Animal-Genome cDNA 20060611S-027900


Search to RefSeqSP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611S-027900
         (1062 letters)

Database: RefSeqSP 
           1040 sequences; 434,620 total letters

Searching...done

 ***** No hits found ******

  Database: RefSeqSP
    Posted date:  Aug 1, 2006  7:14 PM
  Number of letters in database: 434,620
  Number of sequences in database:  1040
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 953,043
Number of Sequences: 1040
Number of extensions: 23296
Number of successful extensions: 123
Number of sequences better than 1.0e-05: 0
Number of HSP's better than  0.0 without gapping: 68
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 116
length of database: 434,620
effective HSP length: 78
effective length of database: 353,500
effective search space used: 97212500
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqBP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611S-027900
         (1062 letters)

Database: RefSeqBP 
           33,508 sequences; 16,112,626 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|XP_604169.2| PREDICTED: similar to malic enzyme 3, NADP(+)-d...   243   2e-64
Alignment   gi|XP_584500.2| PREDICTED: similar to NAD-dependent malic enzym...   164   8e-41
Alignment   gi|XP_613987.2| PREDICTED: similar to NADP-dependent malic enzy...   150   1e-36

>ref|XP_604169.2| PREDICTED: similar to malic enzyme 3, NADP(+)-dependent,
           mitochondrial [Bos taurus]
          Length = 564

 Score =  243 bits (619), Expect = 2e-64
 Identities = 115/119 (96%), Positives = 118/119 (99%)
 Frame = +2

Query: 278 MAFTLEERLQLGIHGLIPPCFLSQDVQLLRIMRYYERQQSDLDKYIILMTLQDRNEKLFY 457
           MAFTLEERLQLGIHGLIPPCFLSQDVQLLR+MRYYERQQSDLDKYIILMTLQDRNEKLFY
Sbjct: 1   MAFTLEERLQLGIHGLIPPCFLSQDVQLLRVMRYYERQQSDLDKYIILMTLQDRNEKLFY 60

Query: 458 RVLTSDVEKFMPIVYTPTVGLACQHYGLTFRRPRGLFITIHDKGHLPTMLNSWPEDDIK 634
           RVLTSDVEKF+PIVYTPTVGLACQHYGLTFRRPRGLFIT+HDKGHL TMLNSWPEDDIK
Sbjct: 61  RVLTSDVEKFLPIVYTPTVGLACQHYGLTFRRPRGLFITVHDKGHLATMLNSWPEDDIK 119


>ref|XP_584500.2| PREDICTED: similar to NAD-dependent malic enzyme, mitochondrial
           precursor (NAD-ME) (Malic enzyme 2), partial [Bos
           taurus]
          Length = 513

 Score =  164 bits (416), Expect = 8e-41
 Identities = 75/140 (53%), Positives = 103/140 (73%)
 Frame = +2

Query: 215 RPVPLKKRGYDVTRNPHLNKGMAFTLEERLQLGIHGLIPPCFLSQDVQLLRIMRYYERQQ 394
           R +  K++G  +  NP  NKGMAFTL+ER  LG+ GL+PP   +QD+Q LR  R  ++  
Sbjct: 92  RHLHTKEKGKPLMLNPRTNKGMAFTLQERQMLGLQGLLPPKIETQDIQALRFHRNLKKLN 151

Query: 395 SDLDKYIILMTLQDRNEKLFYRVLTSDVEKFMPIVYTPTVGLACQHYGLTFRRPRGLFIT 574
             L+KYI +M +Q+RNEKLFYR+L  D+E  MPIVYTPTVGLAC  YG  FRRP+GLFI+
Sbjct: 152 GPLEKYIYIMGIQERNEKLFYRILQDDIETLMPIVYTPTVGLACSQYGHIFRRPKGLFIS 211

Query: 575 IHDKGHLPTMLNSWPEDDIK 634
           I D+GH+ +++++WPE+ +K
Sbjct: 212 ISDRGHVRSIVDNWPENHVK 231


>ref|XP_613987.2| PREDICTED: similar to NADP-dependent malic enzyme (NADP-ME) (Malic
           enzyme 1) [Bos taurus]
          Length = 472

 Score =  150 bits (380), Expect = 1e-36
 Identities = 71/108 (65%), Positives = 87/108 (80%), Gaps = 8/108 (7%)
 Frame = +2

Query: 278 MAFTLEERLQLGIHGLIPPCFLSQDVQLLRIMRYYERQQSDLDKYIILMTLQDRNEKLFY 457
           +AFTLEER QL IHGL+PP F+SQDVQ+LR+++ +ER  SD D+Y++LM LQDRNEKLFY
Sbjct: 15  LAFTLEERQQLNIHGLLPPSFISQDVQVLRVLKNFERLNSDFDRYLLLMDLQDRNEKLFY 74

Query: 458 RVLTSDVEKFMPIVYTPTVGLACQHYGLTFRRPR--------GLFITI 577
           +VL SD+EKFMPIVYTPTVGLACQ Y L FR+PR        GLF+ +
Sbjct: 75  KVLMSDIEKFMPIVYTPTVGLACQQYSLAFRKPRFNVLVTSYGLFLNV 122


  Database: RefSeqBP
    Posted date:  Aug 1, 2006  7:14 PM
  Number of letters in database: 16,112,626
  Number of sequences in database:  33,508
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 35,610,847
Number of Sequences: 33508
Number of extensions: 889174
Number of successful extensions: 4505
Number of sequences better than 1.0e-05: 3
Number of HSP's better than  0.0 without gapping: 3214
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4397
length of database: 16,112,626
effective HSP length: 102
effective length of database: 12,694,810
effective search space used: 3186397310
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqHP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611S-027900
         (1062 letters)

Database: RefSeqHP 
           39,411 sequences; 17,774,539 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_001014811.1| malic enzyme 3, NADP(+)-dependent, mitochond...   320   1e-87
Alignment   gi|NP_006671.2| malic enzyme 3, NADP(+)-dependent, mitochondria...   320   1e-87
Alignment   gi|NP_002386.1| cytosolic malic enzyme 1 [Homo sapiens]              213   2e-55
Alignment   gi|NP_002387.1| malic enzyme 2, NAD(+)-dependent, mitochondrial...   168   8e-42
Alignment   gi|XP_934770.1| PREDICTED: similar to NAD-dependent malic enzym...   101   9e-22
Alignment   gi|XP_944182.1| PREDICTED: similar to NAD-dependent malic enzym...   101   9e-22

>ref|NP_001014811.1| malic enzyme 3, NADP(+)-dependent, mitochondrial [Homo sapiens]
          Length = 604

 Score =  320 bits (820), Expect = 1e-87
 Identities = 156/181 (86%), Positives = 162/181 (89%)
 Frame = +2

Query: 92  MGASLGSGARVALLPRQACGAVXXXXXXXXXXDCHSKTGLPRPVPLKKRGYDVTRNPHLN 271
           MGA+LG+G R+A  P +ACGA+           CHSK G  RPVPLKKRGYDVTRNPHLN
Sbjct: 1   MGAALGTGTRLAPWPGRACGALPRWTPTAPAQGCHSKPGPARPVPLKKRGYDVTRNPHLN 60

Query: 272 KGMAFTLEERLQLGIHGLIPPCFLSQDVQLLRIMRYYERQQSDLDKYIILMTLQDRNEKL 451
           KGMAFTLEERLQLGIHGLIPPCFLSQDVQLLRIMRYYERQQSDLDKYIILMTLQDRNEKL
Sbjct: 61  KGMAFTLEERLQLGIHGLIPPCFLSQDVQLLRIMRYYERQQSDLDKYIILMTLQDRNEKL 120

Query: 452 FYRVLTSDVEKFMPIVYTPTVGLACQHYGLTFRRPRGLFITIHDKGHLPTMLNSWPEDDI 631
           FYRVLTSDVEKFMPIVYTPTVGLACQHYGLTFRRPRGLFITIHDKGHL TMLNSWPED+I
Sbjct: 121 FYRVLTSDVEKFMPIVYTPTVGLACQHYGLTFRRPRGLFITIHDKGHLATMLNSWPEDNI 180

Query: 632 K 634
           K
Sbjct: 181 K 181


>ref|NP_006671.2| malic enzyme 3, NADP(+)-dependent, mitochondrial [Homo sapiens]
          Length = 604

 Score =  320 bits (820), Expect = 1e-87
 Identities = 156/181 (86%), Positives = 162/181 (89%)
 Frame = +2

Query: 92  MGASLGSGARVALLPRQACGAVXXXXXXXXXXDCHSKTGLPRPVPLKKRGYDVTRNPHLN 271
           MGA+LG+G R+A  P +ACGA+           CHSK G  RPVPLKKRGYDVTRNPHLN
Sbjct: 1   MGAALGTGTRLAPWPGRACGALPRWTPTAPAQGCHSKPGPARPVPLKKRGYDVTRNPHLN 60

Query: 272 KGMAFTLEERLQLGIHGLIPPCFLSQDVQLLRIMRYYERQQSDLDKYIILMTLQDRNEKL 451
           KGMAFTLEERLQLGIHGLIPPCFLSQDVQLLRIMRYYERQQSDLDKYIILMTLQDRNEKL
Sbjct: 61  KGMAFTLEERLQLGIHGLIPPCFLSQDVQLLRIMRYYERQQSDLDKYIILMTLQDRNEKL 120

Query: 452 FYRVLTSDVEKFMPIVYTPTVGLACQHYGLTFRRPRGLFITIHDKGHLPTMLNSWPEDDI 631
           FYRVLTSDVEKFMPIVYTPTVGLACQHYGLTFRRPRGLFITIHDKGHL TMLNSWPED+I
Sbjct: 121 FYRVLTSDVEKFMPIVYTPTVGLACQHYGLTFRRPRGLFITIHDKGHLATMLNSWPEDNI 180

Query: 632 K 634
           K
Sbjct: 181 K 181


>ref|NP_002386.1| cytosolic malic enzyme 1 [Homo sapiens]
          Length = 572

 Score =  213 bits (543), Expect = 2e-55
 Identities = 98/141 (69%), Positives = 119/141 (84%)
 Frame = +2

Query: 212 PRPVPLKKRGYDVTRNPHLNKGMAFTLEERLQLGIHGLIPPCFLSQDVQLLRIMRYYERQ 391
           PR     +RGY +TRNPHLNK +AFTLEER QL IHGL+PP F SQ++Q+LR+++ +E  
Sbjct: 6   PRRRHTHQRGYLLTRNPHLNKDLAFTLEERQQLNIHGLLPPSFNSQEIQVLRVVKNFEHL 65

Query: 392 QSDLDKYIILMTLQDRNEKLFYRVLTSDVEKFMPIVYTPTVGLACQHYGLTFRRPRGLFI 571
            SD D+Y++LM LQDRNEKLFYRVLTSD+EKFMPIVYTPTVGLACQ Y L FR+PRGLFI
Sbjct: 66  NSDFDRYLLLMDLQDRNEKLFYRVLTSDIEKFMPIVYTPTVGLACQQYSLVFRKPRGLFI 125

Query: 572 TIHDKGHLPTMLNSWPEDDIK 634
           TIHD+GH+ ++LN+WPED IK
Sbjct: 126 TIHDRGHIASVLNAWPEDVIK 146


>ref|NP_002387.1| malic enzyme 2, NAD(+)-dependent, mitochondrial [Homo sapiens]
          Length = 584

 Score =  168 bits (425), Expect = 8e-42
 Identities = 76/140 (54%), Positives = 105/140 (75%)
 Frame = +2

Query: 215 RPVPLKKRGYDVTRNPHLNKGMAFTLEERLQLGIHGLIPPCFLSQDVQLLRIMRYYERQQ 394
           R + +K++G  +  NP  NKGMAFTL+ER  LG+ GL+PP   +QD+Q LR  R  ++  
Sbjct: 17  RHLHIKEKGKPLMLNPRTNKGMAFTLQERQMLGLQGLLPPKIETQDIQALRFHRNLKKMT 76

Query: 395 SDLDKYIILMTLQDRNEKLFYRVLTSDVEKFMPIVYTPTVGLACQHYGLTFRRPRGLFIT 574
           S L+KYI +M +Q+RNEKLFYR+L  D+E  MPIVYTPTVGLAC  YG  FRRP+GLFI+
Sbjct: 77  SPLEKYIYIMGIQERNEKLFYRILQDDIESLMPIVYTPTVGLACSQYGHIFRRPKGLFIS 136

Query: 575 IHDKGHLPTMLNSWPEDDIK 634
           I D+GH+ +++++WPE+ +K
Sbjct: 137 ISDRGHVRSIVDNWPENHVK 156


>ref|XP_934770.1| PREDICTED: similar to NAD-dependent malic enzyme, mitochondrial
           precursor (NAD-ME) (Malic enzyme 2) [Homo sapiens]
          Length = 196

 Score =  101 bits (252), Expect = 9e-22
 Identities = 43/80 (53%), Positives = 59/80 (73%)
 Frame = +2

Query: 395 SDLDKYIILMTLQDRNEKLFYRVLTSDVEKFMPIVYTPTVGLACQHYGLTFRRPRGLFIT 574
           S  + YI +M +Q+RN+KLFYR+L  D E  MPI YTPTVGL C   G  FRRP+GLFI+
Sbjct: 3   SPSENYIYIMGIQERNDKLFYRILQDDTESLMPIAYTPTVGLVCSQCGHLFRRPKGLFIS 62

Query: 575 IHDKGHLPTMLNSWPEDDIK 634
           I D+GH+ ++++ WPE+ +K
Sbjct: 63  ISDRGHVRSIVDKWPENHVK 82


>ref|XP_944182.1| PREDICTED: similar to NAD-dependent malic enzyme, mitochondrial
           precursor (NAD-ME) (Malic enzyme 2) [Homo sapiens]
          Length = 196

 Score =  101 bits (252), Expect = 9e-22
 Identities = 43/80 (53%), Positives = 59/80 (73%)
 Frame = +2

Query: 395 SDLDKYIILMTLQDRNEKLFYRVLTSDVEKFMPIVYTPTVGLACQHYGLTFRRPRGLFIT 574
           S  + YI +M +Q+RN+KLFYR+L  D E  MPI YTPTVGL C   G  FRRP+GLFI+
Sbjct: 3   SPSENYIYIMGIQERNDKLFYRILQDDTESLMPIAYTPTVGLVCSQCGHLFRRPKGLFIS 62

Query: 575 IHDKGHLPTMLNSWPEDDIK 634
           I D+GH+ ++++ WPE+ +K
Sbjct: 63  ISDRGHVRSIVDKWPENHVK 82


  Database: RefSeqHP
    Posted date:  Aug 2, 2006 12:57 AM
  Number of letters in database: 17,774,539
  Number of sequences in database:  39,411
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 40,479,770
Number of Sequences: 39411
Number of extensions: 1049369
Number of successful extensions: 5874
Number of sequences better than 1.0e-05: 6
Number of HSP's better than  0.0 without gapping: 3784
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5701
length of database: 17,774,539
effective HSP length: 103
effective length of database: 13,715,206
effective search space used: 3428801500
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqMP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611S-027900
         (1062 letters)

Database: RefSeqMP 
           45,328 sequences; 21,768,885 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_852072.1| malic enzyme 3, NADP(+)-dependent, mitochondria...   318   5e-87
Alignment   gi|NP_032641.1| malic enzyme, supernatant [Mus musculus]             211   8e-55
Alignment   gi|XP_001004679.1| PREDICTED: similar to NADP-dependent malic e...   189   6e-48
Alignment   gi|XP_001004685.1| PREDICTED: similar to NADP-dependent malic e...   189   6e-48
Alignment   gi|NP_663469.1| malic enzyme 2, NAD(+)-dependent, mitochondrial...   169   6e-42

>ref|NP_852072.1| malic enzyme 3, NADP(+)-dependent, mitochondrial [Mus musculus]
          Length = 604

 Score =  318 bits (816), Expect = 5e-87
 Identities = 153/181 (84%), Positives = 162/181 (89%)
 Frame = +2

Query: 92  MGASLGSGARVALLPRQACGAVXXXXXXXXXXDCHSKTGLPRPVPLKKRGYDVTRNPHLN 271
           MGA+LG+GAR+  +PR AC ++           CHSK+G PRPVPLKKRGYDVTRNPHLN
Sbjct: 1   MGAALGTGARLTSVPRIACSSLRRQAPSAPAQGCHSKSGPPRPVPLKKRGYDVTRNPHLN 60

Query: 272 KGMAFTLEERLQLGIHGLIPPCFLSQDVQLLRIMRYYERQQSDLDKYIILMTLQDRNEKL 451
           KGMAFTLEERLQLGIHGLIPPCFLSQDVQLLRIMRYYE QQSDLDKYIILMT QDRNEKL
Sbjct: 61  KGMAFTLEERLQLGIHGLIPPCFLSQDVQLLRIMRYYENQQSDLDKYIILMTHQDRNEKL 120

Query: 452 FYRVLTSDVEKFMPIVYTPTVGLACQHYGLTFRRPRGLFITIHDKGHLPTMLNSWPEDDI 631
           FYRVLTSDVEKFMPIVYTPTVGLACQHYGLTFRRPRGLFITIHDKGH+ TMLNSWPED+I
Sbjct: 121 FYRVLTSDVEKFMPIVYTPTVGLACQHYGLTFRRPRGLFITIHDKGHIATMLNSWPEDNI 180

Query: 632 K 634
           K
Sbjct: 181 K 181


>ref|NP_032641.1| malic enzyme, supernatant [Mus musculus]
          Length = 572

 Score =  211 bits (538), Expect = 8e-55
 Identities = 97/141 (68%), Positives = 119/141 (84%)
 Frame = +2

Query: 212 PRPVPLKKRGYDVTRNPHLNKGMAFTLEERLQLGIHGLIPPCFLSQDVQLLRIMRYYERQ 391
           PR     +RGY +TR+PHLNK +AFTLEER QL IHGL+PPC +SQ++Q+LRI++ +ER 
Sbjct: 6   PRRRHTHQRGYLLTRDPHLNKDLAFTLEERQQLNIHGLLPPCIISQELQVLRIIKNFERL 65

Query: 392 QSDLDKYIILMTLQDRNEKLFYRVLTSDVEKFMPIVYTPTVGLACQHYGLTFRRPRGLFI 571
            SD D+Y++LM LQDRNEKLFY VL SDVEKFMPIVYTPTVGLACQ Y L FR+PRGLFI
Sbjct: 66  NSDFDRYLLLMDLQDRNEKLFYSVLMSDVEKFMPIVYTPTVGLACQQYSLAFRKPRGLFI 125

Query: 572 TIHDKGHLPTMLNSWPEDDIK 634
           +IHDKGH+ ++LN+WPED +K
Sbjct: 126 SIHDKGHIASVLNAWPEDVVK 146


>ref|XP_001004679.1| PREDICTED: similar to NADP-dependent malic enzyme (NADP-ME) (Malic
           enzyme 1) isoform 1 [Mus musculus]
          Length = 554

 Score =  189 bits (479), Expect = 6e-48
 Identities = 85/119 (71%), Positives = 104/119 (87%)
 Frame = +2

Query: 278 MAFTLEERLQLGIHGLIPPCFLSQDVQLLRIMRYYERQQSDLDKYIILMTLQDRNEKLFY 457
           +AFTLEER QL IHGL+PPC +SQ++Q+LRI++ +ER  SD D+Y++LM LQDRNEKLFY
Sbjct: 8   LAFTLEERQQLNIHGLLPPCIISQELQVLRIIKNFERLNSDFDRYLLLMDLQDRNEKLFY 67

Query: 458 RVLTSDVEKFMPIVYTPTVGLACQHYGLTFRRPRGLFITIHDKGHLPTMLNSWPEDDIK 634
            VL SDVEKFMPIVYTPTVGLACQ Y L FR+PRGLFI+IHDKGH+ ++LN+WPED +K
Sbjct: 68  SVLMSDVEKFMPIVYTPTVGLACQQYSLAFRKPRGLFISIHDKGHIASVLNAWPEDVVK 126


>ref|XP_001004685.1| PREDICTED: similar to NADP-dependent malic enzyme (NADP-ME) (Malic
           enzyme 1) isoform 4 [Mus musculus]
          Length = 552

 Score =  189 bits (479), Expect = 6e-48
 Identities = 85/119 (71%), Positives = 104/119 (87%)
 Frame = +2

Query: 278 MAFTLEERLQLGIHGLIPPCFLSQDVQLLRIMRYYERQQSDLDKYIILMTLQDRNEKLFY 457
           +AFTLEER QL IHGL+PPC +SQ++Q+LRI++ +ER  SD D+Y++LM LQDRNEKLFY
Sbjct: 8   LAFTLEERQQLNIHGLLPPCIISQELQVLRIIKNFERLNSDFDRYLLLMDLQDRNEKLFY 67

Query: 458 RVLTSDVEKFMPIVYTPTVGLACQHYGLTFRRPRGLFITIHDKGHLPTMLNSWPEDDIK 634
            VL SDVEKFMPIVYTPTVGLACQ Y L FR+PRGLFI+IHDKGH+ ++LN+WPED +K
Sbjct: 68  SVLMSDVEKFMPIVYTPTVGLACQQYSLAFRKPRGLFISIHDKGHIASVLNAWPEDVVK 126


>ref|NP_663469.1| malic enzyme 2, NAD(+)-dependent, mitochondrial [Mus musculus]
          Length = 589

 Score =  169 bits (427), Expect = 6e-42
 Identities = 78/140 (55%), Positives = 105/140 (75%)
 Frame = +2

Query: 215 RPVPLKKRGYDVTRNPHLNKGMAFTLEERLQLGIHGLIPPCFLSQDVQLLRIMRYYERQQ 394
           R V LK++G  +  NP  NKGMAFTL+ER  LG+ GL+PP   +QD+Q LR  R  ++  
Sbjct: 17  RRVHLKEKGKPLMLNPRTNKGMAFTLQERQMLGLQGLLPPKIETQDIQALRFHRNLKKMT 76

Query: 395 SDLDKYIILMTLQDRNEKLFYRVLTSDVEKFMPIVYTPTVGLACQHYGLTFRRPRGLFIT 574
           S L+KYI +M +Q+RNEKLFYR+L  D+E  MPIVYTPTVGLAC  YG  FRRP+GLFI+
Sbjct: 77  SPLEKYIYIMGIQERNEKLFYRILQDDIESLMPIVYTPTVGLACCQYGHIFRRPKGLFIS 136

Query: 575 IHDKGHLPTMLNSWPEDDIK 634
           I D+GH+ +++++WPE+ +K
Sbjct: 137 ISDRGHVRSIVDNWPENHVK 156


  Database: RefSeqMP
    Posted date:  Aug 2, 2006 12:58 AM
  Number of letters in database: 21,768,885
  Number of sequences in database:  45,328
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 47,684,244
Number of Sequences: 45328
Number of extensions: 1177953
Number of successful extensions: 5172
Number of sequences better than 1.0e-05: 5
Number of HSP's better than  0.0 without gapping: 3774
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5033
length of database: 21,768,885
effective HSP length: 104
effective length of database: 17,054,773
effective search space used: 4246638477
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqCP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611S-027900
         (1062 letters)

Database: RefSeqCP 
           33,732 sequences; 19,266,565 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|XP_848770.1| PREDICTED: similar to malic enzyme 3, NADP(+)-d...   311   7e-85
Alignment   gi|XP_857227.1| PREDICTED: similar to malic enzyme 3, NADP(+)-d...   241   7e-64
Alignment   gi|XP_857177.1| PREDICTED: similar to malic enzyme 3, NADP(+)-d...   241   7e-64
Alignment   gi|XP_857135.1| PREDICTED: similar to malic enzyme 3, NADP(+)-d...   241   7e-64
Alignment   gi|XP_857051.1| PREDICTED: similar to malic enzyme 3, NADP(+)-d...   241   7e-64
Alignment   gi|XP_542269.2| PREDICTED: similar to malic enzyme 3, NADP(+)-d...   227   2e-59
Alignment   gi|XP_532217.2| PREDICTED: similar to NADP-dependent malic enzy...   191   1e-48
Alignment   gi|XP_849530.1| PREDICTED: similar to NAD-dependent malic enzym...   166   3e-41
Alignment   gi|XP_533402.2| PREDICTED: similar to NAD-dependent malic enzym...   105   1e-22

>ref|XP_848770.1| PREDICTED: similar to malic enzyme 3, NADP(+)-dependent,
           mitochondrial isoform 2 [Canis familiaris]
          Length = 604

 Score =  311 bits (797), Expect = 7e-85
 Identities = 155/181 (85%), Positives = 158/181 (87%)
 Frame = +2

Query: 92  MGASLGSGARVALLPRQACGAVXXXXXXXXXXDCHSKTGLPRPVPLKKRGYDVTRNPHLN 271
           MGA+LG GAR  LL  +A GAV           C S+ G  RPVPLKKRGYDVTRNPHLN
Sbjct: 1   MGAALGRGARPGLLRGKAWGAVPRWTPSAPGRGCRSRAGPARPVPLKKRGYDVTRNPHLN 60

Query: 272 KGMAFTLEERLQLGIHGLIPPCFLSQDVQLLRIMRYYERQQSDLDKYIILMTLQDRNEKL 451
           KGMAFTLEERLQLGIHGLIPPCFLSQDVQLLRIMRYYERQQSDLDKYIILMTLQDRNEKL
Sbjct: 61  KGMAFTLEERLQLGIHGLIPPCFLSQDVQLLRIMRYYERQQSDLDKYIILMTLQDRNEKL 120

Query: 452 FYRVLTSDVEKFMPIVYTPTVGLACQHYGLTFRRPRGLFITIHDKGHLPTMLNSWPEDDI 631
           FYRVLTSDVEKFMPIVYTPTVGLACQ YGLTFRRPRGLFITIHDKGHL TMLNSWPEDDI
Sbjct: 121 FYRVLTSDVEKFMPIVYTPTVGLACQQYGLTFRRPRGLFITIHDKGHLATMLNSWPEDDI 180

Query: 632 K 634
           K
Sbjct: 181 K 181


>ref|XP_857227.1| PREDICTED: similar to malic enzyme 3, NADP(+)-dependent,
           mitochondrial isoform 7 [Canis familiaris]
          Length = 562

 Score =  241 bits (616), Expect = 7e-64
 Identities = 117/119 (98%), Positives = 117/119 (98%)
 Frame = +2

Query: 278 MAFTLEERLQLGIHGLIPPCFLSQDVQLLRIMRYYERQQSDLDKYIILMTLQDRNEKLFY 457
           MAFTLEERLQLGIHGLIPPCFLSQDVQLLRIMRYYERQQSDLDKYIILMTLQDRNEKLFY
Sbjct: 1   MAFTLEERLQLGIHGLIPPCFLSQDVQLLRIMRYYERQQSDLDKYIILMTLQDRNEKLFY 60

Query: 458 RVLTSDVEKFMPIVYTPTVGLACQHYGLTFRRPRGLFITIHDKGHLPTMLNSWPEDDIK 634
           RVLTSDVEKFMPIVYTPTVGLACQ YGLTFRRPRGLFITIHDKGHL TMLNSWPEDDIK
Sbjct: 61  RVLTSDVEKFMPIVYTPTVGLACQQYGLTFRRPRGLFITIHDKGHLATMLNSWPEDDIK 119


>ref|XP_857177.1| PREDICTED: similar to malic enzyme 3, NADP(+)-dependent,
           mitochondrial isoform 6 [Canis familiaris]
          Length = 513

 Score =  241 bits (616), Expect = 7e-64
 Identities = 117/119 (98%), Positives = 117/119 (98%)
 Frame = +2

Query: 278 MAFTLEERLQLGIHGLIPPCFLSQDVQLLRIMRYYERQQSDLDKYIILMTLQDRNEKLFY 457
           MAFTLEERLQLGIHGLIPPCFLSQDVQLLRIMRYYERQQSDLDKYIILMTLQDRNEKLFY
Sbjct: 1   MAFTLEERLQLGIHGLIPPCFLSQDVQLLRIMRYYERQQSDLDKYIILMTLQDRNEKLFY 60

Query: 458 RVLTSDVEKFMPIVYTPTVGLACQHYGLTFRRPRGLFITIHDKGHLPTMLNSWPEDDIK 634
           RVLTSDVEKFMPIVYTPTVGLACQ YGLTFRRPRGLFITIHDKGHL TMLNSWPEDDIK
Sbjct: 61  RVLTSDVEKFMPIVYTPTVGLACQQYGLTFRRPRGLFITIHDKGHLATMLNSWPEDDIK 119


>ref|XP_857135.1| PREDICTED: similar to malic enzyme 3, NADP(+)-dependent,
           mitochondrial isoform 5 [Canis familiaris]
          Length = 573

 Score =  241 bits (616), Expect = 7e-64
 Identities = 117/119 (98%), Positives = 117/119 (98%)
 Frame = +2

Query: 278 MAFTLEERLQLGIHGLIPPCFLSQDVQLLRIMRYYERQQSDLDKYIILMTLQDRNEKLFY 457
           MAFTLEERLQLGIHGLIPPCFLSQDVQLLRIMRYYERQQSDLDKYIILMTLQDRNEKLFY
Sbjct: 1   MAFTLEERLQLGIHGLIPPCFLSQDVQLLRIMRYYERQQSDLDKYIILMTLQDRNEKLFY 60

Query: 458 RVLTSDVEKFMPIVYTPTVGLACQHYGLTFRRPRGLFITIHDKGHLPTMLNSWPEDDIK 634
           RVLTSDVEKFMPIVYTPTVGLACQ YGLTFRRPRGLFITIHDKGHL TMLNSWPEDDIK
Sbjct: 61  RVLTSDVEKFMPIVYTPTVGLACQQYGLTFRRPRGLFITIHDKGHLATMLNSWPEDDIK 119


>ref|XP_857051.1| PREDICTED: similar to malic enzyme 3, NADP(+)-dependent,
           mitochondrial isoform 3 [Canis familiaris]
          Length = 361

 Score =  241 bits (616), Expect = 7e-64
 Identities = 117/119 (98%), Positives = 117/119 (98%)
 Frame = +2

Query: 278 MAFTLEERLQLGIHGLIPPCFLSQDVQLLRIMRYYERQQSDLDKYIILMTLQDRNEKLFY 457
           MAFTLEERLQLGIHGLIPPCFLSQDVQLLRIMRYYERQQSDLDKYIILMTLQDRNEKLFY
Sbjct: 1   MAFTLEERLQLGIHGLIPPCFLSQDVQLLRIMRYYERQQSDLDKYIILMTLQDRNEKLFY 60

Query: 458 RVLTSDVEKFMPIVYTPTVGLACQHYGLTFRRPRGLFITIHDKGHLPTMLNSWPEDDIK 634
           RVLTSDVEKFMPIVYTPTVGLACQ YGLTFRRPRGLFITIHDKGHL TMLNSWPEDDIK
Sbjct: 61  RVLTSDVEKFMPIVYTPTVGLACQQYGLTFRRPRGLFITIHDKGHLATMLNSWPEDDIK 119


>ref|XP_542269.2| PREDICTED: similar to malic enzyme 3, NADP(+)-dependent,
           mitochondrial isoform 1 [Canis familiaris]
          Length = 569

 Score =  227 bits (578), Expect = 2e-59
 Identities = 117/146 (80%), Positives = 117/146 (80%), Gaps = 27/146 (18%)
 Frame = +2

Query: 278 MAFTLEERLQLGIHGLIPPCFLSQDVQLLRIMRYYERQQSDLDKYIILMTLQDRNEKLFY 457
           MAFTLEERLQLGIHGLIPPCFLSQDVQLLRIMRYYERQQSDLDKYIILMTLQDRNEKLFY
Sbjct: 1   MAFTLEERLQLGIHGLIPPCFLSQDVQLLRIMRYYERQQSDLDKYIILMTLQDRNEKLFY 60

Query: 458 RVLTSDVEKFMPIVYTPTVGLACQHYGLTFRRP--------------------------- 556
           RVLTSDVEKFMPIVYTPTVGLACQ YGLTFRRP                           
Sbjct: 61  RVLTSDVEKFMPIVYTPTVGLACQQYGLTFRRPRSAKEGLRGESHYGVDSLSSEGLSCSA 120

Query: 557 RGLFITIHDKGHLPTMLNSWPEDDIK 634
           RGLFITIHDKGHL TMLNSWPEDDIK
Sbjct: 121 RGLFITIHDKGHLATMLNSWPEDDIK 146


>ref|XP_532217.2| PREDICTED: similar to NADP-dependent malic enzyme (NADP-ME) (Malic
           enzyme 1) [Canis familiaris]
          Length = 634

 Score =  191 bits (485), Expect = 1e-48
 Identities = 86/119 (72%), Positives = 105/119 (88%)
 Frame = +2

Query: 278 MAFTLEERLQLGIHGLIPPCFLSQDVQLLRIMRYYERQQSDLDKYIILMTLQDRNEKLFY 457
           +AFTLEER QL IHGL+PPCF+SQD+Q+LRI++ +ER  SD D+Y++LM LQDRNEKLFY
Sbjct: 90  LAFTLEERQQLNIHGLLPPCFISQDIQVLRIIKNFERLTSDFDRYLLLMDLQDRNEKLFY 149

Query: 458 RVLTSDVEKFMPIVYTPTVGLACQHYGLTFRRPRGLFITIHDKGHLPTMLNSWPEDDIK 634
            VL SD+EKFMPIVYTPTVGLACQ Y L FR+PRGLFI+IHD+GH+ ++LN+WPED IK
Sbjct: 150 SVLMSDLEKFMPIVYTPTVGLACQQYSLAFRKPRGLFISIHDRGHIASVLNAWPEDVIK 208


>ref|XP_849530.1| PREDICTED: similar to NAD-dependent malic enzyme, mitochondrial
           precursor (NAD-ME) (Malic enzyme 2) isoform 2 [Canis
           familiaris]
          Length = 584

 Score =  166 bits (421), Expect = 3e-41
 Identities = 74/140 (52%), Positives = 104/140 (74%)
 Frame = +2

Query: 215 RPVPLKKRGYDVTRNPHLNKGMAFTLEERLQLGIHGLIPPCFLSQDVQLLRIMRYYERQQ 394
           R + +K++G  +  NP  NKGMAFTL+ER  LG+ GL+PP   +QD+Q LR  +  ++  
Sbjct: 17  RHIHIKEKGKPLMLNPRTNKGMAFTLQERQMLGLQGLLPPKIETQDIQALRFHKNVKKMN 76

Query: 395 SDLDKYIILMTLQDRNEKLFYRVLTSDVEKFMPIVYTPTVGLACQHYGLTFRRPRGLFIT 574
             L+KYI +M +Q+RNEKLFYR+L  D+E  MPIVYTPTVGLAC  YG  FRRP+GLFI+
Sbjct: 77  GPLEKYIYIMGIQERNEKLFYRILQDDIESLMPIVYTPTVGLACSQYGHIFRRPKGLFIS 136

Query: 575 IHDKGHLPTMLNSWPEDDIK 634
           I D+GH+ +++++WPE+ +K
Sbjct: 137 ISDRGHVRSIVDNWPENHVK 156


>ref|XP_533402.2| PREDICTED: similar to NAD-dependent malic enzyme, mitochondrial
           precursor (NAD-ME) (Malic enzyme 2) isoform 1 [Canis
           familiaris]
          Length = 499

 Score =  105 bits (261), Expect = 1e-22
 Identities = 44/71 (61%), Positives = 59/71 (83%)
 Frame = +2

Query: 422 MTLQDRNEKLFYRVLTSDVEKFMPIVYTPTVGLACQHYGLTFRRPRGLFITIHDKGHLPT 601
           M +Q+RNEKLFYR+L  D+E  MPIVYTPTVGLAC  YG  FRRP+GLFI+I D+GH+ +
Sbjct: 1   MGIQERNEKLFYRILQDDIESLMPIVYTPTVGLACSQYGHIFRRPKGLFISISDRGHVRS 60

Query: 602 MLNSWPEDDIK 634
           ++++WPE+ +K
Sbjct: 61  IVDNWPENHVK 71


  Database: RefSeqCP
    Posted date:  Aug 1, 2006  9:25 PM
  Number of letters in database: 19,266,565
  Number of sequences in database:  33,732
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 41,781,054
Number of Sequences: 33732
Number of extensions: 1045850
Number of successful extensions: 5207
Number of sequences better than 1.0e-05: 9
Number of HSP's better than  0.0 without gapping: 3661
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5078
length of database: 19,266,565
effective HSP length: 104
effective length of database: 15,758,437
effective search space used: 3923850813
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)