BLASTX 2.2.10 [Oct-19-2004] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 20060611S-027651 (553 letters) Database: RefSeqSP 1040 sequences; 434,620 total letters Searching...done Score E Sequences producing significant alignments: (bits) Value Alignment gi|NP_998939.1| CD74 antigen [Sus scrofa] 120 2e-29 >ref|NP_998939.1| CD74 antigen [Sus scrofa] Length = 214 Score = 120 bits (302), Expect = 2e-29 Identities = 59/59 (100%), Positives = 59/59 (100%) Frame = +1 Query: 61 MEDQRDLISNHEQLPMLGQRPGAPESKCSRGALYTGFSVLVALLLAGQATTAYFLYQQQ 237 MEDQRDLISNHEQLPMLGQRPGAPESKCSRGALYTGFSVLVALLLAGQATTAYFLYQQQ Sbjct: 1 MEDQRDLISNHEQLPMLGQRPGAPESKCSRGALYTGFSVLVALLLAGQATTAYFLYQQQ 59 Database: RefSeqSP Posted date: Aug 1, 2006 7:14 PM Number of letters in database: 434,620 Number of sequences in database: 1040 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 552,771 Number of Sequences: 1040 Number of extensions: 14106 Number of successful extensions: 55 Number of sequences better than 1.0e-05: 1 Number of HSP's better than 0.0 without gapping: 50 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 54 length of database: 434,620 effective HSP length: 71 effective length of database: 360,780 effective search space used: 40407360 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
Search to RefSeqBP
BLASTX 2.2.10 [Oct-19-2004] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 20060611S-027651 (553 letters) Database: RefSeqBP 33,508 sequences; 16,112,626 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Alignment gi|NP_001029907.1| similar to CD74 antigen isoform b [Bos taurus] 117 4e-27 >ref|NP_001029907.1| similar to CD74 antigen isoform b [Bos taurus] Length = 204 Score = 117 bits (294), Expect = 4e-27 Identities = 58/59 (98%), Positives = 58/59 (98%) Frame = +1 Query: 61 MEDQRDLISNHEQLPMLGQRPGAPESKCSRGALYTGFSVLVALLLAGQATTAYFLYQQQ 237 MEDQRDLISNHEQLPMLGQRPGA ESKCSRGALYTGFSVLVALLLAGQATTAYFLYQQQ Sbjct: 1 MEDQRDLISNHEQLPMLGQRPGAQESKCSRGALYTGFSVLVALLLAGQATTAYFLYQQQ 59 Database: RefSeqBP Posted date: Aug 1, 2006 7:14 PM Number of letters in database: 16,112,626 Number of sequences in database: 33,508 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 21,265,455 Number of Sequences: 33508 Number of extensions: 585245 Number of successful extensions: 3528 Number of sequences better than 1.0e-05: 1 Number of HSP's better than 0.0 without gapping: 2897 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3508 length of database: 16,112,626 effective HSP length: 95 effective length of database: 12,929,366 effective search space used: 1137784208 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
Search to RefSeqHP
BLASTX 2.2.10 [Oct-19-2004] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 20060611S-027651 (553 letters) Database: RefSeqHP 39,411 sequences; 17,774,539 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Alignment gi|NP_001020329.1| CD74 antigen isoform c [Homo sapiens] 114 5e-26 Alignment gi|NP_001020330.1| CD74 antigen isoform a [Homo sapiens] 114 5e-26 Alignment gi|NP_004346.1| CD74 antigen isoform b [Homo sapiens] 114 5e-26 >ref|NP_001020329.1| CD74 antigen isoform c [Homo sapiens] Length = 160 Score = 114 bits (285), Expect = 5e-26 Identities = 55/63 (87%), Positives = 59/63 (93%) Frame = +1 Query: 49 QARTMEDQRDLISNHEQLPMLGQRPGAPESKCSRGALYTGFSVLVALLLAGQATTAYFLY 228 Q M+DQRDLISN+EQLPMLG+RPGAPESKCSRGALYTGFS+LV LLLAGQATTAYFLY Sbjct: 13 QKPVMDDQRDLISNNEQLPMLGRRPGAPESKCSRGALYTGFSILVTLLLAGQATTAYFLY 72 Query: 229 QQQ 237 QQQ Sbjct: 73 QQQ 75 >ref|NP_001020330.1| CD74 antigen isoform a [Homo sapiens] Length = 296 Score = 114 bits (285), Expect = 5e-26 Identities = 55/63 (87%), Positives = 59/63 (93%) Frame = +1 Query: 49 QARTMEDQRDLISNHEQLPMLGQRPGAPESKCSRGALYTGFSVLVALLLAGQATTAYFLY 228 Q M+DQRDLISN+EQLPMLG+RPGAPESKCSRGALYTGFS+LV LLLAGQATTAYFLY Sbjct: 13 QKPVMDDQRDLISNNEQLPMLGRRPGAPESKCSRGALYTGFSILVTLLLAGQATTAYFLY 72 Query: 229 QQQ 237 QQQ Sbjct: 73 QQQ 75 >ref|NP_004346.1| CD74 antigen isoform b [Homo sapiens] Length = 232 Score = 114 bits (285), Expect = 5e-26 Identities = 55/63 (87%), Positives = 59/63 (93%) Frame = +1 Query: 49 QARTMEDQRDLISNHEQLPMLGQRPGAPESKCSRGALYTGFSVLVALLLAGQATTAYFLY 228 Q M+DQRDLISN+EQLPMLG+RPGAPESKCSRGALYTGFS+LV LLLAGQATTAYFLY Sbjct: 13 QKPVMDDQRDLISNNEQLPMLGRRPGAPESKCSRGALYTGFSILVTLLLAGQATTAYFLY 72 Query: 229 QQQ 237 QQQ Sbjct: 73 QQQ 75 Database: RefSeqHP Posted date: Aug 2, 2006 12:57 AM Number of letters in database: 17,774,539 Number of sequences in database: 39,411 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 24,658,290 Number of Sequences: 39411 Number of extensions: 725335 Number of successful extensions: 4697 Number of sequences better than 1.0e-05: 3 Number of HSP's better than 0.0 without gapping: 3553 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4681 length of database: 17,774,539 effective HSP length: 96 effective length of database: 13,991,083 effective search space used: 1217224221 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
Search to RefSeqMP
BLASTX 2.2.10 [Oct-19-2004] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 20060611S-027651 (553 letters) Database: RefSeqMP 45,328 sequences; 21,768,885 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Alignment gi|NP_034675.1| Ia-associated invariant chain [Mus musculus] 101 5e-22 >ref|NP_034675.1| Ia-associated invariant chain [Mus musculus] Length = 215 Score = 101 bits (251), Expect = 5e-22 Identities = 51/59 (86%), Positives = 54/59 (91%) Frame = +1 Query: 61 MEDQRDLISNHEQLPMLGQRPGAPESKCSRGALYTGFSVLVALLLAGQATTAYFLYQQQ 237 M+DQRDLISNHEQLP+LG RP PE +CSRGALYTG SVLVALLLAGQATTAYFLYQQQ Sbjct: 1 MDDQRDLISNHEQLPILGNRPREPE-RCSRGALYTGVSVLVALLLAGQATTAYFLYQQQ 58 Database: RefSeqMP Posted date: Aug 2, 2006 12:58 AM Number of letters in database: 21,768,885 Number of sequences in database: 45,328 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 28,226,145 Number of Sequences: 45328 Number of extensions: 763751 Number of successful extensions: 4422 Number of sequences better than 1.0e-05: 1 Number of HSP's better than 0.0 without gapping: 3660 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4410 length of database: 21,768,885 effective HSP length: 97 effective length of database: 17,372,069 effective search space used: 1493997934 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
Search to RefSeqCP
BLASTX 2.2.10 [Oct-19-2004] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 20060611S-027651 (553 letters) Database: RefSeqCP 33,732 sequences; 19,266,565 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Alignment gi|XP_536468.2| PREDICTED: similar to HLA class II histocompati... 119 2e-27 >ref|XP_536468.2| PREDICTED: similar to HLA class II histocompatibility antigen, gamma chain (HLA-DR antigens associated invariant chain) (Ia antigen-associated invariant chain) (Ii) (p33) (CD74 antigen) [Canis familiaris] Length = 272 Score = 119 bits (298), Expect = 2e-27 Identities = 58/59 (98%), Positives = 59/59 (100%) Frame = +1 Query: 61 MEDQRDLISNHEQLPMLGQRPGAPESKCSRGALYTGFSVLVALLLAGQATTAYFLYQQQ 237 MEDQRDLISNHEQLP+LGQRPGAPESKCSRGALYTGFSVLVALLLAGQATTAYFLYQQQ Sbjct: 1 MEDQRDLISNHEQLPILGQRPGAPESKCSRGALYTGFSVLVALLLAGQATTAYFLYQQQ 59 Database: RefSeqCP Posted date: Aug 1, 2006 9:25 PM Number of letters in database: 19,266,565 Number of sequences in database: 33,732 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 24,807,286 Number of Sequences: 33732 Number of extensions: 686973 Number of successful extensions: 4080 Number of sequences better than 1.0e-05: 1 Number of HSP's better than 0.0 without gapping: 3316 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4071 length of database: 19,266,565 effective HSP length: 97 effective length of database: 15,994,561 effective search space used: 1375532246 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)