Animal-Genome cDNA 20060611S-031595


Search to RefSeqSP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611S-031595
         (1162 letters)

Database: RefSeqSP 
           1040 sequences; 434,620 total letters

Searching...done

 ***** No hits found ******

  Database: RefSeqSP
    Posted date:  Aug 1, 2006  7:14 PM
  Number of letters in database: 434,620
  Number of sequences in database:  1040
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 881,638
Number of Sequences: 1040
Number of extensions: 21216
Number of successful extensions: 129
Number of sequences better than 1.0e-05: 0
Number of HSP's better than  0.0 without gapping: 72
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 127
length of database: 434,620
effective HSP length: 78
effective length of database: 353,500
effective search space used: 108878000
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqBP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611S-031595
         (1162 letters)

Database: RefSeqBP 
           33,508 sequences; 16,112,626 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|XP_604169.2| PREDICTED: similar to malic enzyme 3, NADP(+)-d...   101   2e-25
Alignment   gi|XP_613987.2| PREDICTED: similar to NADP-dependent malic enzy...    73   4e-16
Alignment   gi|XP_584500.2| PREDICTED: similar to NAD-dependent malic enzym...    68   2e-11

>ref|XP_604169.2| PREDICTED: similar to malic enzyme 3, NADP(+)-dependent,
           mitochondrial [Bos taurus]
          Length = 564

 Score =  101 bits (251), Expect(2) = 2e-25
 Identities = 50/66 (75%), Positives = 53/66 (80%)
 Frame = +3

Query: 261 MAFTLEERLPLGIHGQIPPCFMRHDFQLLRAVRYYHPQQSDLHQYIILMTPPDRNEKLFY 440
           MAFTLEERL LGIHG IPPCF+  D QLLR +RYY  QQSDL +YIILMT  DRNEKLFY
Sbjct: 1   MAFTLEERLQLGIHGLIPPCFLSQDVQLLRVMRYYERQQSDLDKYIILMTLQDRNEKLFY 60

Query: 441 PVLPSD 458
            VL SD
Sbjct: 61  RVLTSD 66



 Score = 33.5 bits (75), Expect(2) = 2e-25
 Identities = 22/49 (44%), Positives = 27/49 (55%)
 Frame = +1

Query: 460 VEKFPPIVYPPPRRERACQPYGLDFDTPRRPFNPIS*LRPTFLSLLHSW 606
           VEKF PIVY P     ACQ YGL F  PR  F  +   +    ++L+SW
Sbjct: 67  VEKFLPIVYTPTVG-LACQHYGLTFRRPRGLFITVH-DKGHLATMLNSW 113


>ref|XP_613987.2| PREDICTED: similar to NADP-dependent malic enzyme (NADP-ME) (Malic
           enzyme 1) [Bos taurus]
          Length = 472

 Score = 73.2 bits (178), Expect(2) = 4e-16
 Identities = 35/66 (53%), Positives = 45/66 (68%)
 Frame = +3

Query: 261 MAFTLEERLPLGIHGQIPPCFMRHDFQLLRAVRYYHPQQSDLHQYIILMTPPDRNEKLFY 440
           +AFTLEER  L IHG +PP F+  D Q+LR ++ +    SD  +Y++LM   DRNEKLFY
Sbjct: 15  LAFTLEERQQLNIHGLLPPSFISQDVQVLRVLKNFERLNSDFDRYLLLMDLQDRNEKLFY 74

Query: 441 PVLPSD 458
            VL SD
Sbjct: 75  KVLMSD 80



 Score = 30.0 bits (66), Expect(2) = 4e-16
 Identities = 16/29 (55%), Positives = 17/29 (58%)
 Frame = +1

Query: 460 VEKFPPIVYPPPRRERACQPYGLDFDTPR 546
           +EKF PIVY  P    ACQ Y L F  PR
Sbjct: 81  IEKFMPIVY-TPTVGLACQQYSLAFRKPR 108


>ref|XP_584500.2| PREDICTED: similar to NAD-dependent malic enzyme, mitochondrial
           precursor (NAD-ME) (Malic enzyme 2), partial [Bos
           taurus]
          Length = 513

 Score = 67.8 bits (164), Expect = 2e-11
 Identities = 36/87 (41%), Positives = 48/87 (55%)
 Frame = +3

Query: 198 RPVPLNKRGYHVTRNPHLNQGMAFTLEERLPLGIHGQIPPCFMRHDFQLLRAVRYYHPQQ 377
           R +   ++G  +  NP  N+GMAFTL+ER  LG+ G +PP     D Q LR  R      
Sbjct: 92  RHLHTKEKGKPLMLNPRTNKGMAFTLQERQMLGLQGLLPPKIETQDIQALRFHRNLKKLN 151

Query: 378 SDLHQYIILMTPPDRNEKLFYPVLPSD 458
             L +YI +M   +RNEKLFY +L  D
Sbjct: 152 GPLEKYIYIMGIQERNEKLFYRILQDD 178


  Database: RefSeqBP
    Posted date:  Aug 1, 2006  7:14 PM
  Number of letters in database: 16,112,626
  Number of sequences in database:  33,508
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 33,850,060
Number of Sequences: 33508
Number of extensions: 870751
Number of successful extensions: 4851
Number of sequences better than 1.0e-05: 3
Number of HSP's better than  0.0 without gapping: 3405
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4793
length of database: 16,112,626
effective HSP length: 103
effective length of database: 12,661,302
effective search space used: 3583148466
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqHP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611S-031595
         (1162 letters)

Database: RefSeqHP 
           39,411 sequences; 17,774,539 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_001014811.1| malic enzyme 3, NADP(+)-dependent, mitochond...   172   1e-46
Alignment   gi|NP_006671.2| malic enzyme 3, NADP(+)-dependent, mitochondria...   172   1e-46
Alignment   gi|NP_002386.1| cytosolic malic enzyme 1 [Homo sapiens]               96   2e-23
Alignment   gi|NP_002387.1| malic enzyme 2, NAD(+)-dependent, mitochondrial...    71   2e-12

>ref|NP_001014811.1| malic enzyme 3, NADP(+)-dependent, mitochondrial [Homo sapiens]
          Length = 604

 Score =  172 bits (435), Expect(2) = 1e-46
 Identities = 86/128 (67%), Positives = 95/128 (74%)
 Frame = +3

Query: 75  MGASLGSGARVALLPRQACGAVXXXXXXXXXXDCHSKTGLPRPVPLNKRGYHVTRNPHLN 254
           MGA+LG+G R+A  P +ACGA+           CHSK G  RPVPL KRGY VTRNPHLN
Sbjct: 1   MGAALGTGTRLAPWPGRACGALPRWTPTAPAQGCHSKPGPARPVPLKKRGYDVTRNPHLN 60

Query: 255 QGMAFTLEERLPLGIHGQIPPCFMRHDFQLLRAVRYYHPQQSDLHQYIILMTPPDRNEKL 434
           +GMAFTLEERL LGIHG IPPCF+  D QLLR +RYY  QQSDL +YIILMT  DRNEKL
Sbjct: 61  KGMAFTLEERLQLGIHGLIPPCFLSQDVQLLRIMRYYERQQSDLDKYIILMTLQDRNEKL 120

Query: 435 FYPVLPSD 458
           FY VL SD
Sbjct: 121 FYRVLTSD 128



 Score = 34.3 bits (77), Expect(2) = 1e-46
 Identities = 23/49 (46%), Positives = 27/49 (55%)
 Frame = +1

Query: 460 VEKFPPIVYPPPRRERACQPYGLDFDTPRRPFNPIS*LRPTFLSLLHSW 606
           VEKF PIVY P     ACQ YGL F  PR  F  I   +    ++L+SW
Sbjct: 129 VEKFMPIVYTPTVG-LACQHYGLTFRRPRGLFITIH-DKGHLATMLNSW 175


>ref|NP_006671.2| malic enzyme 3, NADP(+)-dependent, mitochondrial [Homo sapiens]
          Length = 604

 Score =  172 bits (435), Expect(2) = 1e-46
 Identities = 86/128 (67%), Positives = 95/128 (74%)
 Frame = +3

Query: 75  MGASLGSGARVALLPRQACGAVXXXXXXXXXXDCHSKTGLPRPVPLNKRGYHVTRNPHLN 254
           MGA+LG+G R+A  P +ACGA+           CHSK G  RPVPL KRGY VTRNPHLN
Sbjct: 1   MGAALGTGTRLAPWPGRACGALPRWTPTAPAQGCHSKPGPARPVPLKKRGYDVTRNPHLN 60

Query: 255 QGMAFTLEERLPLGIHGQIPPCFMRHDFQLLRAVRYYHPQQSDLHQYIILMTPPDRNEKL 434
           +GMAFTLEERL LGIHG IPPCF+  D QLLR +RYY  QQSDL +YIILMT  DRNEKL
Sbjct: 61  KGMAFTLEERLQLGIHGLIPPCFLSQDVQLLRIMRYYERQQSDLDKYIILMTLQDRNEKL 120

Query: 435 FYPVLPSD 458
           FY VL SD
Sbjct: 121 FYRVLTSD 128



 Score = 34.3 bits (77), Expect(2) = 1e-46
 Identities = 23/49 (46%), Positives = 27/49 (55%)
 Frame = +1

Query: 460 VEKFPPIVYPPPRRERACQPYGLDFDTPRRPFNPIS*LRPTFLSLLHSW 606
           VEKF PIVY P     ACQ YGL F  PR  F  I   +    ++L+SW
Sbjct: 129 VEKFMPIVYTPTVG-LACQHYGLTFRRPRGLFITIH-DKGHLATMLNSW 175


>ref|NP_002386.1| cytosolic malic enzyme 1 [Homo sapiens]
          Length = 572

 Score = 96.3 bits (238), Expect(2) = 2e-23
 Identities = 47/88 (53%), Positives = 60/88 (68%)
 Frame = +3

Query: 195 PRPVPLNKRGYHVTRNPHLNQGMAFTLEERLPLGIHGQIPPCFMRHDFQLLRAVRYYHPQ 374
           PR    ++RGY +TRNPHLN+ +AFTLEER  L IHG +PP F   + Q+LR V+ +   
Sbjct: 6   PRRRHTHQRGYLLTRNPHLNKDLAFTLEERQQLNIHGLLPPSFNSQEIQVLRVVKNFEHL 65

Query: 375 QSDLHQYIILMTPPDRNEKLFYPVLPSD 458
            SD  +Y++LM   DRNEKLFY VL SD
Sbjct: 66  NSDFDRYLLLMDLQDRNEKLFYRVLTSD 93



 Score = 32.0 bits (71), Expect(2) = 2e-23
 Identities = 22/49 (44%), Positives = 26/49 (53%)
 Frame = +1

Query: 460 VEKFPPIVYPPPRRERACQPYGLDFDTPRRPFNPIS*LRPTFLSLLHSW 606
           +EKF PIVY  P    ACQ Y L F  PR  F  I   R    S+L++W
Sbjct: 94  IEKFMPIVY-TPTVGLACQQYSLVFRKPRGLFITIH-DRGHIASVLNAW 140


>ref|NP_002387.1| malic enzyme 2, NAD(+)-dependent, mitochondrial [Homo sapiens]
          Length = 584

 Score = 70.9 bits (172), Expect = 2e-12
 Identities = 37/87 (42%), Positives = 50/87 (57%)
 Frame = +3

Query: 198 RPVPLNKRGYHVTRNPHLNQGMAFTLEERLPLGIHGQIPPCFMRHDFQLLRAVRYYHPQQ 377
           R + + ++G  +  NP  N+GMAFTL+ER  LG+ G +PP     D Q LR  R      
Sbjct: 17  RHLHIKEKGKPLMLNPRTNKGMAFTLQERQMLGLQGLLPPKIETQDIQALRFHRNLKKMT 76

Query: 378 SDLHQYIILMTPPDRNEKLFYPVLPSD 458
           S L +YI +M   +RNEKLFY +L  D
Sbjct: 77  SPLEKYIYIMGIQERNEKLFYRILQDD 103


  Database: RefSeqHP
    Posted date:  Aug 2, 2006 12:57 AM
  Number of letters in database: 17,774,539
  Number of sequences in database:  39,411
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 38,606,452
Number of Sequences: 39411
Number of extensions: 1036203
Number of successful extensions: 7131
Number of sequences better than 1.0e-05: 4
Number of HSP's better than  0.0 without gapping: 4373
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7033
length of database: 17,774,539
effective HSP length: 104
effective length of database: 13,675,795
effective search space used: 3856574190
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqCP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611S-031595
         (1162 letters)

Database: RefSeqCP 
           33,732 sequences; 19,266,565 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|XP_848770.1| PREDICTED: similar to malic enzyme 3, NADP(+)-d...   164   2e-44
Alignment   gi|XP_857135.1| PREDICTED: similar to malic enzyme 3, NADP(+)-d...   100   1e-25
Alignment   gi|XP_857227.1| PREDICTED: similar to malic enzyme 3, NADP(+)-d...   100   1e-25
Alignment   gi|XP_857177.1| PREDICTED: similar to malic enzyme 3, NADP(+)-d...   100   1e-25
Alignment   gi|XP_857051.1| PREDICTED: similar to malic enzyme 3, NADP(+)-d...   100   1e-25
Alignment   gi|XP_542269.2| PREDICTED: similar to malic enzyme 3, NADP(+)-d...   100   4e-25
Alignment   gi|XP_532217.2| PREDICTED: similar to NADP-dependent malic enzy...    79   3e-18
Alignment   gi|XP_849530.1| PREDICTED: similar to NAD-dependent malic enzym...    69   7e-12

>ref|XP_848770.1| PREDICTED: similar to malic enzyme 3, NADP(+)-dependent,
           mitochondrial isoform 2 [Canis familiaris]
          Length = 604

 Score =  164 bits (415), Expect(2) = 2e-44
 Identities = 85/128 (66%), Positives = 92/128 (71%)
 Frame = +3

Query: 75  MGASLGSGARVALLPRQACGAVXXXXXXXXXXDCHSKTGLPRPVPLNKRGYHVTRNPHLN 254
           MGA+LG GAR  LL  +A GAV           C S+ G  RPVPL KRGY VTRNPHLN
Sbjct: 1   MGAALGRGARPGLLRGKAWGAVPRWTPSAPGRGCRSRAGPARPVPLKKRGYDVTRNPHLN 60

Query: 255 QGMAFTLEERLPLGIHGQIPPCFMRHDFQLLRAVRYYHPQQSDLHQYIILMTPPDRNEKL 434
           +GMAFTLEERL LGIHG IPPCF+  D QLLR +RYY  QQSDL +YIILMT  DRNEKL
Sbjct: 61  KGMAFTLEERLQLGIHGLIPPCFLSQDVQLLRIMRYYERQQSDLDKYIILMTLQDRNEKL 120

Query: 435 FYPVLPSD 458
           FY VL SD
Sbjct: 121 FYRVLTSD 128



 Score = 34.7 bits (78), Expect(2) = 2e-44
 Identities = 23/49 (46%), Positives = 27/49 (55%)
 Frame = +1

Query: 460 VEKFPPIVYPPPRRERACQPYGLDFDTPRRPFNPIS*LRPTFLSLLHSW 606
           VEKF PIVY P     ACQ YGL F  PR  F  I   +    ++L+SW
Sbjct: 129 VEKFMPIVYTPTVG-LACQQYGLTFRRPRGLFITIH-DKGHLATMLNSW 175


>ref|XP_857135.1| PREDICTED: similar to malic enzyme 3, NADP(+)-dependent,
           mitochondrial isoform 5 [Canis familiaris]
          Length = 573

 Score =  100 bits (250), Expect(2) = 1e-25
 Identities = 50/66 (75%), Positives = 53/66 (80%)
 Frame = +3

Query: 261 MAFTLEERLPLGIHGQIPPCFMRHDFQLLRAVRYYHPQQSDLHQYIILMTPPDRNEKLFY 440
           MAFTLEERL LGIHG IPPCF+  D QLLR +RYY  QQSDL +YIILMT  DRNEKLFY
Sbjct: 1   MAFTLEERLQLGIHGLIPPCFLSQDVQLLRIMRYYERQQSDLDKYIILMTLQDRNEKLFY 60

Query: 441 PVLPSD 458
            VL SD
Sbjct: 61  RVLTSD 66



 Score = 34.7 bits (78), Expect(2) = 1e-25
 Identities = 23/49 (46%), Positives = 27/49 (55%)
 Frame = +1

Query: 460 VEKFPPIVYPPPRRERACQPYGLDFDTPRRPFNPIS*LRPTFLSLLHSW 606
           VEKF PIVY P     ACQ YGL F  PR  F  I   +    ++L+SW
Sbjct: 67  VEKFMPIVYTPTVG-LACQQYGLTFRRPRGLFITIH-DKGHLATMLNSW 113


>ref|XP_857227.1| PREDICTED: similar to malic enzyme 3, NADP(+)-dependent,
           mitochondrial isoform 7 [Canis familiaris]
          Length = 562

 Score =  100 bits (250), Expect(2) = 1e-25
 Identities = 50/66 (75%), Positives = 53/66 (80%)
 Frame = +3

Query: 261 MAFTLEERLPLGIHGQIPPCFMRHDFQLLRAVRYYHPQQSDLHQYIILMTPPDRNEKLFY 440
           MAFTLEERL LGIHG IPPCF+  D QLLR +RYY  QQSDL +YIILMT  DRNEKLFY
Sbjct: 1   MAFTLEERLQLGIHGLIPPCFLSQDVQLLRIMRYYERQQSDLDKYIILMTLQDRNEKLFY 60

Query: 441 PVLPSD 458
            VL SD
Sbjct: 61  RVLTSD 66



 Score = 34.7 bits (78), Expect(2) = 1e-25
 Identities = 23/49 (46%), Positives = 27/49 (55%)
 Frame = +1

Query: 460 VEKFPPIVYPPPRRERACQPYGLDFDTPRRPFNPIS*LRPTFLSLLHSW 606
           VEKF PIVY P     ACQ YGL F  PR  F  I   +    ++L+SW
Sbjct: 67  VEKFMPIVYTPTVG-LACQQYGLTFRRPRGLFITIH-DKGHLATMLNSW 113


>ref|XP_857177.1| PREDICTED: similar to malic enzyme 3, NADP(+)-dependent,
           mitochondrial isoform 6 [Canis familiaris]
          Length = 513

 Score =  100 bits (250), Expect(2) = 1e-25
 Identities = 50/66 (75%), Positives = 53/66 (80%)
 Frame = +3

Query: 261 MAFTLEERLPLGIHGQIPPCFMRHDFQLLRAVRYYHPQQSDLHQYIILMTPPDRNEKLFY 440
           MAFTLEERL LGIHG IPPCF+  D QLLR +RYY  QQSDL +YIILMT  DRNEKLFY
Sbjct: 1   MAFTLEERLQLGIHGLIPPCFLSQDVQLLRIMRYYERQQSDLDKYIILMTLQDRNEKLFY 60

Query: 441 PVLPSD 458
            VL SD
Sbjct: 61  RVLTSD 66



 Score = 34.7 bits (78), Expect(2) = 1e-25
 Identities = 23/49 (46%), Positives = 27/49 (55%)
 Frame = +1

Query: 460 VEKFPPIVYPPPRRERACQPYGLDFDTPRRPFNPIS*LRPTFLSLLHSW 606
           VEKF PIVY P     ACQ YGL F  PR  F  I   +    ++L+SW
Sbjct: 67  VEKFMPIVYTPTVG-LACQQYGLTFRRPRGLFITIH-DKGHLATMLNSW 113


>ref|XP_857051.1| PREDICTED: similar to malic enzyme 3, NADP(+)-dependent,
           mitochondrial isoform 3 [Canis familiaris]
          Length = 361

 Score =  100 bits (250), Expect(2) = 1e-25
 Identities = 50/66 (75%), Positives = 53/66 (80%)
 Frame = +3

Query: 261 MAFTLEERLPLGIHGQIPPCFMRHDFQLLRAVRYYHPQQSDLHQYIILMTPPDRNEKLFY 440
           MAFTLEERL LGIHG IPPCF+  D QLLR +RYY  QQSDL +YIILMT  DRNEKLFY
Sbjct: 1   MAFTLEERLQLGIHGLIPPCFLSQDVQLLRIMRYYERQQSDLDKYIILMTLQDRNEKLFY 60

Query: 441 PVLPSD 458
            VL SD
Sbjct: 61  RVLTSD 66



 Score = 34.7 bits (78), Expect(2) = 1e-25
 Identities = 23/49 (46%), Positives = 27/49 (55%)
 Frame = +1

Query: 460 VEKFPPIVYPPPRRERACQPYGLDFDTPRRPFNPIS*LRPTFLSLLHSW 606
           VEKF PIVY P     ACQ YGL F  PR  F  I   +    ++L+SW
Sbjct: 67  VEKFMPIVYTPTVG-LACQQYGLTFRRPRGLFITIH-DKGHLATMLNSW 113


>ref|XP_542269.2| PREDICTED: similar to malic enzyme 3, NADP(+)-dependent,
           mitochondrial isoform 1 [Canis familiaris]
          Length = 569

 Score =  100 bits (250), Expect(2) = 4e-25
 Identities = 50/66 (75%), Positives = 53/66 (80%)
 Frame = +3

Query: 261 MAFTLEERLPLGIHGQIPPCFMRHDFQLLRAVRYYHPQQSDLHQYIILMTPPDRNEKLFY 440
           MAFTLEERL LGIHG IPPCF+  D QLLR +RYY  QQSDL +YIILMT  DRNEKLFY
Sbjct: 1   MAFTLEERLQLGIHGLIPPCFLSQDVQLLRIMRYYERQQSDLDKYIILMTLQDRNEKLFY 60

Query: 441 PVLPSD 458
            VL SD
Sbjct: 61  RVLTSD 66



 Score = 33.1 bits (74), Expect(2) = 4e-25
 Identities = 18/29 (62%), Positives = 18/29 (62%)
 Frame = +1

Query: 460 VEKFPPIVYPPPRRERACQPYGLDFDTPR 546
           VEKF PIVY P     ACQ YGL F  PR
Sbjct: 67  VEKFMPIVYTPTVG-LACQQYGLTFRRPR 94


>ref|XP_532217.2| PREDICTED: similar to NADP-dependent malic enzyme (NADP-ME) (Malic
           enzyme 1) [Canis familiaris]
          Length = 634

 Score = 79.3 bits (194), Expect(2) = 3e-18
 Identities = 38/71 (53%), Positives = 48/71 (67%)
 Frame = +3

Query: 255 QGMAFTLEERLPLGIHGQIPPCFMRHDFQLLRAVRYYHPQQSDLHQYIILMTPPDRNEKL 434
           Q +AFTLEER  L IHG +PPCF+  D Q+LR ++ +    SD  +Y++LM   DRNEKL
Sbjct: 88  QDLAFTLEERQQLNIHGLLPPCFISQDIQVLRIIKNFERLTSDFDRYLLLMDLQDRNEKL 147

Query: 435 FYPVLPSDRGK 467
           FY VL SD  K
Sbjct: 148 FYSVLMSDLEK 158



 Score = 31.6 bits (70), Expect(2) = 3e-18
 Identities = 22/49 (44%), Positives = 26/49 (53%)
 Frame = +1

Query: 460 VEKFPPIVYPPPRRERACQPYGLDFDTPRRPFNPIS*LRPTFLSLLHSW 606
           +EKF PIVY  P    ACQ Y L F  PR  F  I   R    S+L++W
Sbjct: 156 LEKFMPIVY-TPTVGLACQQYSLAFRKPRGLFISIH-DRGHIASVLNAW 202


>ref|XP_849530.1| PREDICTED: similar to NAD-dependent malic enzyme, mitochondrial
           precursor (NAD-ME) (Malic enzyme 2) isoform 2 [Canis
           familiaris]
          Length = 584

 Score = 69.3 bits (168), Expect = 7e-12
 Identities = 35/87 (40%), Positives = 49/87 (56%)
 Frame = +3

Query: 198 RPVPLNKRGYHVTRNPHLNQGMAFTLEERLPLGIHGQIPPCFMRHDFQLLRAVRYYHPQQ 377
           R + + ++G  +  NP  N+GMAFTL+ER  LG+ G +PP     D Q LR  +      
Sbjct: 17  RHIHIKEKGKPLMLNPRTNKGMAFTLQERQMLGLQGLLPPKIETQDIQALRFHKNVKKMN 76

Query: 378 SDLHQYIILMTPPDRNEKLFYPVLPSD 458
             L +YI +M   +RNEKLFY +L  D
Sbjct: 77  GPLEKYIYIMGIQERNEKLFYRILQDD 103


  Database: RefSeqCP
    Posted date:  Aug 1, 2006  9:25 PM
  Number of letters in database: 19,266,565
  Number of sequences in database:  33,732
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 39,774,866
Number of Sequences: 33732
Number of extensions: 1028553
Number of successful extensions: 6097
Number of sequences better than 1.0e-05: 8
Number of HSP's better than  0.0 without gapping: 4188
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6003
length of database: 19,266,565
effective HSP length: 105
effective length of database: 15,724,705
effective search space used: 4418642105
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqMP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611S-031595
         (1162 letters)

Database: RefSeqMP 
           45,328 sequences; 21,768,885 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_852072.1| malic enzyme 3, NADP(+)-dependent, mitochondria...   176   6e-48
Alignment   gi|NP_032641.1| malic enzyme, supernatant [Mus musculus]              96   3e-23
Alignment   gi|XP_001004679.1| PREDICTED: similar to NADP-dependent malic e...    74   1e-16
Alignment   gi|XP_001004685.1| PREDICTED: similar to NADP-dependent malic e...    74   1e-16
Alignment   gi|NP_663469.1| malic enzyme 2, NAD(+)-dependent, mitochondrial...    73   7e-13

>ref|NP_852072.1| malic enzyme 3, NADP(+)-dependent, mitochondrial [Mus musculus]
          Length = 604

 Score =  176 bits (446), Expect(2) = 6e-48
 Identities = 86/128 (67%), Positives = 97/128 (75%)
 Frame = +3

Query: 75  MGASLGSGARVALLPRQACGAVXXXXXXXXXXDCHSKTGLPRPVPLNKRGYHVTRNPHLN 254
           MGA+LG+GAR+  +PR AC ++           CHSK+G PRPVPL KRGY VTRNPHLN
Sbjct: 1   MGAALGTGARLTSVPRIACSSLRRQAPSAPAQGCHSKSGPPRPVPLKKRGYDVTRNPHLN 60

Query: 255 QGMAFTLEERLPLGIHGQIPPCFMRHDFQLLRAVRYYHPQQSDLHQYIILMTPPDRNEKL 434
           +GMAFTLEERL LGIHG IPPCF+  D QLLR +RYY  QQSDL +YIILMT  DRNEKL
Sbjct: 61  KGMAFTLEERLQLGIHGLIPPCFLSQDVQLLRIMRYYENQQSDLDKYIILMTHQDRNEKL 120

Query: 435 FYPVLPSD 458
           FY VL SD
Sbjct: 121 FYRVLTSD 128



 Score = 34.3 bits (77), Expect(2) = 6e-48
 Identities = 23/49 (46%), Positives = 27/49 (55%)
 Frame = +1

Query: 460 VEKFPPIVYPPPRRERACQPYGLDFDTPRRPFNPIS*LRPTFLSLLHSW 606
           VEKF PIVY P     ACQ YGL F  PR  F  I   +    ++L+SW
Sbjct: 129 VEKFMPIVYTPTVG-LACQHYGLTFRRPRGLFITIH-DKGHIATMLNSW 175


>ref|NP_032641.1| malic enzyme, supernatant [Mus musculus]
          Length = 572

 Score = 96.3 bits (238), Expect(2) = 3e-23
 Identities = 45/88 (51%), Positives = 61/88 (69%)
 Frame = +3

Query: 195 PRPVPLNKRGYHVTRNPHLNQGMAFTLEERLPLGIHGQIPPCFMRHDFQLLRAVRYYHPQ 374
           PR    ++RGY +TR+PHLN+ +AFTLEER  L IHG +PPC +  + Q+LR ++ +   
Sbjct: 6   PRRRHTHQRGYLLTRDPHLNKDLAFTLEERQQLNIHGLLPPCIISQELQVLRIIKNFERL 65

Query: 375 QSDLHQYIILMTPPDRNEKLFYPVLPSD 458
            SD  +Y++LM   DRNEKLFY VL SD
Sbjct: 66  NSDFDRYLLLMDLQDRNEKLFYSVLMSD 93



 Score = 31.6 bits (70), Expect(2) = 3e-23
 Identities = 22/49 (44%), Positives = 26/49 (53%)
 Frame = +1

Query: 460 VEKFPPIVYPPPRRERACQPYGLDFDTPRRPFNPIS*LRPTFLSLLHSW 606
           VEKF PIVY  P    ACQ Y L F  PR  F  I   +    S+L++W
Sbjct: 94  VEKFMPIVY-TPTVGLACQQYSLAFRKPRGLFISIH-DKGHIASVLNAW 140


>ref|XP_001004679.1| PREDICTED: similar to NADP-dependent malic enzyme (NADP-ME) (Malic
           enzyme 1) isoform 1 [Mus musculus]
          Length = 554

 Score = 74.3 bits (181), Expect(2) = 1e-16
 Identities = 34/68 (50%), Positives = 46/68 (67%)
 Frame = +3

Query: 255 QGMAFTLEERLPLGIHGQIPPCFMRHDFQLLRAVRYYHPQQSDLHQYIILMTPPDRNEKL 434
           + +AFTLEER  L IHG +PPC +  + Q+LR ++ +    SD  +Y++LM   DRNEKL
Sbjct: 6   EDLAFTLEERQQLNIHGLLPPCIISQELQVLRIIKNFERLNSDFDRYLLLMDLQDRNEKL 65

Query: 435 FYPVLPSD 458
           FY VL SD
Sbjct: 66  FYSVLMSD 73



 Score = 31.6 bits (70), Expect(2) = 1e-16
 Identities = 22/49 (44%), Positives = 26/49 (53%)
 Frame = +1

Query: 460 VEKFPPIVYPPPRRERACQPYGLDFDTPRRPFNPIS*LRPTFLSLLHSW 606
           VEKF PIVY  P    ACQ Y L F  PR  F  I   +    S+L++W
Sbjct: 74  VEKFMPIVY-TPTVGLACQQYSLAFRKPRGLFISIH-DKGHIASVLNAW 120


>ref|XP_001004685.1| PREDICTED: similar to NADP-dependent malic enzyme (NADP-ME) (Malic
           enzyme 1) isoform 4 [Mus musculus]
          Length = 552

 Score = 74.3 bits (181), Expect(2) = 1e-16
 Identities = 34/68 (50%), Positives = 46/68 (67%)
 Frame = +3

Query: 255 QGMAFTLEERLPLGIHGQIPPCFMRHDFQLLRAVRYYHPQQSDLHQYIILMTPPDRNEKL 434
           + +AFTLEER  L IHG +PPC +  + Q+LR ++ +    SD  +Y++LM   DRNEKL
Sbjct: 6   EDLAFTLEERQQLNIHGLLPPCIISQELQVLRIIKNFERLNSDFDRYLLLMDLQDRNEKL 65

Query: 435 FYPVLPSD 458
           FY VL SD
Sbjct: 66  FYSVLMSD 73



 Score = 31.6 bits (70), Expect(2) = 1e-16
 Identities = 22/49 (44%), Positives = 26/49 (53%)
 Frame = +1

Query: 460 VEKFPPIVYPPPRRERACQPYGLDFDTPRRPFNPIS*LRPTFLSLLHSW 606
           VEKF PIVY  P    ACQ Y L F  PR  F  I   +    S+L++W
Sbjct: 74  VEKFMPIVY-TPTVGLACQQYSLAFRKPRGLFISIH-DKGHIASVLNAW 120


>ref|NP_663469.1| malic enzyme 2, NAD(+)-dependent, mitochondrial [Mus musculus]
          Length = 589

 Score = 72.8 bits (177), Expect = 7e-13
 Identities = 39/87 (44%), Positives = 50/87 (57%)
 Frame = +3

Query: 198 RPVPLNKRGYHVTRNPHLNQGMAFTLEERLPLGIHGQIPPCFMRHDFQLLRAVRYYHPQQ 377
           R V L ++G  +  NP  N+GMAFTL+ER  LG+ G +PP     D Q LR  R      
Sbjct: 17  RRVHLKEKGKPLMLNPRTNKGMAFTLQERQMLGLQGLLPPKIETQDIQALRFHRNLKKMT 76

Query: 378 SDLHQYIILMTPPDRNEKLFYPVLPSD 458
           S L +YI +M   +RNEKLFY +L  D
Sbjct: 77  SPLEKYIYIMGIQERNEKLFYRILQDD 103


  Database: RefSeqMP
    Posted date:  Aug 2, 2006 12:58 AM
  Number of letters in database: 21,768,885
  Number of sequences in database:  45,328
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 44,783,165
Number of Sequences: 45328
Number of extensions: 1134389
Number of successful extensions: 6582
Number of sequences better than 1.0e-05: 5
Number of HSP's better than  0.0 without gapping: 4621
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6501
length of database: 21,768,885
effective HSP length: 105
effective length of database: 17,009,445
effective search space used: 4779654045
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)