Animal-Genome cDNA 20060611S-032346


Search to RefSeqSP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611S-032346
         (1158 letters)

Database: RefSeqSP 
           1040 sequences; 434,620 total letters

Searching...done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_999478.1| thioredoxin [Sus scrofa]                              45   3e-06

>ref|NP_999478.1| thioredoxin [Sus scrofa]
          Length = 105

 Score = 45.1 bits (105), Expect = 3e-06
 Identities = 22/81 (27%), Positives = 37/81 (45%)
 Frame = +3

Query: 105 EELLRLRAKSLLVVHFWAPWAPQCAQMNDVMADLAKDHPPVSFVKLEAEAVPDVPEKYGI 284
           +E L    + L+VV F A W   C  +      L++ +  V F++++ +   DV  +  +
Sbjct: 12  QEALNSAGEKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVVFLEVDVDDCQDVASECEV 71

Query: 285 SSVPTFLFFKNSHSTDRLDGA 347
             +PTF FFK         GA
Sbjct: 72  KCMPTFQFFKKGQKVGEFSGA 92


  Database: RefSeqSP
    Posted date:  Aug 1, 2006  7:14 PM
  Number of letters in database: 434,620
  Number of sequences in database:  1040
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 953,545
Number of Sequences: 1040
Number of extensions: 21724
Number of successful extensions: 45
Number of sequences better than 1.0e-05: 1
Number of HSP's better than  0.0 without gapping: 43
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 45
length of database: 434,620
effective HSP length: 78
effective length of database: 353,500
effective search space used: 108524500
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqBP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611S-032346
         (1158 letters)

Database: RefSeqBP 
           33,508 sequences; 16,112,626 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_001030273.1| thioredoxin-like [Bos taurus]                     162   3e-49
Alignment   gi|XP_873370.1| PREDICTED: similar to Thioredoxin-like protein ...    35   7e-06

>ref|NP_001030273.1| thioredoxin-like [Bos taurus]
          Length = 334

 Score =  162 bits (410), Expect(2) = 3e-49
 Identities = 82/102 (80%), Positives = 86/102 (84%)
 Frame = +3

Query: 96  GQIEELLRLRAKSLLVVHFWAPWAPQCAQMNDVMADLAKDHPPVSFVKLEAEAVPDVPEK 275
           GQ EELLRLRAKSLLVVHFWAPWAPQCAQMNDVMA+LAK+H  VSFVKLEAEAVP+V EK
Sbjct: 19  GQFEELLRLRAKSLLVVHFWAPWAPQCAQMNDVMAELAKEHQQVSFVKLEAEAVPEVSEK 78

Query: 276 YGISSVPTFLFFKNSHSTDRLDGAYVP*LTNWD*RHASSSFF 401
           Y ISSVPTFLFFKNS   DRLDGA+ P LT    RHASS  F
Sbjct: 79  YEISSVPTFLFFKNSQKIDRLDGAHAPELTKKVQRHASSGSF 120



 Score = 52.0 bits (123), Expect(2) = 3e-49
 Identities = 36/73 (49%), Positives = 40/73 (54%), Gaps = 7/73 (9%)
 Frame = +2

Query: 473 PCMLFMNGTSQELRCCFSSRWWKFFQI*YPVKH------FDIFSDE*VRQGFQTLFQLVH 634
           PCMLFM GT QE RC FS +  +        KH      FDIFSDE VRQG +T      
Sbjct: 144 PCMLFMKGTPQEPRCGFSKQMVEILN-----KHNIQFSSFDIFSDEEVRQGLKTYSS--W 196

Query: 635 PT-PCSYVSGEFL 670
           PT P  YVSGE +
Sbjct: 197 PTYPQLYVSGELI 209


>ref|XP_873370.1| PREDICTED: similar to Thioredoxin-like protein 2 (PKC-interacting
           cousin of thioredoxin) (PKC-theta-interacting protein)
           (PKCq-interacting protein) (HUSSY-22) [Bos taurus]
          Length = 164

 Score = 34.7 bits (78), Expect(3) = 7e-06
 Identities = 18/26 (69%), Positives = 18/26 (69%)
 Frame = +1

Query: 397 SFSSGGSEHLKEDLFLRLKNLIHAAP 474
           SFS  GSEHLKEDL   LK L  AAP
Sbjct: 17  SFSPSGSEHLKEDLNQPLKKLFLAAP 42



 Score = 30.4 bits (67), Expect(3) = 7e-06
 Identities = 12/18 (66%), Positives = 14/18 (77%)
 Frame = +2

Query: 473 PCMLFMNGTSQELRCCFS 526
           PC+LFM GT QE RC F+
Sbjct: 42  PCILFMKGTPQEPRCGFN 59



 Score = 22.3 bits (46), Expect(3) = 7e-06
 Identities = 8/17 (47%), Positives = 10/17 (58%)
 Frame = +3

Query: 591 NKFVKVFKPYSNWSTLP 641
           N+  +  K YSNW T P
Sbjct: 59  NEVRQALKTYSNWPTYP 75


  Database: RefSeqBP
    Posted date:  Aug 1, 2006  7:14 PM
  Number of letters in database: 16,112,626
  Number of sequences in database:  33,508
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 34,982,659
Number of Sequences: 33508
Number of extensions: 791816
Number of successful extensions: 2241
Number of sequences better than 1.0e-05: 2
Number of HSP's better than  0.0 without gapping: 2028
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2221
length of database: 16,112,626
effective HSP length: 103
effective length of database: 12,661,302
effective search space used: 3570487164
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqHP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611S-032346
         (1158 letters)

Database: RefSeqHP 
           39,411 sequences; 17,774,539 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_006532.2| thioredoxin-like [Homo sapiens]                      158   2e-47

>ref|NP_006532.2| thioredoxin-like [Homo sapiens]
          Length = 335

 Score =  158 bits (400), Expect(2) = 2e-47
 Identities = 80/103 (77%), Positives = 86/103 (83%)
 Frame = +3

Query: 96  GQIEELLRLRAKSLLVVHFWAPWAPQCAQMNDVMADLAKDHPPVSFVKLEAEAVPDVPEK 275
           GQ EELLRL+AKSLLVVHFWAPWAPQCAQMN+VMA+LAK+ P VSFVKLEAE VP+V EK
Sbjct: 20  GQFEELLRLKAKSLLVVHFWAPWAPQCAQMNEVMAELAKELPQVSFVKLEAEGVPEVSEK 79

Query: 276 YGISSVPTFLFFKNSHSTDRLDGAYVP*LTNWD*RHASSSFFL 404
           Y ISSVPTFLFFKNS   DRLDGA+ P LT    RHASS  FL
Sbjct: 80  YEISSVPTFLFFKNSQKIDRLDGAHAPELTKKVQRHASSGSFL 122



 Score = 50.1 bits (118), Expect(2) = 2e-47
 Identities = 35/73 (47%), Positives = 39/73 (53%), Gaps = 7/73 (9%)
 Frame = +2

Query: 473 PCMLFMNGTSQELRCCFSSRWWKFFQI*YPVKH------FDIFSDE*VRQGFQTLFQLVH 634
           PCMLFM GT QE RC FS +  +        KH      FDIFSDE VRQG +       
Sbjct: 145 PCMLFMKGTPQEPRCGFSKQMVEILH-----KHNIQFSSFDIFSDEEVRQGLKAYSS--W 197

Query: 635 PT-PCSYVSGEFL 670
           PT P  YVSGE +
Sbjct: 198 PTYPQLYVSGELI 210


  Database: RefSeqHP
    Posted date:  Aug 2, 2006 12:57 AM
  Number of letters in database: 17,774,539
  Number of sequences in database:  39,411
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 39,338,685
Number of Sequences: 39411
Number of extensions: 899434
Number of successful extensions: 2244
Number of sequences better than 1.0e-05: 1
Number of HSP's better than  0.0 without gapping: 2071
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2232
length of database: 17,774,539
effective HSP length: 104
effective length of database: 13,675,795
effective search space used: 3842898395
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqCP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611S-032346
         (1158 letters)

Database: RefSeqCP 
           33,732 sequences; 19,266,565 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|XP_535061.2| PREDICTED: similar to Thioredoxin-like 2 protei...   159   5e-39

>ref|XP_535061.2| PREDICTED: similar to Thioredoxin-like 2 protein (PKC-interacting
           cousin of thioredoxin) (PKCq-interacting protein)
           (PKC-theta-interacting protein) [Canis familiaris]
          Length = 333

 Score =  159 bits (402), Expect = 5e-39
 Identities = 100/190 (52%), Positives = 112/190 (58%), Gaps = 9/190 (4%)
 Frame = +3

Query: 99  QIEELLRLRAKSLLVVHFWAPWAPQCAQMNDVMADLAKDHPPVSFVKLEAEAVPDVPEKY 278
           Q EELLRLRAKSL+VVHFWAPWAPQC QMNDVMA+LAK+HP VSFVKLEAEAVP+V EKY
Sbjct: 19  QFEELLRLRAKSLVVVHFWAPWAPQCVQMNDVMAELAKEHPQVSFVKLEAEAVPEVSEKY 78

Query: 279 GISSVPTFLFFKNSHSTDRLDGAYVP*LTNWD*RHASSSFFLIWR**APERRSFPSPEES 458
            ISSVPTFL FKNS   DRLDGA+ P LT    RHASS  F       P     P  E+ 
Sbjct: 79  EISSVPTFLLFKNSQKIDRLDGAHAPELTKKVQRHASSGSF------PPSTNEHPK-EDL 131

Query: 459 DPRC-----PPACCL*M----ELPRSCAAVSQADGGNSFKSNIPLSTLISSQMNKFVKVF 611
             R         C L M    + PR   +    +  N  K NI  S+       +  +  
Sbjct: 132 HVRLKKLTHAAPCMLFMKGTPQEPRCGFSKQMVEILN--KHNIQFSSFDIFSDEEVRQGL 189

Query: 612 KPYSNWSTLP 641
           K YSNW T P
Sbjct: 190 KTYSNWPTYP 199



 Score = 52.0 bits (123), Expect = 1e-06
 Identities = 36/73 (49%), Positives = 40/73 (54%), Gaps = 7/73 (9%)
 Frame = +2

Query: 473 PCMLFMNGTSQELRCCFSSRWWKFFQI*YPVKH------FDIFSDE*VRQGFQTLFQLVH 634
           PCMLFM GT QE RC FS +  +        KH      FDIFSDE VRQG +T      
Sbjct: 143 PCMLFMKGTPQEPRCGFSKQMVEILN-----KHNIQFSSFDIFSDEEVRQGLKTYSN--W 195

Query: 635 PT-PCSYVSGEFL 670
           PT P  YVSGE +
Sbjct: 196 PTYPQLYVSGELI 208


  Database: RefSeqCP
    Posted date:  Aug 1, 2006  9:25 PM
  Number of letters in database: 19,266,565
  Number of sequences in database:  33,732
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 41,240,939
Number of Sequences: 33732
Number of extensions: 935161
Number of successful extensions: 2342
Number of sequences better than 1.0e-05: 1
Number of HSP's better than  0.0 without gapping: 2116
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2330
length of database: 19,266,565
effective HSP length: 105
effective length of database: 15,724,705
effective search space used: 4402917400
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqMP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611S-032346
         (1158 letters)

Database: RefSeqMP 
           45,328 sequences; 21,768,885 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_075629.2| thioredoxin-like 2 [Mus musculus]                    157   1e-47
Alignment   gi|XP_995522.1| PREDICTED: similar to thioredoxin-like 2 [Mus m...   174   2e-43
Alignment   gi|XP_978406.1| PREDICTED: similar to thioredoxin-like 2 [Mus m...   174   2e-43
Alignment   gi|XP_978323.1| PREDICTED: similar to thioredoxin-like 2 [Mus m...   174   2e-43
Alignment   gi|NP_705739.1| thioredoxin domain containing 2 (spermatozoa) [...    49   8e-06

>ref|NP_075629.2| thioredoxin-like 2 [Mus musculus]
          Length = 337

 Score =  157 bits (397), Expect(2) = 1e-47
 Identities = 78/101 (77%), Positives = 83/101 (82%)
 Frame = +3

Query: 99  QIEELLRLRAKSLLVVHFWAPWAPQCAQMNDVMADLAKDHPPVSFVKLEAEAVPDVPEKY 278
           Q EELLRL+ KSLLVVHFWAPWAPQC QMNDVMA+LAK+HP VSFVKLEAEAVP+V EKY
Sbjct: 23  QFEELLRLKTKSLLVVHFWAPWAPQCVQMNDVMAELAKEHPHVSFVKLEAEAVPEVSEKY 82

Query: 279 GISSVPTFLFFKNSHSTDRLDGAYVP*LTNWD*RHASSSFF 401
            ISSVPTFLFFKNS   DRLDGA+ P LT    RH SS  F
Sbjct: 83  EISSVPTFLFFKNSQKVDRLDGAHAPELTKKVQRHVSSGAF 123



 Score = 52.0 bits (123), Expect(2) = 1e-47
 Identities = 36/73 (49%), Positives = 40/73 (54%), Gaps = 7/73 (9%)
 Frame = +2

Query: 473 PCMLFMNGTSQELRCCFSSRWWKFFQI*YPVKH------FDIFSDE*VRQGFQTLFQLVH 634
           PCMLFM GT QE RC FS +  +        KH      FDIFSDE VRQG +T      
Sbjct: 147 PCMLFMKGTPQEPRCGFSKQMVEILH-----KHNIQFSSFDIFSDEEVRQGLKTYSN--W 199

Query: 635 PT-PCSYVSGEFL 670
           PT P  YVSGE +
Sbjct: 200 PTYPQLYVSGELI 212


>ref|XP_995522.1| PREDICTED: similar to thioredoxin-like 2 [Mus musculus]
          Length = 365

 Score =  174 bits (440), Expect = 2e-43
 Identities = 107/191 (56%), Positives = 126/191 (65%), Gaps = 2/191 (1%)
 Frame = +3

Query: 99  QIEELLRLRAKSLLVVHFWAPWAPQCAQMNDVMADLAKDHPPVSFVKLEAEAVPDVPEKY 278
           Q EELLRL+ KSLLVVHFWAPWAPQC QMNDVMA+LAK+HP VSFVKLEAEAVP+V EKY
Sbjct: 51  QFEELLRLKTKSLLVVHFWAPWAPQCVQMNDVMAELAKEHPHVSFVKLEAEAVPEVSEKY 110

Query: 279 GISSVPTFLFFKNSHSTDRLDGAYVP*LTNWD*RHASS-SFFLIWR**APERRSFPSPEE 455
            ISSVP+FLFFKNS   DRLDGA+ P LT    RH SS +F L+      +  +F    +
Sbjct: 111 EISSVPSFLFFKNSQKVDRLDGAHAPELTKKVQRHVSSGAFRLVLMNILKKTSAFAX--K 168

Query: 456 SDPRCPPACCL*MELPRSCAAVSQADGGNSFKSNI-PLSTLISSQMNKFVKVFKPYSNWS 632
           S    PPACC   E  ++ A VS +    SF + I   + LISSQM KF +  K      
Sbjct: 169 SXLTLPPACCSXREHLKNRAVVSASRWWKSFTNTIFSSAALISSQMKKFDRGSKRTLIGP 228

Query: 633 TLPLALMFLES 665
            + L+ MFLES
Sbjct: 229 PI-LSSMFLES 238


>ref|XP_978406.1| PREDICTED: similar to thioredoxin-like 2 [Mus musculus]
          Length = 365

 Score =  174 bits (440), Expect = 2e-43
 Identities = 107/191 (56%), Positives = 126/191 (65%), Gaps = 2/191 (1%)
 Frame = +3

Query: 99  QIEELLRLRAKSLLVVHFWAPWAPQCAQMNDVMADLAKDHPPVSFVKLEAEAVPDVPEKY 278
           Q EELLRL+ KSLLVVHFWAPWAPQC QMNDVMA+LAK+HP VSFVKLEAEAVP+V EKY
Sbjct: 51  QFEELLRLKTKSLLVVHFWAPWAPQCVQMNDVMAELAKEHPHVSFVKLEAEAVPEVSEKY 110

Query: 279 GISSVPTFLFFKNSHSTDRLDGAYVP*LTNWD*RHASS-SFFLIWR**APERRSFPSPEE 455
            ISSVP+FLFFKNS   DRLDGA+ P LT    RH SS +F L+      +  +F    +
Sbjct: 111 EISSVPSFLFFKNSQKVDRLDGAHAPELTKKVQRHVSSGAFRLVLMNILKKTSAFAX--K 168

Query: 456 SDPRCPPACCL*MELPRSCAAVSQADGGNSFKSNI-PLSTLISSQMNKFVKVFKPYSNWS 632
           S    PPACC   E  ++ A VS +    SF + I   + LISSQM KF +  K      
Sbjct: 169 SXLTLPPACCSXREHLKNRAVVSASRWWKSFTNTIFSSAALISSQMKKFDRGSKRTLIGP 228

Query: 633 TLPLALMFLES 665
            + L+ MFLES
Sbjct: 229 PI-LSSMFLES 238


>ref|XP_978323.1| PREDICTED: similar to thioredoxin-like 2 [Mus musculus]
          Length = 365

 Score =  174 bits (440), Expect = 2e-43
 Identities = 107/191 (56%), Positives = 126/191 (65%), Gaps = 2/191 (1%)
 Frame = +3

Query: 99  QIEELLRLRAKSLLVVHFWAPWAPQCAQMNDVMADLAKDHPPVSFVKLEAEAVPDVPEKY 278
           Q EELLRL+ KSLLVVHFWAPWAPQC QMNDVMA+LAK+HP VSFVKLEAEAVP+V EKY
Sbjct: 51  QFEELLRLKTKSLLVVHFWAPWAPQCVQMNDVMAELAKEHPHVSFVKLEAEAVPEVSEKY 110

Query: 279 GISSVPTFLFFKNSHSTDRLDGAYVP*LTNWD*RHASS-SFFLIWR**APERRSFPSPEE 455
            ISSVP+FLFFKNS   DRLDGA+ P LT    RH SS +F L+      +  +F    +
Sbjct: 111 EISSVPSFLFFKNSQKVDRLDGAHAPELTKKVQRHVSSGAFRLVLMNILKKTSAFAX--K 168

Query: 456 SDPRCPPACCL*MELPRSCAAVSQADGGNSFKSNI-PLSTLISSQMNKFVKVFKPYSNWS 632
           S    PPACC   E  ++ A VS +    SF + I   + LISSQM KF +  K      
Sbjct: 169 SXLTLPPACCSXREHLKNRAVVSASRWWKSFTNTIFSSAALISSQMKKFDRGSKRTLIGP 228

Query: 633 TLPLALMFLES 665
            + L+ MFLES
Sbjct: 229 PI-LSSMFLES 238


>ref|NP_705739.1| thioredoxin domain containing 2 (spermatozoa) [Mus musculus]
          Length = 462

 Score = 49.3 bits (116), Expect = 8e-06
 Identities = 25/85 (29%), Positives = 40/85 (47%)
 Frame = +3

Query: 99  QIEELLRLRAKSLLVVHFWAPWAPQCAQMNDVMADLAKDHPPVSFVKLEAEAVPDVPEKY 278
           + EE+L+   + L+ V F A W   C  M  +   L+  H  V F++++ E    + +  
Sbjct: 367 EFEEVLKDAGEKLVAVDFSAAWCGPCRMMKPLFHSLSLKHEDVIFLEVDTEDCEQLVQDC 426

Query: 279 GISSVPTFLFFKNSHSTDRLDGAYV 353
            I  +PTF F+KN        GA V
Sbjct: 427 EIFHLPTFQFYKNEEKVGEFSGALV 451


  Database: RefSeqMP
    Posted date:  Aug 2, 2006 12:58 AM
  Number of letters in database: 21,768,885
  Number of sequences in database:  45,328
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 47,030,486
Number of Sequences: 45328
Number of extensions: 1062858
Number of successful extensions: 2758
Number of sequences better than 1.0e-05: 5
Number of HSP's better than  0.0 without gapping: 2513
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2731
length of database: 21,768,885
effective HSP length: 105
effective length of database: 17,009,445
effective search space used: 4762644600
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)