Animal-Genome cDNA 20060611S-024617


Search to RefSeqSP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611S-024617
         (731 letters)

Database: RefSeqSP 
           1040 sequences; 434,620 total letters

Searching...done

 ***** No hits found ******

  Database: RefSeqSP
    Posted date:  Aug 1, 2006  7:14 PM
  Number of letters in database: 434,620
  Number of sequences in database:  1040
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 627,045
Number of Sequences: 1040
Number of extensions: 14997
Number of successful extensions: 50
Number of sequences better than 1.0e-05: 0
Number of HSP's better than  0.0 without gapping: 49
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 50
length of database: 434,620
effective HSP length: 74
effective length of database: 357,660
effective search space used: 60444540
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqBP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611S-024617
         (731 letters)

Database: RefSeqBP 
           33,508 sequences; 16,112,626 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|XP_604169.2| PREDICTED: similar to malic enzyme 3, NADP(+)-d...   264   1e-74
Alignment   gi|XP_584500.2| PREDICTED: similar to NAD-dependent malic enzym...   233   1e-63
Alignment   gi|XP_613987.2| PREDICTED: similar to NADP-dependent malic enzy...   189   1e-48
Alignment   gi|XP_596455.2| PREDICTED: similar to NADP-dependent malic enzy...   129   2e-34

>ref|XP_604169.2| PREDICTED: similar to malic enzyme 3, NADP(+)-dependent,
           mitochondrial [Bos taurus]
          Length = 564

 Score =  264 bits (675), Expect(2) = 1e-74
 Identities = 120/158 (75%), Positives = 143/158 (90%)
 Frame = +3

Query: 219 LAFTLEERQQLNIHGLLPPCFISQDIQVLRVIKNFERLNSDFDRYLLLMDLQDRNEKLFY 398
           +AFTLEER QL IHGL+PPCF+SQD+Q+LRV++ +ER  SD D+Y++LM LQDRNEKLFY
Sbjct: 1   MAFTLEERLQLGIHGLIPPCFLSQDVQLLRVMRYYERQQSDLDKYIILMTLQDRNEKLFY 60

Query: 399 KVLMSDIEKFMPIVYTPTVGLACQQYSLAFRKPRGLFISIHDRGHVASVLNAWPEDVIKA 578
           +VL SD+EKF+PIVYTPTVGLACQ Y L FR+PRGLFI++HD+GH+A++LN+WPED IKA
Sbjct: 61  RVLTSDVEKFLPIVYTPTVGLACQHYGLTFRRPRGLFITVHDKGHLATMLNSWPEDDIKA 120

Query: 579 VVVTDGERILGLGDLGCNGMGIPVGKMALYTACGGGKP 692
           VVVTDGERILGLGDLGC GMGIPVGK+ALYTACGG  P
Sbjct: 121 VVVTDGERILGLGDLGCYGMGIPVGKLALYTACGGVNP 158



 Score = 34.3 bits (77), Expect(2) = 1e-74
 Identities = 13/16 (81%), Positives = 16/16 (100%)
 Frame = +1

Query: 682 GVNPQECLPVILDVGT 729
           GVNP++CLPV+LDVGT
Sbjct: 155 GVNPRQCLPVLLDVGT 170


>ref|XP_584500.2| PREDICTED: similar to NAD-dependent malic enzyme, mitochondrial
           precursor (NAD-ME) (Malic enzyme 2), partial [Bos
           taurus]
          Length = 513

 Score =  233 bits (594), Expect(2) = 1e-63
 Identities = 111/183 (60%), Positives = 138/183 (75%)
 Frame = +3

Query: 150 APRRRHTLQRGYAVTRIPHLNKDLAFTLEERQQLNIHGLLPPCFISQDIQVLRVIKNFER 329
           A R  HT ++G  +   P  NK +AFTL+ERQ L + GLLPP   +QDIQ LR  +N ++
Sbjct: 90  ACRHLHTKEKGKPLMLNPRTNKGMAFTLQERQMLGLQGLLPPKIETQDIQALRFHRNLKK 149

Query: 330 LNSDFDRYLLLMDLQDRNEKLFYKVLMSDIEKFMPIVYTPTVGLACQQYSLAFRKPRGLF 509
           LN   ++Y+ +M +Q+RNEKLFY++L  DIE  MPIVYTPTVGLAC QY   FR+P+GLF
Sbjct: 150 LNGPLEKYIYIMGIQERNEKLFYRILQDDIETLMPIVYTPTVGLACSQYGHIFRRPKGLF 209

Query: 510 ISIHDRGHVASVLNAWPEDVIKAVVVTDGERILGLGDLGCNGMGIPVGKMALYTACGGGK 689
           ISI DRGHV S+++ WPE+ +KAVVVTDGERILGLGDLG  GMGIPVGK+ LYTAC G +
Sbjct: 210 ISISDRGHVRSIVDNWPENHVKAVVVTDGERILGLGDLGVYGMGIPVGKLCLYTACAGIR 269

Query: 690 PPR 698
           P R
Sbjct: 270 PDR 272



 Score = 28.5 bits (62), Expect(2) = 1e-63
 Identities = 10/16 (62%), Positives = 12/16 (75%)
 Frame = +1

Query: 682 GVNPQECLPVILDVGT 729
           G+ P  CLPV +DVGT
Sbjct: 267 GIRPDRCLPVCIDVGT 282


>ref|XP_613987.2| PREDICTED: similar to NADP-dependent malic enzyme (NADP-ME) (Malic
           enzyme 1) [Bos taurus]
          Length = 472

 Score =  189 bits (481), Expect = 1e-48
 Identities = 95/109 (87%), Positives = 100/109 (91%), Gaps = 8/109 (7%)
 Frame = +3

Query: 216 DLAFTLEERQQLNIHGLLPPCFISQDIQVLRVIKNFERLNSDFDRYLLLMDLQDRNEKLF 395
           DLAFTLEERQQLNIHGLLPP FISQD+QVLRV+KNFERLNSDFDRYLLLMDLQDRNEKLF
Sbjct: 14  DLAFTLEERQQLNIHGLLPPSFISQDVQVLRVLKNFERLNSDFDRYLLLMDLQDRNEKLF 73

Query: 396 YKVLMSDIEKFMPIVYTPTVGLACQQYSLAFRKPR--------GLFISI 518
           YKVLMSDIEKFMPIVYTPTVGLACQQYSLAFRKPR        GLF+++
Sbjct: 74  YKVLMSDIEKFMPIVYTPTVGLACQQYSLAFRKPRFNVLVTSYGLFLNV 122


>ref|XP_596455.2| PREDICTED: similar to NADP-dependent malic enzyme (NADP-ME) (Malic
           enzyme 1) [Bos taurus]
          Length = 157

 Score =  129 bits (325), Expect(2) = 2e-34
 Identities = 59/65 (90%), Positives = 63/65 (96%)
 Frame = +3

Query: 498 RGLFISIHDRGHVASVLNAWPEDVIKAVVVTDGERILGLGDLGCNGMGIPVGKMALYTAC 677
           RGLFISIHDRGH++SVLNAWPEDVIKA+VVTDGERILGLGDLGCNGMGIPVGK+ALYTAC
Sbjct: 72  RGLFISIHDRGHISSVLNAWPEDVIKAIVVTDGERILGLGDLGCNGMGIPVGKLALYTAC 131

Query: 678 GGGKP 692
           GG  P
Sbjct: 132 GGMNP 136



 Score = 34.3 bits (77), Expect(2) = 2e-34
 Identities = 13/16 (81%), Positives = 16/16 (100%)
 Frame = +1

Query: 682 GVNPQECLPVILDVGT 729
           G+NPQ+CLPV+LDVGT
Sbjct: 133 GMNPQQCLPVMLDVGT 148


  Database: RefSeqBP
    Posted date:  Aug 1, 2006  7:14 PM
  Number of letters in database: 16,112,626
  Number of sequences in database:  33,508
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 23,326,760
Number of Sequences: 33508
Number of extensions: 563501
Number of successful extensions: 2169
Number of sequences better than 1.0e-05: 4
Number of HSP's better than  0.0 without gapping: 1994
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2163
length of database: 16,112,626
effective HSP length: 99
effective length of database: 12,795,334
effective search space used: 1842528096
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqHP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611S-024617
         (731 letters)

Database: RefSeqHP 
           39,411 sequences; 17,774,539 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_002386.1| cytosolic malic enzyme 1 [Homo sapiens]              345   2e-99
Alignment   gi|NP_001014811.1| malic enzyme 3, NADP(+)-dependent, mitochond...   288   3e-82
Alignment   gi|NP_006671.2| malic enzyme 3, NADP(+)-dependent, mitochondria...   288   3e-82
Alignment   gi|NP_002387.1| malic enzyme 2, NAD(+)-dependent, mitochondrial...   229   1e-62
Alignment   gi|XP_934770.1| PREDICTED: similar to NAD-dependent malic enzym...   160   1e-39
Alignment   gi|XP_944182.1| PREDICTED: similar to NAD-dependent malic enzym...   160   1e-39

>ref|NP_002386.1| cytosolic malic enzyme 1 [Homo sapiens]
          Length = 572

 Score =  345 bits (884), Expect(2) = 2e-99
 Identities = 166/185 (89%), Positives = 174/185 (94%)
 Frame = +3

Query: 138 MEPRAPRRRHTLQRGYAVTRIPHLNKDLAFTLEERQQLNIHGLLPPCFISQDIQVLRVIK 317
           MEP APRRRHT QRGY +TR PHLNKDLAFTLEERQQLNIHGLLPP F SQ+IQVLRV+K
Sbjct: 1   MEPEAPRRRHTHQRGYLLTRNPHLNKDLAFTLEERQQLNIHGLLPPSFNSQEIQVLRVVK 60

Query: 318 NFERLNSDFDRYLLLMDLQDRNEKLFYKVLMSDIEKFMPIVYTPTVGLACQQYSLAFRKP 497
           NFE LNSDFDRYLLLMDLQDRNEKLFY+VL SDIEKFMPIVYTPTVGLACQQYSL FRKP
Sbjct: 61  NFEHLNSDFDRYLLLMDLQDRNEKLFYRVLTSDIEKFMPIVYTPTVGLACQQYSLVFRKP 120

Query: 498 RGLFISIHDRGHVASVLNAWPEDVIKAVVVTDGERILGLGDLGCNGMGIPVGKMALYTAC 677
           RGLFI+IHDRGH+ASVLNAWPEDVIKA+VVTDGERILGLGDLGCNGMGIPVGK+ALYTAC
Sbjct: 121 RGLFITIHDRGHIASVLNAWPEDVIKAIVVTDGERILGLGDLGCNGMGIPVGKLALYTAC 180

Query: 678 GGGKP 692
           GG  P
Sbjct: 181 GGMNP 185



 Score = 36.6 bits (83), Expect(2) = 2e-99
 Identities = 15/16 (93%), Positives = 16/16 (100%)
 Frame = +1

Query: 682 GVNPQECLPVILDVGT 729
           G+NPQECLPVILDVGT
Sbjct: 182 GMNPQECLPVILDVGT 197


>ref|NP_001014811.1| malic enzyme 3, NADP(+)-dependent, mitochondrial [Homo sapiens]
          Length = 604

 Score =  288 bits (737), Expect(2) = 3e-82
 Identities = 138/202 (68%), Positives = 166/202 (82%)
 Frame = +3

Query: 87  GSIRPLSPVPPRQRQPAMEPRAPRRRHTLQRGYAVTRIPHLNKDLAFTLEERQQLNIHGL 266
           G++   +P  P Q   + +P   R     +RGY VTR PHLNK +AFTLEER QL IHGL
Sbjct: 20  GALPRWTPTAPAQGCHS-KPGPARPVPLKKRGYDVTRNPHLNKGMAFTLEERLQLGIHGL 78

Query: 267 LPPCFISQDIQVLRVIKNFERLNSDFDRYLLLMDLQDRNEKLFYKVLMSDIEKFMPIVYT 446
           +PPCF+SQD+Q+LR+++ +ER  SD D+Y++LM LQDRNEKLFY+VL SD+EKFMPIVYT
Sbjct: 79  IPPCFLSQDVQLLRIMRYYERQQSDLDKYIILMTLQDRNEKLFYRVLTSDVEKFMPIVYT 138

Query: 447 PTVGLACQQYSLAFRKPRGLFISIHDRGHVASVLNAWPEDVIKAVVVTDGERILGLGDLG 626
           PTVGLACQ Y L FR+PRGLFI+IHD+GH+A++LN+WPED IKAVVVTDGERILGLGDLG
Sbjct: 139 PTVGLACQHYGLTFRRPRGLFITIHDKGHLATMLNSWPEDNIKAVVVTDGERILGLGDLG 198

Query: 627 CNGMGIPVGKMALYTACGGGKP 692
           C GMGIPVGK+ALYTACGG  P
Sbjct: 199 CYGMGIPVGKLALYTACGGVNP 220



 Score = 35.8 bits (81), Expect(2) = 3e-82
 Identities = 14/16 (87%), Positives = 16/16 (100%)
 Frame = +1

Query: 682 GVNPQECLPVILDVGT 729
           GVNPQ+CLPV+LDVGT
Sbjct: 217 GVNPQQCLPVLLDVGT 232


>ref|NP_006671.2| malic enzyme 3, NADP(+)-dependent, mitochondrial [Homo sapiens]
          Length = 604

 Score =  288 bits (737), Expect(2) = 3e-82
 Identities = 138/202 (68%), Positives = 166/202 (82%)
 Frame = +3

Query: 87  GSIRPLSPVPPRQRQPAMEPRAPRRRHTLQRGYAVTRIPHLNKDLAFTLEERQQLNIHGL 266
           G++   +P  P Q   + +P   R     +RGY VTR PHLNK +AFTLEER QL IHGL
Sbjct: 20  GALPRWTPTAPAQGCHS-KPGPARPVPLKKRGYDVTRNPHLNKGMAFTLEERLQLGIHGL 78

Query: 267 LPPCFISQDIQVLRVIKNFERLNSDFDRYLLLMDLQDRNEKLFYKVLMSDIEKFMPIVYT 446
           +PPCF+SQD+Q+LR+++ +ER  SD D+Y++LM LQDRNEKLFY+VL SD+EKFMPIVYT
Sbjct: 79  IPPCFLSQDVQLLRIMRYYERQQSDLDKYIILMTLQDRNEKLFYRVLTSDVEKFMPIVYT 138

Query: 447 PTVGLACQQYSLAFRKPRGLFISIHDRGHVASVLNAWPEDVIKAVVVTDGERILGLGDLG 626
           PTVGLACQ Y L FR+PRGLFI+IHD+GH+A++LN+WPED IKAVVVTDGERILGLGDLG
Sbjct: 139 PTVGLACQHYGLTFRRPRGLFITIHDKGHLATMLNSWPEDNIKAVVVTDGERILGLGDLG 198

Query: 627 CNGMGIPVGKMALYTACGGGKP 692
           C GMGIPVGK+ALYTACGG  P
Sbjct: 199 CYGMGIPVGKLALYTACGGVNP 220



 Score = 35.8 bits (81), Expect(2) = 3e-82
 Identities = 14/16 (87%), Positives = 16/16 (100%)
 Frame = +1

Query: 682 GVNPQECLPVILDVGT 729
           GVNPQ+CLPV+LDVGT
Sbjct: 217 GVNPQQCLPVLLDVGT 232


>ref|NP_002387.1| malic enzyme 2, NAD(+)-dependent, mitochondrial [Homo sapiens]
          Length = 584

 Score =  229 bits (585), Expect(2) = 1e-62
 Identities = 109/183 (59%), Positives = 137/183 (74%)
 Frame = +3

Query: 150 APRRRHTLQRGYAVTRIPHLNKDLAFTLEERQQLNIHGLLPPCFISQDIQVLRVIKNFER 329
           A R  H  ++G  +   P  NK +AFTL+ERQ L + GLLPP   +QDIQ LR  +N ++
Sbjct: 15  ACRHLHIKEKGKPLMLNPRTNKGMAFTLQERQMLGLQGLLPPKIETQDIQALRFHRNLKK 74

Query: 330 LNSDFDRYLLLMDLQDRNEKLFYKVLMSDIEKFMPIVYTPTVGLACQQYSLAFRKPRGLF 509
           + S  ++Y+ +M +Q+RNEKLFY++L  DIE  MPIVYTPTVGLAC QY   FR+P+GLF
Sbjct: 75  MTSPLEKYIYIMGIQERNEKLFYRILQDDIESLMPIVYTPTVGLACSQYGHIFRRPKGLF 134

Query: 510 ISIHDRGHVASVLNAWPEDVIKAVVVTDGERILGLGDLGCNGMGIPVGKMALYTACGGGK 689
           ISI DRGHV S+++ WPE+ +KAVVVTDGERILGLGDLG  GMGIPVGK+ LYTAC G +
Sbjct: 135 ISISDRGHVRSIVDNWPENHVKAVVVTDGERILGLGDLGVYGMGIPVGKLCLYTACAGIR 194

Query: 690 PPR 698
           P R
Sbjct: 195 PDR 197



 Score = 28.5 bits (62), Expect(2) = 1e-62
 Identities = 10/16 (62%), Positives = 12/16 (75%)
 Frame = +1

Query: 682 GVNPQECLPVILDVGT 729
           G+ P  CLPV +DVGT
Sbjct: 192 GIRPDRCLPVCIDVGT 207


>ref|XP_934770.1| PREDICTED: similar to NAD-dependent malic enzyme, mitochondrial
           precursor (NAD-ME) (Malic enzyme 2) [Homo sapiens]
          Length = 196

 Score =  160 bits (405), Expect = 1e-39
 Identities = 74/123 (60%), Positives = 92/123 (74%)
 Frame = +3

Query: 330 LNSDFDRYLLLMDLQDRNEKLFYKVLMSDIEKFMPIVYTPTVGLACQQYSLAFRKPRGLF 509
           + S  + Y+ +M +Q+RN+KLFY++L  D E  MPI YTPTVGL C Q    FR+P+GLF
Sbjct: 1   MTSPSENYIYIMGIQERNDKLFYRILQDDTESLMPIAYTPTVGLVCSQCGHLFRRPKGLF 60

Query: 510 ISIHDRGHVASVLNAWPEDVIKAVVVTDGERILGLGDLGCNGMGIPVGKMALYTACGGGK 689
           ISI DRGHV S+++ WPE+ +KAV+VTDGERILG GDLG  GMGIPVGK+ LYT C G  
Sbjct: 61  ISISDRGHVRSIVDKWPENHVKAVLVTDGERILGHGDLGVYGMGIPVGKICLYTVCPGIW 120

Query: 690 PPR 698
           P R
Sbjct: 121 PDR 123


>ref|XP_944182.1| PREDICTED: similar to NAD-dependent malic enzyme, mitochondrial
           precursor (NAD-ME) (Malic enzyme 2) [Homo sapiens]
          Length = 196

 Score =  160 bits (405), Expect = 1e-39
 Identities = 74/123 (60%), Positives = 92/123 (74%)
 Frame = +3

Query: 330 LNSDFDRYLLLMDLQDRNEKLFYKVLMSDIEKFMPIVYTPTVGLACQQYSLAFRKPRGLF 509
           + S  + Y+ +M +Q+RN+KLFY++L  D E  MPI YTPTVGL C Q    FR+P+GLF
Sbjct: 1   MTSPSENYIYIMGIQERNDKLFYRILQDDTESLMPIAYTPTVGLVCSQCGHLFRRPKGLF 60

Query: 510 ISIHDRGHVASVLNAWPEDVIKAVVVTDGERILGLGDLGCNGMGIPVGKMALYTACGGGK 689
           ISI DRGHV S+++ WPE+ +KAV+VTDGERILG GDLG  GMGIPVGK+ LYT C G  
Sbjct: 61  ISISDRGHVRSIVDKWPENHVKAVLVTDGERILGHGDLGVYGMGIPVGKICLYTVCPGIW 120

Query: 690 PPR 698
           P R
Sbjct: 121 PDR 123


  Database: RefSeqHP
    Posted date:  Aug 2, 2006 12:57 AM
  Number of letters in database: 17,774,539
  Number of sequences in database:  39,411
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 26,508,658
Number of Sequences: 39411
Number of extensions: 653855
Number of successful extensions: 2663
Number of sequences better than 1.0e-05: 6
Number of HSP's better than  0.0 without gapping: 2359
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2653
length of database: 17,774,539
effective HSP length: 99
effective length of database: 13,872,850
effective search space used: 1997690400
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqCP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611S-024617
         (731 letters)

Database: RefSeqCP 
           33,732 sequences; 19,266,565 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|XP_532217.2| PREDICTED: similar to NADP-dependent malic enzy...   313   7e-90
Alignment   gi|XP_848770.1| PREDICTED: similar to malic enzyme 3, NADP(+)-d...   289   5e-82
Alignment   gi|XP_857135.1| PREDICTED: similar to malic enzyme 3, NADP(+)-d...   267   2e-75
Alignment   gi|XP_857227.1| PREDICTED: similar to malic enzyme 3, NADP(+)-d...   267   2e-75
Alignment   gi|XP_857177.1| PREDICTED: similar to malic enzyme 3, NADP(+)-d...   267   2e-75
Alignment   gi|XP_857051.1| PREDICTED: similar to malic enzyme 3, NADP(+)-d...   267   2e-75
Alignment   gi|XP_542269.2| PREDICTED: similar to malic enzyme 3, NADP(+)-d...   253   5e-71
Alignment   gi|XP_849530.1| PREDICTED: similar to NAD-dependent malic enzym...   231   7e-63
Alignment   gi|XP_533402.2| PREDICTED: similar to NAD-dependent malic enzym...   172   2e-45

>ref|XP_532217.2| PREDICTED: similar to NADP-dependent malic enzyme (NADP-ME) (Malic
           enzyme 1) [Canis familiaris]
          Length = 634

 Score =  313 bits (801), Expect(2) = 7e-90
 Identities = 150/160 (93%), Positives = 156/160 (97%)
 Frame = +3

Query: 213 KDLAFTLEERQQLNIHGLLPPCFISQDIQVLRVIKNFERLNSDFDRYLLLMDLQDRNEKL 392
           +DLAFTLEERQQLNIHGLLPPCFISQDIQVLR+IKNFERL SDFDRYLLLMDLQDRNEKL
Sbjct: 88  QDLAFTLEERQQLNIHGLLPPCFISQDIQVLRIIKNFERLTSDFDRYLLLMDLQDRNEKL 147

Query: 393 FYKVLMSDIEKFMPIVYTPTVGLACQQYSLAFRKPRGLFISIHDRGHVASVLNAWPEDVI 572
           FY VLMSD+EKFMPIVYTPTVGLACQQYSLAFRKPRGLFISIHDRGH+ASVLNAWPEDVI
Sbjct: 148 FYSVLMSDLEKFMPIVYTPTVGLACQQYSLAFRKPRGLFISIHDRGHIASVLNAWPEDVI 207

Query: 573 KAVVVTDGERILGLGDLGCNGMGIPVGKMALYTACGGGKP 692
           KA+VVTDGERILGLGDLGCNGMGIPVGK+ALYTACGG  P
Sbjct: 208 KAIVVTDGERILGLGDLGCNGMGIPVGKLALYTACGGMNP 247



 Score = 36.6 bits (83), Expect(2) = 7e-90
 Identities = 15/16 (93%), Positives = 16/16 (100%)
 Frame = +1

Query: 682 GVNPQECLPVILDVGT 729
           G+NPQECLPVILDVGT
Sbjct: 244 GMNPQECLPVILDVGT 259


>ref|XP_848770.1| PREDICTED: similar to malic enzyme 3, NADP(+)-dependent,
           mitochondrial isoform 2 [Canis familiaris]
          Length = 604

 Score =  289 bits (740), Expect(2) = 5e-82
 Identities = 133/173 (76%), Positives = 156/173 (90%)
 Frame = +3

Query: 174 QRGYAVTRIPHLNKDLAFTLEERQQLNIHGLLPPCFISQDIQVLRVIKNFERLNSDFDRY 353
           +RGY VTR PHLNK +AFTLEER QL IHGL+PPCF+SQD+Q+LR+++ +ER  SD D+Y
Sbjct: 48  KRGYDVTRNPHLNKGMAFTLEERLQLGIHGLIPPCFLSQDVQLLRIMRYYERQQSDLDKY 107

Query: 354 LLLMDLQDRNEKLFYKVLMSDIEKFMPIVYTPTVGLACQQYSLAFRKPRGLFISIHDRGH 533
           ++LM LQDRNEKLFY+VL SD+EKFMPIVYTPTVGLACQQY L FR+PRGLFI+IHD+GH
Sbjct: 108 IILMTLQDRNEKLFYRVLTSDVEKFMPIVYTPTVGLACQQYGLTFRRPRGLFITIHDKGH 167

Query: 534 VASVLNAWPEDVIKAVVVTDGERILGLGDLGCNGMGIPVGKMALYTACGGGKP 692
           +A++LN+WPED IKAVVVTDGERILGLGDLGC GMGIPVGK+ALYTACGG  P
Sbjct: 168 LATMLNSWPEDDIKAVVVTDGERILGLGDLGCYGMGIPVGKLALYTACGGVSP 220



 Score = 33.9 bits (76), Expect(2) = 5e-82
 Identities = 13/16 (81%), Positives = 16/16 (100%)
 Frame = +1

Query: 682 GVNPQECLPVILDVGT 729
           GV+PQ+CLPV+LDVGT
Sbjct: 217 GVSPQQCLPVLLDVGT 232


>ref|XP_857135.1| PREDICTED: similar to malic enzyme 3, NADP(+)-dependent,
           mitochondrial isoform 5 [Canis familiaris]
          Length = 573

 Score =  267 bits (683), Expect(2) = 2e-75
 Identities = 122/158 (77%), Positives = 144/158 (91%)
 Frame = +3

Query: 219 LAFTLEERQQLNIHGLLPPCFISQDIQVLRVIKNFERLNSDFDRYLLLMDLQDRNEKLFY 398
           +AFTLEER QL IHGL+PPCF+SQD+Q+LR+++ +ER  SD D+Y++LM LQDRNEKLFY
Sbjct: 1   MAFTLEERLQLGIHGLIPPCFLSQDVQLLRIMRYYERQQSDLDKYIILMTLQDRNEKLFY 60

Query: 399 KVLMSDIEKFMPIVYTPTVGLACQQYSLAFRKPRGLFISIHDRGHVASVLNAWPEDVIKA 578
           +VL SD+EKFMPIVYTPTVGLACQQY L FR+PRGLFI+IHD+GH+A++LN+WPED IKA
Sbjct: 61  RVLTSDVEKFMPIVYTPTVGLACQQYGLTFRRPRGLFITIHDKGHLATMLNSWPEDDIKA 120

Query: 579 VVVTDGERILGLGDLGCNGMGIPVGKMALYTACGGGKP 692
           VVVTDGERILGLGDLGC GMGIPVGK+ALYTACGG  P
Sbjct: 121 VVVTDGERILGLGDLGCYGMGIPVGKLALYTACGGVSP 158



 Score = 33.9 bits (76), Expect(2) = 2e-75
 Identities = 13/16 (81%), Positives = 16/16 (100%)
 Frame = +1

Query: 682 GVNPQECLPVILDVGT 729
           GV+PQ+CLPV+LDVGT
Sbjct: 155 GVSPQQCLPVLLDVGT 170


>ref|XP_857227.1| PREDICTED: similar to malic enzyme 3, NADP(+)-dependent,
           mitochondrial isoform 7 [Canis familiaris]
          Length = 562

 Score =  267 bits (683), Expect(2) = 2e-75
 Identities = 122/158 (77%), Positives = 144/158 (91%)
 Frame = +3

Query: 219 LAFTLEERQQLNIHGLLPPCFISQDIQVLRVIKNFERLNSDFDRYLLLMDLQDRNEKLFY 398
           +AFTLEER QL IHGL+PPCF+SQD+Q+LR+++ +ER  SD D+Y++LM LQDRNEKLFY
Sbjct: 1   MAFTLEERLQLGIHGLIPPCFLSQDVQLLRIMRYYERQQSDLDKYIILMTLQDRNEKLFY 60

Query: 399 KVLMSDIEKFMPIVYTPTVGLACQQYSLAFRKPRGLFISIHDRGHVASVLNAWPEDVIKA 578
           +VL SD+EKFMPIVYTPTVGLACQQY L FR+PRGLFI+IHD+GH+A++LN+WPED IKA
Sbjct: 61  RVLTSDVEKFMPIVYTPTVGLACQQYGLTFRRPRGLFITIHDKGHLATMLNSWPEDDIKA 120

Query: 579 VVVTDGERILGLGDLGCNGMGIPVGKMALYTACGGGKP 692
           VVVTDGERILGLGDLGC GMGIPVGK+ALYTACGG  P
Sbjct: 121 VVVTDGERILGLGDLGCYGMGIPVGKLALYTACGGVSP 158



 Score = 33.9 bits (76), Expect(2) = 2e-75
 Identities = 13/16 (81%), Positives = 16/16 (100%)
 Frame = +1

Query: 682 GVNPQECLPVILDVGT 729
           GV+PQ+CLPV+LDVGT
Sbjct: 155 GVSPQQCLPVLLDVGT 170


>ref|XP_857177.1| PREDICTED: similar to malic enzyme 3, NADP(+)-dependent,
           mitochondrial isoform 6 [Canis familiaris]
          Length = 513

 Score =  267 bits (683), Expect(2) = 2e-75
 Identities = 122/158 (77%), Positives = 144/158 (91%)
 Frame = +3

Query: 219 LAFTLEERQQLNIHGLLPPCFISQDIQVLRVIKNFERLNSDFDRYLLLMDLQDRNEKLFY 398
           +AFTLEER QL IHGL+PPCF+SQD+Q+LR+++ +ER  SD D+Y++LM LQDRNEKLFY
Sbjct: 1   MAFTLEERLQLGIHGLIPPCFLSQDVQLLRIMRYYERQQSDLDKYIILMTLQDRNEKLFY 60

Query: 399 KVLMSDIEKFMPIVYTPTVGLACQQYSLAFRKPRGLFISIHDRGHVASVLNAWPEDVIKA 578
           +VL SD+EKFMPIVYTPTVGLACQQY L FR+PRGLFI+IHD+GH+A++LN+WPED IKA
Sbjct: 61  RVLTSDVEKFMPIVYTPTVGLACQQYGLTFRRPRGLFITIHDKGHLATMLNSWPEDDIKA 120

Query: 579 VVVTDGERILGLGDLGCNGMGIPVGKMALYTACGGGKP 692
           VVVTDGERILGLGDLGC GMGIPVGK+ALYTACGG  P
Sbjct: 121 VVVTDGERILGLGDLGCYGMGIPVGKLALYTACGGVSP 158



 Score = 33.9 bits (76), Expect(2) = 2e-75
 Identities = 13/16 (81%), Positives = 16/16 (100%)
 Frame = +1

Query: 682 GVNPQECLPVILDVGT 729
           GV+PQ+CLPV+LDVGT
Sbjct: 155 GVSPQQCLPVLLDVGT 170


>ref|XP_857051.1| PREDICTED: similar to malic enzyme 3, NADP(+)-dependent,
           mitochondrial isoform 3 [Canis familiaris]
          Length = 361

 Score =  267 bits (683), Expect(2) = 2e-75
 Identities = 122/158 (77%), Positives = 144/158 (91%)
 Frame = +3

Query: 219 LAFTLEERQQLNIHGLLPPCFISQDIQVLRVIKNFERLNSDFDRYLLLMDLQDRNEKLFY 398
           +AFTLEER QL IHGL+PPCF+SQD+Q+LR+++ +ER  SD D+Y++LM LQDRNEKLFY
Sbjct: 1   MAFTLEERLQLGIHGLIPPCFLSQDVQLLRIMRYYERQQSDLDKYIILMTLQDRNEKLFY 60

Query: 399 KVLMSDIEKFMPIVYTPTVGLACQQYSLAFRKPRGLFISIHDRGHVASVLNAWPEDVIKA 578
           +VL SD+EKFMPIVYTPTVGLACQQY L FR+PRGLFI+IHD+GH+A++LN+WPED IKA
Sbjct: 61  RVLTSDVEKFMPIVYTPTVGLACQQYGLTFRRPRGLFITIHDKGHLATMLNSWPEDDIKA 120

Query: 579 VVVTDGERILGLGDLGCNGMGIPVGKMALYTACGGGKP 692
           VVVTDGERILGLGDLGC GMGIPVGK+ALYTACGG  P
Sbjct: 121 VVVTDGERILGLGDLGCYGMGIPVGKLALYTACGGVSP 158



 Score = 33.9 bits (76), Expect(2) = 2e-75
 Identities = 13/16 (81%), Positives = 16/16 (100%)
 Frame = +1

Query: 682 GVNPQECLPVILDVGT 729
           GV+PQ+CLPV+LDVGT
Sbjct: 155 GVSPQQCLPVLLDVGT 170


>ref|XP_542269.2| PREDICTED: similar to malic enzyme 3, NADP(+)-dependent,
           mitochondrial isoform 1 [Canis familiaris]
          Length = 569

 Score =  253 bits (645), Expect(2) = 5e-71
 Identities = 122/185 (65%), Positives = 144/185 (77%), Gaps = 27/185 (14%)
 Frame = +3

Query: 219 LAFTLEERQQLNIHGLLPPCFISQDIQVLRVIKNFERLNSDFDRYLLLMDLQDRNEKLFY 398
           +AFTLEER QL IHGL+PPCF+SQD+Q+LR+++ +ER  SD D+Y++LM LQDRNEKLFY
Sbjct: 1   MAFTLEERLQLGIHGLIPPCFLSQDVQLLRIMRYYERQQSDLDKYIILMTLQDRNEKLFY 60

Query: 399 KVLMSDIEKFMPIVYTPTVGLACQQYSLAFRKP--------------------------- 497
           +VL SD+EKFMPIVYTPTVGLACQQY L FR+P                           
Sbjct: 61  RVLTSDVEKFMPIVYTPTVGLACQQYGLTFRRPRSAKEGLRGESHYGVDSLSSEGLSCSA 120

Query: 498 RGLFISIHDRGHVASVLNAWPEDVIKAVVVTDGERILGLGDLGCNGMGIPVGKMALYTAC 677
           RGLFI+IHD+GH+A++LN+WPED IKAVVVTDGERILGLGDLGC GMGIPVGK+ALYTAC
Sbjct: 121 RGLFITIHDKGHLATMLNSWPEDDIKAVVVTDGERILGLGDLGCYGMGIPVGKLALYTAC 180

Query: 678 GGGKP 692
           GG  P
Sbjct: 181 GGVSP 185



 Score = 33.9 bits (76), Expect(2) = 5e-71
 Identities = 13/16 (81%), Positives = 16/16 (100%)
 Frame = +1

Query: 682 GVNPQECLPVILDVGT 729
           GV+PQ+CLPV+LDVGT
Sbjct: 182 GVSPQQCLPVLLDVGT 197


>ref|XP_849530.1| PREDICTED: similar to NAD-dependent malic enzyme, mitochondrial
           precursor (NAD-ME) (Malic enzyme 2) isoform 2 [Canis
           familiaris]
          Length = 584

 Score =  231 bits (588), Expect(2) = 7e-63
 Identities = 110/183 (60%), Positives = 137/183 (74%)
 Frame = +3

Query: 150 APRRRHTLQRGYAVTRIPHLNKDLAFTLEERQQLNIHGLLPPCFISQDIQVLRVIKNFER 329
           A R  H  ++G  +   P  NK +AFTL+ERQ L + GLLPP   +QDIQ LR  KN ++
Sbjct: 15  ACRHIHIKEKGKPLMLNPRTNKGMAFTLQERQMLGLQGLLPPKIETQDIQALRFHKNVKK 74

Query: 330 LNSDFDRYLLLMDLQDRNEKLFYKVLMSDIEKFMPIVYTPTVGLACQQYSLAFRKPRGLF 509
           +N   ++Y+ +M +Q+RNEKLFY++L  DIE  MPIVYTPTVGLAC QY   FR+P+GLF
Sbjct: 75  MNGPLEKYIYIMGIQERNEKLFYRILQDDIESLMPIVYTPTVGLACSQYGHIFRRPKGLF 134

Query: 510 ISIHDRGHVASVLNAWPEDVIKAVVVTDGERILGLGDLGCNGMGIPVGKMALYTACGGGK 689
           ISI DRGHV S+++ WPE+ +KAVVVTDGERILGLGDLG  GMGIPVGK+ LYTAC G +
Sbjct: 135 ISISDRGHVRSIVDNWPENHVKAVVVTDGERILGLGDLGVYGMGIPVGKLCLYTACAGIR 194

Query: 690 PPR 698
           P R
Sbjct: 195 PDR 197



 Score = 28.5 bits (62), Expect(2) = 7e-63
 Identities = 10/16 (62%), Positives = 12/16 (75%)
 Frame = +1

Query: 682 GVNPQECLPVILDVGT 729
           G+ P  CLPV +DVGT
Sbjct: 192 GIRPDRCLPVCIDVGT 207


>ref|XP_533402.2| PREDICTED: similar to NAD-dependent malic enzyme, mitochondrial
           precursor (NAD-ME) (Malic enzyme 2) isoform 1 [Canis
           familiaris]
          Length = 499

 Score =  172 bits (436), Expect(2) = 2e-45
 Identities = 80/112 (71%), Positives = 93/112 (83%)
 Frame = +3

Query: 363 MDLQDRNEKLFYKVLMSDIEKFMPIVYTPTVGLACQQYSLAFRKPRGLFISIHDRGHVAS 542
           M +Q+RNEKLFY++L  DIE  MPIVYTPTVGLAC QY   FR+P+GLFISI DRGHV S
Sbjct: 1   MGIQERNEKLFYRILQDDIESLMPIVYTPTVGLACSQYGHIFRRPKGLFISISDRGHVRS 60

Query: 543 VLNAWPEDVIKAVVVTDGERILGLGDLGCNGMGIPVGKMALYTACGGGKPPR 698
           +++ WPE+ +KAVVVTDGERILGLGDLG  GMGIPVGK+ LYTAC G +P R
Sbjct: 61  IVDNWPENHVKAVVVTDGERILGLGDLGVYGMGIPVGKLCLYTACAGIRPDR 112



 Score = 28.5 bits (62), Expect(2) = 2e-45
 Identities = 10/16 (62%), Positives = 12/16 (75%)
 Frame = +1

Query: 682 GVNPQECLPVILDVGT 729
           G+ P  CLPV +DVGT
Sbjct: 107 GIRPDRCLPVCIDVGT 122


  Database: RefSeqCP
    Posted date:  Aug 1, 2006  9:25 PM
  Number of letters in database: 19,266,565
  Number of sequences in database:  33,732
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 27,376,190
Number of Sequences: 33732
Number of extensions: 658563
Number of successful extensions: 2752
Number of sequences better than 1.0e-05: 9
Number of HSP's better than  0.0 without gapping: 2465
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2744
length of database: 19,266,565
effective HSP length: 100
effective length of database: 15,893,365
effective search space used: 2272751195
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqMP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611S-024617
         (731 letters)

Database: RefSeqMP 
           45,328 sequences; 21,768,885 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_032641.1| malic enzyme, supernatant [Mus musculus]             354   e-101
Alignment   gi|XP_001004679.1| PREDICTED: similar to NADP-dependent malic e...   309   4e-88
Alignment   gi|XP_001004685.1| PREDICTED: similar to NADP-dependent malic e...   309   4e-88
Alignment   gi|NP_852072.1| malic enzyme 3, NADP(+)-dependent, mitochondria...   285   3e-81
Alignment   gi|NP_663469.1| malic enzyme 2, NAD(+)-dependent, mitochondrial...   228   2e-62
Alignment   gi|XP_001004683.1| PREDICTED: similar to NADP-dependent malic e...    39   3e-07

>ref|NP_032641.1| malic enzyme, supernatant [Mus musculus]
          Length = 572

 Score =  354 bits (909), Expect(2) = e-101
 Identities = 168/185 (90%), Positives = 178/185 (96%)
 Frame = +3

Query: 138 MEPRAPRRRHTLQRGYAVTRIPHLNKDLAFTLEERQQLNIHGLLPPCFISQDIQVLRVIK 317
           MEPRAPRRRHT QRGY +TR PHLNKDLAFTLEERQQLNIHGLLPPC ISQ++QVLR+IK
Sbjct: 1   MEPRAPRRRHTHQRGYLLTRDPHLNKDLAFTLEERQQLNIHGLLPPCIISQELQVLRIIK 60

Query: 318 NFERLNSDFDRYLLLMDLQDRNEKLFYKVLMSDIEKFMPIVYTPTVGLACQQYSLAFRKP 497
           NFERLNSDFDRYLLLMDLQDRNEKLFY VLMSD+EKFMPIVYTPTVGLACQQYSLAFRKP
Sbjct: 61  NFERLNSDFDRYLLLMDLQDRNEKLFYSVLMSDVEKFMPIVYTPTVGLACQQYSLAFRKP 120

Query: 498 RGLFISIHDRGHVASVLNAWPEDVIKAVVVTDGERILGLGDLGCNGMGIPVGKMALYTAC 677
           RGLFISIHD+GH+ASVLNAWPEDV+KA+VVTDGERILGLGDLGCNGMGIPVGK+ALYTAC
Sbjct: 121 RGLFISIHDKGHIASVLNAWPEDVVKAIVVTDGERILGLGDLGCNGMGIPVGKLALYTAC 180

Query: 678 GGGKP 692
           GG  P
Sbjct: 181 GGVNP 185



 Score = 34.3 bits (77), Expect(2) = e-101
 Identities = 13/16 (81%), Positives = 15/16 (93%)
 Frame = +1

Query: 682 GVNPQECLPVILDVGT 729
           GVNPQ+CLP+ LDVGT
Sbjct: 182 GVNPQQCLPITLDVGT 197


>ref|XP_001004679.1| PREDICTED: similar to NADP-dependent malic enzyme (NADP-ME) (Malic
           enzyme 1) isoform 1 [Mus musculus]
          Length = 554

 Score =  309 bits (792), Expect(2) = 4e-88
 Identities = 146/160 (91%), Positives = 156/160 (97%)
 Frame = +3

Query: 213 KDLAFTLEERQQLNIHGLLPPCFISQDIQVLRVIKNFERLNSDFDRYLLLMDLQDRNEKL 392
           +DLAFTLEERQQLNIHGLLPPC ISQ++QVLR+IKNFERLNSDFDRYLLLMDLQDRNEKL
Sbjct: 6   EDLAFTLEERQQLNIHGLLPPCIISQELQVLRIIKNFERLNSDFDRYLLLMDLQDRNEKL 65

Query: 393 FYKVLMSDIEKFMPIVYTPTVGLACQQYSLAFRKPRGLFISIHDRGHVASVLNAWPEDVI 572
           FY VLMSD+EKFMPIVYTPTVGLACQQYSLAFRKPRGLFISIHD+GH+ASVLNAWPEDV+
Sbjct: 66  FYSVLMSDVEKFMPIVYTPTVGLACQQYSLAFRKPRGLFISIHDKGHIASVLNAWPEDVV 125

Query: 573 KAVVVTDGERILGLGDLGCNGMGIPVGKMALYTACGGGKP 692
           KA+VVTDGERILGLGDLGCNGMGIPVGK+ALYTACGG  P
Sbjct: 126 KAIVVTDGERILGLGDLGCNGMGIPVGKLALYTACGGVNP 165



 Score = 34.3 bits (77), Expect(2) = 4e-88
 Identities = 13/16 (81%), Positives = 15/16 (93%)
 Frame = +1

Query: 682 GVNPQECLPVILDVGT 729
           GVNPQ+CLP+ LDVGT
Sbjct: 162 GVNPQQCLPITLDVGT 177


>ref|XP_001004685.1| PREDICTED: similar to NADP-dependent malic enzyme (NADP-ME) (Malic
           enzyme 1) isoform 4 [Mus musculus]
          Length = 552

 Score =  309 bits (792), Expect(2) = 4e-88
 Identities = 146/160 (91%), Positives = 156/160 (97%)
 Frame = +3

Query: 213 KDLAFTLEERQQLNIHGLLPPCFISQDIQVLRVIKNFERLNSDFDRYLLLMDLQDRNEKL 392
           +DLAFTLEERQQLNIHGLLPPC ISQ++QVLR+IKNFERLNSDFDRYLLLMDLQDRNEKL
Sbjct: 6   EDLAFTLEERQQLNIHGLLPPCIISQELQVLRIIKNFERLNSDFDRYLLLMDLQDRNEKL 65

Query: 393 FYKVLMSDIEKFMPIVYTPTVGLACQQYSLAFRKPRGLFISIHDRGHVASVLNAWPEDVI 572
           FY VLMSD+EKFMPIVYTPTVGLACQQYSLAFRKPRGLFISIHD+GH+ASVLNAWPEDV+
Sbjct: 66  FYSVLMSDVEKFMPIVYTPTVGLACQQYSLAFRKPRGLFISIHDKGHIASVLNAWPEDVV 125

Query: 573 KAVVVTDGERILGLGDLGCNGMGIPVGKMALYTACGGGKP 692
           KA+VVTDGERILGLGDLGCNGMGIPVGK+ALYTACGG  P
Sbjct: 126 KAIVVTDGERILGLGDLGCNGMGIPVGKLALYTACGGVNP 165



 Score = 34.3 bits (77), Expect(2) = 4e-88
 Identities = 13/16 (81%), Positives = 15/16 (93%)
 Frame = +1

Query: 682 GVNPQECLPVILDVGT 729
           GVNPQ+CLP+ LDVGT
Sbjct: 162 GVNPQQCLPITLDVGT 177


>ref|NP_852072.1| malic enzyme 3, NADP(+)-dependent, mitochondrial [Mus musculus]
          Length = 604

 Score =  285 bits (729), Expect(2) = 3e-81
 Identities = 137/201 (68%), Positives = 164/201 (81%)
 Frame = +3

Query: 90  SIRPLSPVPPRQRQPAMEPRAPRRRHTLQRGYAVTRIPHLNKDLAFTLEERQQLNIHGLL 269
           S+R  +P  P Q   + +   PR     +RGY VTR PHLNK +AFTLEER QL IHGL+
Sbjct: 21  SLRRQAPSAPAQGCHS-KSGPPRPVPLKKRGYDVTRNPHLNKGMAFTLEERLQLGIHGLI 79

Query: 270 PPCFISQDIQVLRVIKNFERLNSDFDRYLLLMDLQDRNEKLFYKVLMSDIEKFMPIVYTP 449
           PPCF+SQD+Q+LR+++ +E   SD D+Y++LM  QDRNEKLFY+VL SD+EKFMPIVYTP
Sbjct: 80  PPCFLSQDVQLLRIMRYYENQQSDLDKYIILMTHQDRNEKLFYRVLTSDVEKFMPIVYTP 139

Query: 450 TVGLACQQYSLAFRKPRGLFISIHDRGHVASVLNAWPEDVIKAVVVTDGERILGLGDLGC 629
           TVGLACQ Y L FR+PRGLFI+IHD+GH+A++LN+WPED IKAVVVTDGERILGLGDLGC
Sbjct: 140 TVGLACQHYGLTFRRPRGLFITIHDKGHIATMLNSWPEDNIKAVVVTDGERILGLGDLGC 199

Query: 630 NGMGIPVGKMALYTACGGGKP 692
            GMGIPVGK+ALYTACGG  P
Sbjct: 200 YGMGIPVGKLALYTACGGVNP 220



 Score = 35.8 bits (81), Expect(2) = 3e-81
 Identities = 14/16 (87%), Positives = 16/16 (100%)
 Frame = +1

Query: 682 GVNPQECLPVILDVGT 729
           GVNPQ+CLPV+LDVGT
Sbjct: 217 GVNPQQCLPVLLDVGT 232


>ref|NP_663469.1| malic enzyme 2, NAD(+)-dependent, mitochondrial [Mus musculus]
          Length = 589

 Score =  228 bits (581), Expect(2) = 2e-62
 Identities = 108/181 (59%), Positives = 137/181 (75%)
 Frame = +3

Query: 156 RRRHTLQRGYAVTRIPHLNKDLAFTLEERQQLNIHGLLPPCFISQDIQVLRVIKNFERLN 335
           RR H  ++G  +   P  NK +AFTL+ERQ L + GLLPP   +QDIQ LR  +N +++ 
Sbjct: 17  RRVHLKEKGKPLMLNPRTNKGMAFTLQERQMLGLQGLLPPKIETQDIQALRFHRNLKKMT 76

Query: 336 SDFDRYLLLMDLQDRNEKLFYKVLMSDIEKFMPIVYTPTVGLACQQYSLAFRKPRGLFIS 515
           S  ++Y+ +M +Q+RNEKLFY++L  DIE  MPIVYTPTVGLAC QY   FR+P+GLFIS
Sbjct: 77  SPLEKYIYIMGIQERNEKLFYRILQDDIESLMPIVYTPTVGLACCQYGHIFRRPKGLFIS 136

Query: 516 IHDRGHVASVLNAWPEDVIKAVVVTDGERILGLGDLGCNGMGIPVGKMALYTACGGGKPP 695
           I DRGHV S+++ WPE+ +KAVVVTDGERILGLGDLG  GMGIPVGK+ LYTAC G +P 
Sbjct: 137 ISDRGHVRSIVDNWPENHVKAVVVTDGERILGLGDLGVYGMGIPVGKLCLYTACAGIQPE 196

Query: 696 R 698
           +
Sbjct: 197 K 197



 Score = 29.6 bits (65), Expect(2) = 2e-62
 Identities = 10/16 (62%), Positives = 14/16 (87%)
 Frame = +1

Query: 682 GVNPQECLPVILDVGT 729
           G+ P++CLPV +DVGT
Sbjct: 192 GIQPEKCLPVCIDVGT 207


>ref|XP_001004683.1| PREDICTED: similar to NADP-dependent malic enzyme (NADP-ME) (Malic
           enzyme 1) isoform 3 [Mus musculus]
          Length = 406

 Score = 38.5 bits (88), Expect(2) = 3e-07
 Identities = 16/19 (84%), Positives = 17/19 (89%)
 Frame = +3

Query: 636 MGIPVGKMALYTACGGGKP 692
           MGIPVGK+ALYTACGG  P
Sbjct: 1   MGIPVGKLALYTACGGVNP 19



 Score = 34.3 bits (77), Expect(2) = 3e-07
 Identities = 13/16 (81%), Positives = 15/16 (93%)
 Frame = +1

Query: 682 GVNPQECLPVILDVGT 729
           GVNPQ+CLP+ LDVGT
Sbjct: 16  GVNPQQCLPITLDVGT 31


  Database: RefSeqMP
    Posted date:  Aug 2, 2006 12:58 AM
  Number of letters in database: 21,768,885
  Number of sequences in database:  45,328
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 31,299,292
Number of Sequences: 45328
Number of extensions: 745313
Number of successful extensions: 2888
Number of sequences better than 1.0e-05: 6
Number of HSP's better than  0.0 without gapping: 2599
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2874
length of database: 21,768,885
effective HSP length: 101
effective length of database: 17,190,757
effective search space used: 2441087494
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)