BLASTX 2.2.10 [Oct-19-2004] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 20060611S-026952 (815 letters) Database: RefSeqSP 1040 sequences; 434,620 total letters Searching...done Score E Sequences producing significant alignments: (bits) Value Alignment gi|NP_998939.1| CD74 antigen [Sus scrofa] 118 4e-62 >ref|NP_998939.1| CD74 antigen [Sus scrofa] Length = 214 Score = 118 bits (296), Expect(3) = 4e-62 Identities = 60/107 (56%), Positives = 70/107 (65%) Frame = +1 Query: 328 RPSLPLTSMRISASMLMLALPLESPEPMLCSAFYSTXXXXXXXXXXXKSDPLRLYSNLTG 507 +PS PL+ MR+SA MLM ALP+E PEPM + Y KSDPL +Y L G Sbjct: 83 KPSKPLSKMRVSAPMLMQALPMEGPEPMRNATKYGNMTQDHVMHLLLKSDPLGVYPKLKG 142 Query: 508 ILTEHLNHL*STMYRVFWKLFDTWLRAWLLFEMSNISLEETPFDVPP 648 L E+L HL +TM V WKLF+ WLR WLLFEMS SLEETPF+VPP Sbjct: 143 SLPENLKHLKNTMDGVNWKLFENWLRQWLLFEMSKNSLEETPFEVPP 189 Score = 115 bits (289), Expect(3) = 4e-62 Identities = 59/79 (74%), Positives = 65/79 (82%) Frame = +3 Query: 96 DVVSYHEHLPMLGQRPWAPDSKCSRGSLYTRFSVLVALLLAGQAPTAYFLYPRHGLLDNL 275 D++S HE LPMLGQRP AP+SKCSRG+LYT FSVLVALLLAGQA TAYFLY + G LD L Sbjct: 6 DLISNHEQLPMLGQRPGAPESKCSRGALYTGFSVLVALLLAGQATTAYFLYQQQGRLDKL 65 Query: 276 TVTSLNLRLESLPMTLSAP 332 TVTS NL+LESL M L P Sbjct: 66 TVTSQNLQLESLRMKLPKP 84 Score = 38.5 bits (88), Expect(3) = 4e-62 Identities = 20/25 (80%), Positives = 21/25 (84%) Frame = +3 Query: 648 KYPLETEDLSSGLGVTFHDLCRVIL 722 K PLETEDLSSGLGVT DL +VIL Sbjct: 190 KDPLETEDLSSGLGVTKQDLGQVIL 214 Database: RefSeqSP Posted date: Aug 1, 2006 7:14 PM Number of letters in database: 434,620 Number of sequences in database: 1040 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 700,495 Number of Sequences: 1040 Number of extensions: 17458 Number of successful extensions: 88 Number of sequences better than 1.0e-05: 1 Number of HSP's better than 0.0 without gapping: 78 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 86 length of database: 434,620 effective HSP length: 75 effective length of database: 356,620 effective search space used: 69897520 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
Search to RefSeqBP
BLASTX 2.2.10 [Oct-19-2004] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 20060611S-026952 (815 letters) Database: RefSeqBP 33,508 sequences; 16,112,626 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Alignment gi|NP_001029907.1| similar to CD74 antigen isoform b [Bos taurus] 111 5e-49 >ref|NP_001029907.1| similar to CD74 antigen isoform b [Bos taurus] Length = 204 Score = 111 bits (278), Expect(3) = 5e-49 Identities = 57/79 (72%), Positives = 64/79 (81%) Frame = +3 Query: 96 DVVSYHEHLPMLGQRPWAPDSKCSRGSLYTRFSVLVALLLAGQAPTAYFLYPRHGLLDNL 275 D++S HE LPMLGQRP A +SKCSRG+LYT FSVLVALLLAGQA TAYFLY + G LD L Sbjct: 6 DLISNHEQLPMLGQRPGAQESKCSRGALYTGFSVLVALLLAGQATTAYFLYQQQGRLDKL 65 Query: 276 TVTSLNLRLESLPMTLSAP 332 TVTS NL+LE+L M L P Sbjct: 66 TVTSQNLQLENLRMKLPKP 84 Score = 101 bits (252), Expect(3) = 5e-49 Identities = 49/107 (45%), Positives = 66/107 (61%) Frame = +1 Query: 328 RPSLPLTSMRISASMLMLALPLESPEPMLCSAFYSTXXXXXXXXXXXKSDPLRLYSNLTG 507 +P+ P++ MR++ MLM ALP+ PEPM + Y K+DPL++Y L G Sbjct: 83 KPAKPMSQMRMATPMLMRALPMAGPEPMKNATKYGNMTQDHVMHLLLKADPLKVYPQLKG 142 Query: 508 ILTEHLNHL*STMYRVFWKLFDTWLRAWLLFEMSNISLEETPFDVPP 648 L E+L HL +M + WKLF++WL WLLFEMS SLEE PF+ PP Sbjct: 143 SLPENLKHLKDSMDGLDWKLFESWLHQWLLFEMSKNSLEEKPFEGPP 189 Score = 20.8 bits (42), Expect(3) = 5e-49 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = +3 Query: 648 KYPLETEDLSSGLGV 692 K P+E E SSGLGV Sbjct: 190 KDPMEMEYPSSGLGV 204 Database: RefSeqBP Posted date: Aug 1, 2006 7:14 PM Number of letters in database: 16,112,626 Number of sequences in database: 33,508 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 26,579,730 Number of Sequences: 33508 Number of extensions: 694980 Number of successful extensions: 2799 Number of sequences better than 1.0e-05: 1 Number of HSP's better than 0.0 without gapping: 2514 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2797 length of database: 16,112,626 effective HSP length: 100 effective length of database: 12,761,826 effective search space used: 2182272246 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
Search to RefSeqHP
BLASTX 2.2.10 [Oct-19-2004] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 20060611S-026952 (815 letters) Database: RefSeqHP 39,411 sequences; 17,774,539 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Alignment gi|NP_004346.1| CD74 antigen isoform b [Homo sapiens] 108 8e-45 Alignment gi|NP_001020330.1| CD74 antigen isoform a [Homo sapiens] 108 6e-43 Alignment gi|NP_001020329.1| CD74 antigen isoform c [Homo sapiens] 108 5e-24 >ref|NP_004346.1| CD74 antigen isoform b [Homo sapiens] Length = 232 Score = 108 bits (270), Expect(3) = 8e-45 Identities = 54/79 (68%), Positives = 64/79 (81%) Frame = +3 Query: 96 DVVSYHEHLPMLGQRPWAPDSKCSRGSLYTRFSVLVALLLAGQAPTAYFLYPRHGLLDNL 275 D++S +E LPMLG+RP AP+SKCSRG+LYT FS+LV LLLAGQA TAYFLY + G LD L Sbjct: 22 DLISNNEQLPMLGRRPGAPESKCSRGALYTGFSILVTLLLAGQATTAYFLYQQQGRLDKL 81 Query: 276 TVTSLNLRLESLPMTLSAP 332 TVTS NL+LE+L M L P Sbjct: 82 TVTSQNLQLENLRMKLPKP 100 Score = 84.3 bits (207), Expect(3) = 8e-45 Identities = 43/109 (39%), Positives = 64/109 (58%), Gaps = 2/109 (1%) Frame = +1 Query: 328 RPSLPLTSMRISASMLMLALPLES-PE-PMLCSAFYSTXXXXXXXXXXXKSDPLRLYSNL 501 +P P++ MR++ +LM ALP+ + P+ PM + Y +DPL++Y L Sbjct: 99 KPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQNADPLKVYPPL 158 Query: 502 TGILTEHLNHL*STMYRVFWKLFDTWLRAWLLFEMSNISLEETPFDVPP 648 G E+L HL +TM + WK+F++W+ WLLFEMS SLE+ P D PP Sbjct: 159 KGSFPENLRHLKNTMETIDWKVFESWMHHWLLFEMSRHSLEQKPTDAPP 207 Score = 26.9 bits (58), Expect(3) = 8e-45 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = +3 Query: 648 KYPLETEDLSSGLGVTFHDL 707 K LE ED SSGLGVT DL Sbjct: 208 KESLELEDPSSGLGVTKQDL 227 >ref|NP_001020330.1| CD74 antigen isoform a [Homo sapiens] Length = 296 Score = 108 bits (270), Expect(2) = 6e-43 Identities = 54/79 (68%), Positives = 64/79 (81%) Frame = +3 Query: 96 DVVSYHEHLPMLGQRPWAPDSKCSRGSLYTRFSVLVALLLAGQAPTAYFLYPRHGLLDNL 275 D++S +E LPMLG+RP AP+SKCSRG+LYT FS+LV LLLAGQA TAYFLY + G LD L Sbjct: 22 DLISNNEQLPMLGRRPGAPESKCSRGALYTGFSILVTLLLAGQATTAYFLYQQQGRLDKL 81 Query: 276 TVTSLNLRLESLPMTLSAP 332 TVTS NL+LE+L M L P Sbjct: 82 TVTSQNLQLENLRMKLPKP 100 Score = 84.3 bits (207), Expect(2) = 6e-43 Identities = 43/109 (39%), Positives = 64/109 (58%), Gaps = 2/109 (1%) Frame = +1 Query: 328 RPSLPLTSMRISASMLMLALPLES-PE-PMLCSAFYSTXXXXXXXXXXXKSDPLRLYSNL 501 +P P++ MR++ +LM ALP+ + P+ PM + Y +DPL++Y L Sbjct: 99 KPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQNADPLKVYPPL 158 Query: 502 TGILTEHLNHL*STMYRVFWKLFDTWLRAWLLFEMSNISLEETPFDVPP 648 G E+L HL +TM + WK+F++W+ WLLFEMS SLE+ P D PP Sbjct: 159 KGSFPENLRHLKNTMETIDWKVFESWMHHWLLFEMSRHSLEQKPTDAPP 207 >ref|NP_001020329.1| CD74 antigen isoform c [Homo sapiens] Length = 160 Score = 108 bits (270), Expect = 5e-24 Identities = 54/79 (68%), Positives = 64/79 (81%) Frame = +3 Query: 96 DVVSYHEHLPMLGQRPWAPDSKCSRGSLYTRFSVLVALLLAGQAPTAYFLYPRHGLLDNL 275 D++S +E LPMLG+RP AP+SKCSRG+LYT FS+LV LLLAGQA TAYFLY + G LD L Sbjct: 22 DLISNNEQLPMLGRRPGAPESKCSRGALYTGFSILVTLLLAGQATTAYFLYQQQGRLDKL 81 Query: 276 TVTSLNLRLESLPMTLSAP 332 TVTS NL+LE+L M L P Sbjct: 82 TVTSQNLQLENLRMKLPKP 100 Database: RefSeqHP Posted date: Aug 2, 2006 12:57 AM Number of letters in database: 17,774,539 Number of sequences in database: 39,411 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 30,240,049 Number of Sequences: 39411 Number of extensions: 821984 Number of successful extensions: 3515 Number of sequences better than 1.0e-05: 3 Number of HSP's better than 0.0 without gapping: 3006 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3508 length of database: 17,774,539 effective HSP length: 100 effective length of database: 13,833,439 effective search space used: 2365518069 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
Search to RefSeqMP
BLASTX 2.2.10 [Oct-19-2004] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 20060611S-026952 (815 letters) Database: RefSeqMP 45,328 sequences; 21,768,885 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Alignment gi|NP_034675.1| Ia-associated invariant chain [Mus musculus] 98 6e-37 >ref|NP_034675.1| Ia-associated invariant chain [Mus musculus] Length = 215 Score = 97.8 bits (242), Expect(3) = 6e-37 Identities = 51/76 (67%), Positives = 60/76 (78%) Frame = +3 Query: 96 DVVSYHEHLPMLGQRPWAPDSKCSRGSLYTRFSVLVALLLAGQAPTAYFLYPRHGLLDNL 275 D++S HE LP+LG RP P+ +CSRG+LYT SVLVALLLAGQA TAYFLY + G LD L Sbjct: 6 DLISNHEQLPILGNRPREPE-RCSRGALYTGVSVLVALLLAGQATTAYFLYQQQGRLDKL 64 Query: 276 TVTSLNLRLESLPMTL 323 T+TS NL+LESL M L Sbjct: 65 TITSQNLQLESLRMKL 80 Score = 63.9 bits (154), Expect(3) = 6e-37 Identities = 37/106 (34%), Positives = 57/106 (53%), Gaps = 3/106 (2%) Frame = +1 Query: 340 PLTSMRISASMLMLALPLESP--EPMLCSAFYSTXXXXXXXXXXXKSDPLRLYSNLTGIL 513 P++ MR++ +LM + +++ P+ Y +S PL Y L G Sbjct: 86 PVSQMRMATPLLMRPMSMDNMLLGPVKNVTKYGNMTQDHVMHLLTRSGPLE-YPQLKGTF 144 Query: 514 TEHLNHL*STMYRVFWKLFDTWLRAWLLFEMSNISLEE-TPFDVPP 648 E+L HL ++M V WK+F++W++ WLLFEMS SLEE P + PP Sbjct: 145 PENLKHLKNSMDGVNWKIFESWMKQWLLFEMSKNSLEEKKPTEAPP 190 Score = 32.0 bits (71), Expect(3) = 6e-37 Identities = 16/25 (64%), Positives = 19/25 (76%) Frame = +3 Query: 648 KYPLETEDLSSGLGVTFHDLCRVIL 722 K PL+ EDLSSGLGVT +L +V L Sbjct: 191 KEPLDMEDLSSGLGVTRQELGQVTL 215 Database: RefSeqMP Posted date: Aug 2, 2006 12:58 AM Number of letters in database: 21,768,885 Number of sequences in database: 45,328 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 35,603,484 Number of Sequences: 45328 Number of extensions: 923633 Number of successful extensions: 3715 Number of sequences better than 1.0e-05: 1 Number of HSP's better than 0.0 without gapping: 3267 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3709 length of database: 21,768,885 effective HSP length: 102 effective length of database: 17,145,429 effective search space used: 2897577501 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
Search to RefSeqCP
BLASTX 2.2.10 [Oct-19-2004] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 20060611S-026952 (815 letters) Database: RefSeqCP 33,732 sequences; 19,266,565 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Alignment gi|XP_536468.2| PREDICTED: similar to HLA class II histocompati... 114 2e-43 >ref|XP_536468.2| PREDICTED: similar to HLA class II histocompatibility antigen, gamma chain (HLA-DR antigens associated invariant chain) (Ia antigen-associated invariant chain) (Ii) (p33) (CD74 antigen) [Canis familiaris] Length = 272 Score = 114 bits (285), Expect(2) = 2e-43 Identities = 58/79 (73%), Positives = 65/79 (82%) Frame = +3 Query: 96 DVVSYHEHLPMLGQRPWAPDSKCSRGSLYTRFSVLVALLLAGQAPTAYFLYPRHGLLDNL 275 D++S HE LP+LGQRP AP+SKCSRG+LYT FSVLVALLLAGQA TAYFLY + G LD L Sbjct: 6 DLISNHEQLPILGQRPGAPESKCSRGALYTGFSVLVALLLAGQATTAYFLYQQQGRLDKL 65 Query: 276 TVTSLNLRLESLPMTLSAP 332 TVTS NL+LESL M L P Sbjct: 66 TVTSQNLQLESLRMKLPKP 84 Score = 80.5 bits (197), Expect(2) = 2e-43 Identities = 42/108 (38%), Positives = 63/108 (58%), Gaps = 2/108 (1%) Frame = +1 Query: 328 RPSLPLTSMRISASMLMLALPLES-PE-PMLCSAFYSTXXXXXXXXXXXKSDPLRLYSNL 501 +P PL+ MR++ M+M ALP++S P+ P + Y ++DPL++Y L Sbjct: 83 KPPKPLSKMRVATPMMMQALPIQSLPQGPTQNATEYGNMTQDHVMHLLLEADPLKVYPKL 142 Query: 502 TGILTEHLNHL*STMYRVFWKLFDTWLRAWLLFEMSNISLEETPFDVP 645 G E+L HL +TM + WK+F+ W+ WLLFEMS SLE+ +VP Sbjct: 143 KGSFPENLKHLKNTMETLDWKVFENWMYQWLLFEMSKNSLEKKSTEVP 190 Database: RefSeqCP Posted date: Aug 1, 2006 9:25 PM Number of letters in database: 19,266,565 Number of sequences in database: 33,732 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 31,161,030 Number of Sequences: 33732 Number of extensions: 814482 Number of successful extensions: 3529 Number of sequences better than 1.0e-05: 1 Number of HSP's better than 0.0 without gapping: 3088 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3470 length of database: 19,266,565 effective HSP length: 101 effective length of database: 15,859,633 effective search space used: 2696137610 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)