (85%), Positives = 50/56 (89%), Gaps = 6/56 (10%)
 Frame = +2

Query: 68  MADLDPFGAPA----GPSLGNGVAG--EEDPAAAFLAQQESEIAGIENDEAFAILD 217
           MA+LDPFGAPA    GP+LGNGVAG  EEDPAAAFLAQQESEIAGIENDEAFAILD
Sbjct: 1   MAELDPFGAPASAPGGPALGNGVAGAGEEDPAAAFLAQQESEIAGIENDEAFAILD 56


>ref|XP_866066.1| PREDICTED: similar to clathrin, light polypeptide isoform a isoform
           3 [Canis familiaris]
          Length = 207

 Score = 56.2 bits (134), Expect = 5e-08
 Identities = 29/44 (65%), Positives = 31/44 (70%)
 Frame = +2

Query: 80  DPFGAPAGPSLGNGVAGEEDPAAAFLAQQESEIAGIENDEAFAI 211
           D FG  +    G   A EEDPAAAFLAQQESEIAGIENDE F +
Sbjct: 3   DDFGFFSSSESGAPEAAEEDPAAAFLAQQESEIAGIENDEGFGL 46


>ref|XP_866115.1| PREDICTED: similar to clathrin, light polypeptide isoform a isoform
           5 [Canis familiaris]
          Length = 211

 Score = 55.5 bits (132), Expect = 9e-08
 Identities = 29/42 (69%), Positives = 30/42 (71%)
 Frame = +2

Query: 80  DPFGAPAGPSLGNGVAGEEDPAAAFLAQQESEIAGIENDEAF 205
           D FG  +    G   A EEDPAAAFLAQQESEIAGIENDE F
Sbjct: 3   DDFGFFSSSESGAPEAAEEDPAAAFLAQQESEIAGIENDEGF 44


>ref|XP_546220.2| PREDICTED: similar to Clathrin light chain B (Lcb) isoform 1 [Canis
           familiaris]
          Length = 229

 Score = 55.5 bits (132), Expect = 9e-08
 Identities = 29/42 (69%), Positives = 30/42 (71%)
 Frame = +2

Query: 80  DPFGAPAGPSLGNGVAGEEDPAAAFLAQQESEIAGIENDEAF 205
           D FG  +    G   A EEDPAAAFLAQQESEIAGIENDE F
Sbjct: 3   DDFGFFSSSESGAPEAAEEDPAAAFLAQQESEIAGIENDEGF 44


>ref|XP_866083.1| PREDICTED: similar to clathrin, light polypeptide isoform a isoform
           4 [Canis familiaris]
          Length = 213

 Score = 55.5 bits (132), Expect = 9e-08
 Identities = 29/42 (69%), Positives = 30/42 (71%)
 Frame = +2

Query: 80  DPFGAPAGPSLGNGVAGEEDPAAAFLAQQESEIAGIENDEAF 205
           D FG  +    G   A EEDPAAAFLAQQESEIAGIENDE F
Sbjct: 3   DDFGFFSSSESGAPEAAEEDPAAAFLAQQESEIAGIENDEGF 44


  Database: RefSeqCP
    Posted date:  Aug 1, 2006  9:25 PM
  Number of letters in database: 19,266,565
  Number of sequences in database:  33,732
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 27,050,343
Number of Sequences: 33732
Number of extensions: 517794
Number of successful extensions: 1666
Number of sequences better than 1.0e-05: 10
Number of HSP's better than  0.0 without gapping: 1551
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1650
length of database: 19,266,565
effective HSP length: 104
effective length of database: 15,758,437
effective search space used: 3797783317
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)