Animal-Genome cDNA 20060611S-034822


Search to RefSeqSP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611S-034822
         (769 letters)

Database: RefSeqSP 
           1040 sequences; 434,620 total letters

Searching...done

 ***** No hits found ******

  Database: RefSeqSP
    Posted date:  Aug 1, 2006  7:14 PM
  Number of letters in database: 434,620
  Number of sequences in database:  1040
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 704,526
Number of Sequences: 1040
Number of extensions: 17569
Number of successful extensions: 63
Number of sequences better than 1.0e-05: 0
Number of HSP's better than  0.0 without gapping: 53
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 61
length of database: 434,620
effective HSP length: 75
effective length of database: 356,620
effective search space used: 64191600
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqBP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611S-034822
         (769 letters)

Database: RefSeqBP 
           33,508 sequences; 16,112,626 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_899207.1| double substrate-specificity short chain dehydr...   234   3e-76
Alignment   gi|XP_870721.1| PREDICTED: similar to Retinol dehydrogenase 11 ...   209   2e-54
Alignment   gi|XP_582373.2| PREDICTED: similar to Retinol dehydrogenase 11 ...   202   2e-52
Alignment   gi|XP_582319.2| PREDICTED: similar to retinol dehydrogenase 14 ...   145   2e-39
Alignment   gi|XP_592820.2| PREDICTED: similar to retinol dehydrogenase 11 ...   122   3e-35
Alignment   gi|XP_584629.2| PREDICTED: similar to Retinol dehydrogenase 13,...    80   7e-26
Alignment   gi|XP_591168.2| PREDICTED: similar to dehydrogenase/reductase (...   103   1e-22
Alignment   gi|XP_584642.2| PREDICTED: similar to retinol dehydrogenase 11 ...    82   5e-22
Alignment   gi|XP_876208.1| PREDICTED: similar to WW domain-containing oxid...    94   9e-20
Alignment   gi|XP_584810.2| PREDICTED: similar to retinol dehydrogenase 13 ...    89   5e-18

>ref|NP_899207.1| double substrate-specificity short chain dehydrogenase/reductase 2
           [Bos taurus]
          Length = 316

 Score =  234 bits (597), Expect(2) = 3e-76
 Identities = 117/167 (70%), Positives = 136/167 (81%)
 Frame = +2

Query: 221 LKEESVAREIQNMTGNQQVLVRKLDLADTKSIRAFAKGFLAEEKHLHILINNAGVMMCPY 400
           LK ES A EIQ  T N QVLVRKLDL+DTKSIRAFA+GFLAEEK LHILINNAGVM+CPY
Sbjct: 74  LKGESAASEIQADTKNSQVLVRKLDLSDTKSIRAFAEGFLAEEKQLHILINNAGVMLCPY 133

Query: 401 SKTADGFETRIGVNXXXXXXXXXXXXXXXKESAPSRVVNVSSLAHHMGRIHFHNLQGEKF 580
           SKTADGFET + VN               KESAP+RVVN+SS+AHH+G+I FH+LQG+K+
Sbjct: 134 SKTADGFETHLAVNHLGHFLLTHLLLGRLKESAPARVVNLSSVAHHLGKIRFHDLQGDKY 193

Query: 581 YHAGLAYCNSKLANVLFTQELARRLKGSGVTTYSVHPGTVDSELGRH 721
           Y+ G AYC+SKLANVLFT+ELA+RLKG+GVTTY+VHPG V S+L RH
Sbjct: 194 YNLGFAYCHSKLANVLFTRELAKRLKGTGVTTYAVHPGIVRSKLVRH 240



 Score = 69.7 bits (169), Expect(2) = 3e-76
 Identities = 32/48 (66%), Positives = 38/48 (79%)
 Frame = +1

Query: 88  YIAVPQIRKMLSSGVCTSTVQLPGKVAVVTGANTGIGKETAKELAKRG 231
           Y+  P IRK  + GVC + VQL GKV V+TGANTGIGKETA+ELA+RG
Sbjct: 16  YVIAPSIRKFFAGGVCRTDVQLFGKVVVITGANTGIGKETARELARRG 63


>ref|XP_870721.1| PREDICTED: similar to Retinol dehydrogenase 11 (Retinal reductase
           1) (RalR1) (Prostate short-chain dehydrogenase/reductase
           1) (Androgen-regulated short-chain
           dehydrogenase/reductase 1) (HCV core-binding protein
           HCBP12) isoform 2 [Bos taurus]
          Length = 314

 Score =  209 bits (531), Expect = 2e-54
 Identities = 111/187 (59%), Positives = 134/187 (71%), Gaps = 6/187 (3%)
 Frame = +2

Query: 179 EPTQALGRRRPKSWL------KEESVAREIQNMTGNQQVLVRKLDLADTKSIRAFAKGFL 340
           E  + L RR  + +L        E VAREIQ MTGNQQVLVRKLDLADTKSIRAFAK FL
Sbjct: 30  ETAKELARRGARVYLACRDVQNGELVAREIQMMTGNQQVLVRKLDLADTKSIRAFAKRFL 89

Query: 341 AEEKHLHILINNAGVMMCPYSKTADGFETRIGVNXXXXXXXXXXXXXXXKESAPSRVVNV 520
            + K++H++ ++   ++C +  ++ G ++                    +ESAPSRVVNV
Sbjct: 90  EDHKYIHLINSSPHFLICGFPGSSAGKDSACNTGYLGHFLLTHLLLEKLEESAPSRVVNV 149

Query: 521 SSLAHHMGRIHFHNLQGEKFYHAGLAYCNSKLANVLFTQELARRLKGSGVTTYSVHPGTV 700
           SSLAH +GRIHFHNLQGEKFY +GLAYC+SKLAN+LFTQELARRLKGSGVT YSVHPGTV
Sbjct: 150 SSLAHLLGRIHFHNLQGEKFYQSGLAYCHSKLANILFTQELARRLKGSGVTVYSVHPGTV 209

Query: 701 DSELGRH 721
           +SEL RH
Sbjct: 210 NSELVRH 216



 Score = 75.1 bits (183), Expect = 5e-14
 Identities = 36/39 (92%), Positives = 38/39 (97%)
 Frame = +1

Query: 115 MLSSGVCTSTVQLPGKVAVVTGANTGIGKETAKELAKRG 231
           MLSSGVCTST+QLPGKVAVVTGAN GIGKETAKELA+RG
Sbjct: 1   MLSSGVCTSTIQLPGKVAVVTGANAGIGKETAKELARRG 39


>ref|XP_582373.2| PREDICTED: similar to Retinol dehydrogenase 11 (Retinal reductase
           1) (RalR1) (Prostate short-chain dehydrogenase/reductase
           1) (Androgen-regulated short-chain
           dehydrogenase/reductase 1) (HCV core-binding protein
           HCBP12) isoform 1 [Bos taurus]
          Length = 308

 Score =  202 bits (515), Expect = 2e-52
 Identities = 114/187 (60%), Positives = 132/187 (70%), Gaps = 6/187 (3%)
 Frame = +2

Query: 179 EPTQALGRRRPKSWL------KEESVAREIQNMTGNQQVLVRKLDLADTKSIRAFAKGFL 340
           E  + L RR  + +L        E VAREIQ MTGNQQVLVRKLDLADTKSIRAFAK FL
Sbjct: 30  ETAKELARRGARVYLACRDVQNGELVAREIQMMTGNQQVLVRKLDLADTKSIRAFAKRFL 89

Query: 341 AEEKHLHILINNAGVMMCPYSKTADGFETRIGVNXXXXXXXXXXXXXXXKESAPSRVVNV 520
            + K++H LIN+ G     +  ++ G ++                    +ESAPSRVVNV
Sbjct: 90  EDHKYIH-LINSVG-----FPGSSAGKDSACNTGYLGHFLLTHLLLEKLEESAPSRVVNV 143

Query: 521 SSLAHHMGRIHFHNLQGEKFYHAGLAYCNSKLANVLFTQELARRLKGSGVTTYSVHPGTV 700
           SSLAH +GRIHFHNLQGEKFY +GLAYC+SKLAN+LFTQELARRLKGSGVT YSVHPGTV
Sbjct: 144 SSLAHLLGRIHFHNLQGEKFYQSGLAYCHSKLANILFTQELARRLKGSGVTVYSVHPGTV 203

Query: 701 DSELGRH 721
           +SEL RH
Sbjct: 204 NSELVRH 210



 Score = 75.1 bits (183), Expect = 5e-14
 Identities = 36/39 (92%), Positives = 38/39 (97%)
 Frame = +1

Query: 115 MLSSGVCTSTVQLPGKVAVVTGANTGIGKETAKELAKRG 231
           MLSSGVCTST+QLPGKVAVVTGAN GIGKETAKELA+RG
Sbjct: 1   MLSSGVCTSTIQLPGKVAVVTGANAGIGKETAKELARRG 39


>ref|XP_582319.2| PREDICTED: similar to retinol dehydrogenase 14 (all-trans and
           9-cis) [Bos taurus]
          Length = 420

 Score =  145 bits (367), Expect(2) = 2e-39
 Identities = 75/156 (48%), Positives = 97/156 (62%)
 Frame = +2

Query: 254 NMTGNQQVLVRKLDLADTKSIRAFAKGFLAEEKHLHILINNAGVMMCPYSKTADGFETRI 433
           N  G  +++V++LDLA   S+R+F +  L EE  L +LINNAGV  CPY KT DGFE + 
Sbjct: 186 NSGGAGELVVKELDLASLSSVRSFCQEMLQEEPRLDVLINNAGVFQCPYMKTEDGFEMQF 245

Query: 434 GVNXXXXXXXXXXXXXXXKESAPSRVVNVSSLAHHMGRIHFHNLQGEKFYHAGLAYCNSK 613
           GVN               K SAPSR+V VSS  +  G I+F +L  E+ Y+    Y  SK
Sbjct: 246 GVNHLGHFLLTNLLLGLLKSSAPSRIVVVSSKLYKYGDINFEDLNSEQSYNKSFCYSRSK 305

Query: 614 LANVLFTQELARRLKGSGVTTYSVHPGTVDSELGRH 721
           LAN+LFT+ELARRL+G+ VT   +HPG V + LGRH
Sbjct: 306 LANILFTRELARRLEGTSVTVNVLHPGIVRTNLGRH 341



 Score = 35.0 bits (79), Expect(2) = 2e-39
 Identities = 18/43 (41%), Positives = 26/43 (60%), Gaps = 3/43 (6%)
 Frame = +1

Query: 157 GKVAVVTGANTGIGKETAKELAKRG---ISGQRNPEHDRKPTG 276
           GK  ++TGAN+G+G+ TA EL + G   I G R+ E   +  G
Sbjct: 127 GKTVLITGANSGLGRATAAELLRLGARVIMGCRDRERAEEAAG 169


>ref|XP_592820.2| PREDICTED: similar to retinol dehydrogenase 11 (predicted) [Bos
           taurus]
          Length = 377

 Score =  122 bits (306), Expect(2) = 3e-35
 Identities = 73/163 (44%), Positives = 95/163 (58%), Gaps = 2/163 (1%)
 Frame = +2

Query: 230 ESVAREIQNMTGNQQVLVRKLDLADTKSIRAFAKGFLAEEKHLHILINNAGVMMCPYSKT 409
           E+ A +++  +GN +V+   LDLA   S+RAFA  FL+ E  L ILI+NAG+  C   +T
Sbjct: 74  EAAAFDLRQESGNNEVIFMALDLASLASVRAFATAFLSSEPRLDILIHNAGISSC--GRT 131

Query: 410 ADGFETRIGVNXXXXXXXXXXXXXXXKESAPSRVVNVSSLAHHMGRIHFHNLQGEK--FY 583
            + F   + VN               K SAPSRVV VSS AH  GR+ F  L      + 
Sbjct: 132 REPFNLLLRVNHIGPFLLTHLLLPRLKTSAPSRVVVVSSAAHRRGRLDFTRLDHPVVGWQ 191

Query: 584 HAGLAYCNSKLANVLFTQELARRLKGSGVTTYSVHPGTVDSEL 712
               AY NSKLANVLF +ELA +L+G+GVT Y+ HPG V+SEL
Sbjct: 192 QELRAYANSKLANVLFARELATQLEGTGVTCYAAHPGPVNSEL 234



 Score = 44.3 bits (103), Expect(2) = 3e-35
 Identities = 21/33 (63%), Positives = 24/33 (72%)
 Frame = +1

Query: 133 CTSTVQLPGKVAVVTGANTGIGKETAKELAKRG 231
           C     L G+ AVVTGAN+GIGK TA ELA+RG
Sbjct: 28  CRGLASLRGRTAVVTGANSGIGKMTALELARRG 60


>ref|XP_584629.2| PREDICTED: similar to Retinol dehydrogenase 13, partial [Bos
           taurus]
          Length = 148

 Score = 79.7 bits (195), Expect(2) = 7e-26
 Identities = 41/73 (56%), Positives = 50/73 (68%)
 Frame = +2

Query: 224 KEESVAREIQNMTGNQQVLVRKLDLADTKSIRAFAKGFLAEEKHLHILINNAGVMMCPYS 403
           K E+ A+EI+  T N +V  R LDLA  KSIR FA     EE+H+HILINNA VM CP+ 
Sbjct: 74  KCEAAAKEIRGETLNHRVNARHLDLASLKSIREFAAKVTEEEEHVHILINNAAVMRCPHW 133

Query: 404 KTADGFETRIGVN 442
            T DGFE ++GVN
Sbjct: 134 TTEDGFEMQLGVN 146



 Score = 55.8 bits (133), Expect(2) = 7e-26
 Identities = 24/42 (57%), Positives = 31/42 (73%)
 Frame = +1

Query: 106 IRKMLSSGVCTSTVQLPGKVAVVTGANTGIGKETAKELAKRG 231
           ++  ++ G C S   +PGK  +VTGANTGIGK+TA ELAKRG
Sbjct: 21  LKDFVAGGACPSKATIPGKTVIVTGANTGIGKQTALELAKRG 62


>ref|XP_591168.2| PREDICTED: similar to dehydrogenase/reductase (SDR family) X-linked
           [Bos taurus]
          Length = 251

 Score =  103 bits (258), Expect = 1e-22
 Identities = 64/149 (42%), Positives = 81/149 (54%), Gaps = 6/149 (4%)
 Frame = +2

Query: 293 DLADTKSIRAFAKGFLAEEKHLHILINNAGVMMCPYSKTADGFETRIGVNXXXXXXXXXX 472
           DLA  +SIR F + F  ++  LH+L+NNAGVMM P   T DGFE   GVN          
Sbjct: 11  DLASMRSIREFVQTFKMKKLPLHVLVNNAGVMMVPQRTTEDGFEEHFGVNYLGHFLLTNL 70

Query: 473 XXXXXKES-AP---SRVVNVSSLAHHMGRIHFHNLQGEKFYHAGLAYCNSKLANVLFTQE 640
                +ES AP   +RVV VSS  H++G ++  +LQ   +Y A  AY  SKLA VLFT  
Sbjct: 71  LLDTLQESGAPGHSARVVTVSSATHYVGELNLDDLQSSTYYSAHAAYAQSKLALVLFTYH 130

Query: 641 LARRLKGSG--VTTYSVHPGTVDSELGRH 721
           L   L   G  VT     PG VD++L R+
Sbjct: 131 LQALLTAQGMPVTASVADPGVVDTDLYRY 159


>ref|XP_584642.2| PREDICTED: similar to retinol dehydrogenase 11 (predicted) [Bos
           taurus]
          Length = 330

 Score = 81.6 bits (200), Expect(2) = 5e-22
 Identities = 54/160 (33%), Positives = 83/160 (51%), Gaps = 1/160 (0%)
 Frame = +2

Query: 245 EIQNMTGNQQVLVRKLDLADTKSIRAFAKGFLAEEKHLHILINNAGVMMCPYSKTADGFE 424
           EIQ  + + ++L+ ++DL+   SIR+FA+  L E   +H+L+NNA V   P + T +G +
Sbjct: 92  EIQATSKSNRLLLGEVDLSSMASIRSFAQRLLQECPEIHLLVNNAAVCGFPTTLTPEGLD 151

Query: 425 TRIGVNXXXXXXXXXXXXXXXKESAPSRVVNVSSLAHHMGRIHFHNLQGE-KFYHAGLAY 601
                N               + +  +RVVNVSS     G I   +L G  +       Y
Sbjct: 152 LTFATNYTGPFLLTNLLQGALQRAGSARVVNVSSFRQSHGYIDEDHLIGAGRPLTFNQNY 211

Query: 602 CNSKLANVLFTQELARRLKGSGVTTYSVHPGTVDSELGRH 721
             SKL    FT +LA+RL+G+GVT  SV PG V +++ +H
Sbjct: 212 DCSKLLLASFTGKLAQRLQGTGVTVNSVDPGVVYTKIMKH 251



 Score = 40.8 bits (94), Expect(2) = 5e-22
 Identities = 19/30 (63%), Positives = 23/30 (76%)
 Frame = +1

Query: 142 TVQLPGKVAVVTGANTGIGKETAKELAKRG 231
           +  L GK AVVTGAN+GIGK  ++ELA RG
Sbjct: 44  STDLTGKTAVVTGANSGIGKAVSQELAHRG 73


>ref|XP_876208.1| PREDICTED: similar to WW domain-containing oxidoreductase isoform 1
           [Bos taurus]
          Length = 745

 Score = 94.4 bits (233), Expect = 9e-20
 Identities = 62/156 (39%), Positives = 81/156 (51%), Gaps = 8/156 (5%)
 Frame = +2

Query: 257 MTGNQQVLVRKLDLADTKSIRAFAKGFLAEEKHLHILINNAGVMMCPYSKTADGFETRIG 436
           M    +V    LDLA  +S++ FA+ F A+   LH+L+ NA V   P++ T DG ET   
Sbjct: 2   MPHKAKVEAMTLDLALLRSVQHFAQAFKAKNVSLHVLVCNAAVFGLPWTLTKDGLETTFQ 61

Query: 437 VNXXXXXXXXXXXXXXXKESAPSRVVNVSSLAHHM-------GRIHFHNLQGEKF-YHAG 592
           VN                 SAP+RVV VSS +H         G++ F  L   K  Y A 
Sbjct: 62  VNHLGHFYLVQLLQDVLCRSAPARVVVVSSESHRFTDINDSSGKLDFSRLSPSKNDYWAM 121

Query: 593 LAYCNSKLANVLFTQELARRLKGSGVTTYSVHPGTV 700
           LAY  SKL N+LF+ EL RRL   GVT+ +VHPG +
Sbjct: 122 LAYNRSKLCNILFSNELHRRLSPRGVTSNAVHPGNM 157


>ref|XP_584810.2| PREDICTED: similar to retinol dehydrogenase 13 (all-trans and
           9-cis) [Bos taurus]
          Length = 223

 Score = 88.6 bits (218), Expect = 5e-18
 Identities = 46/79 (58%), Positives = 57/79 (72%), Gaps = 1/79 (1%)
 Frame = +2

Query: 488 KESAPSRVVNVSSLAHHMGRIHFHNLQGEKF-YHAGLAYCNSKLANVLFTQELARRLKGS 664
           K SAPSR++NVSSLAH  G I F +L  EK  Y    AYC SKLA V+ T+EL+RRL+G+
Sbjct: 50  KASAPSRIINVSSLAHVAGHIDFEDLNWEKRKYDTKAAYCQSKLAVVVSTKELSRRLQGT 109

Query: 665 GVTTYSVHPGTVDSELGRH 721
           GVT  ++HPG   +ELGRH
Sbjct: 110 GVTVNALHPGVARTELGRH 128


  Database: RefSeqBP
    Posted date:  Aug 1, 2006  7:14 PM
  Number of letters in database: 16,112,626
  Number of sequences in database:  33,508
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 26,129,257
Number of Sequences: 33508
Number of extensions: 675466
Number of successful extensions: 2110
Number of sequences better than 1.0e-05: 10
Number of HSP's better than  0.0 without gapping: 1909
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2096
length of database: 16,112,626
effective HSP length: 99
effective length of database: 12,795,334
effective search space used: 1996072104
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqHP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611S-034822
         (769 letters)

Database: RefSeqHP 
           39,411 sequences; 17,774,539 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_057110.2| androgen-regulated short-chain dehydrogenase/re...   270   4e-93
Alignment   gi|NP_689656.1| retinol dehydrogenase 12 (all-trans and 9-cis) ...   229   8e-76
Alignment   gi|NP_065956.1| retinol dehydrogenase 14 (all-trans and 9-cis) ...   147   2e-39
Alignment   gi|NP_612421.1| retinol dehydrogenase 13 (all-trans and 9-cis) ...   155   3e-38
Alignment   gi|NP_660160.1| dehydrogenase/reductase (SDR family) X-linked [...   109   4e-28
Alignment   gi|NP_653284.1| hypothetical protein LOC147015 [Homo sapiens]        114   1e-25
Alignment   gi|NP_057457.1| WW domain-containing oxidoreductase isoform 1 [...    94   1e-24
Alignment   gi|NP_078981.1| hypothetical protein FLJ13639 isoform 2 [Homo s...    74   2e-13
Alignment   gi|NP_001026889.1| hypothetical protein FLJ13639 isoform 1 [Hom...    74   2e-13
Alignment   gi|XP_947127.1| PREDICTED: similar to short-chain dehydrogenase...    48   2e-11

>ref|NP_057110.2| androgen-regulated short-chain dehydrogenase/reductase 1 [Homo
           sapiens]
          Length = 318

 Score =  270 bits (690), Expect(2) = 4e-93
 Identities = 135/166 (81%), Positives = 143/166 (86%)
 Frame = +2

Query: 224 KEESVAREIQNMTGNQQVLVRKLDLADTKSIRAFAKGFLAEEKHLHILINNAGVMMCPYS 403
           K E VA+EIQ  TGNQQVLVRKLDL+DTKSIRAFAKGFLAEEKHLH+LINNAGVMMCPYS
Sbjct: 77  KGELVAKEIQTTTGNQQVLVRKLDLSDTKSIRAFAKGFLAEEKHLHVLINNAGVMMCPYS 136

Query: 404 KTADGFETRIGVNXXXXXXXXXXXXXXXKESAPSRVVNVSSLAHHMGRIHFHNLQGEKFY 583
           KTADGFE  IGVN               KESAPSR+VNVSSLAHH+GRIHFHNLQGEKFY
Sbjct: 137 KTADGFEMHIGVNHLGHFLLTHLLLEKLKESAPSRIVNVSSLAHHLGRIHFHNLQGEKFY 196

Query: 584 HAGLAYCNSKLANVLFTQELARRLKGSGVTTYSVHPGTVDSELGRH 721
           +AGLAYC+SKLAN+LFTQELARRLKGSGVTTYSVHPGTV SEL RH
Sbjct: 197 NAGLAYCHSKLANILFTQELARRLKGSGVTTYSVHPGTVQSELVRH 242



 Score = 90.1 bits (222), Expect(2) = 4e-93
 Identities = 44/48 (91%), Positives = 46/48 (95%)
 Frame = +1

Query: 88  YIAVPQIRKMLSSGVCTSTVQLPGKVAVVTGANTGIGKETAKELAKRG 231
           Y+A PQIRKMLSSGVCTSTVQLPGKV VVTGANTGIGKETAKELA+RG
Sbjct: 18  YMAAPQIRKMLSSGVCTSTVQLPGKVVVVTGANTGIGKETAKELAQRG 65


>ref|NP_689656.1| retinol dehydrogenase 12 (all-trans and 9-cis) [Homo sapiens]
          Length = 316

 Score =  229 bits (584), Expect(2) = 8e-76
 Identities = 118/167 (70%), Positives = 133/167 (79%)
 Frame = +2

Query: 221 LKEESVAREIQNMTGNQQVLVRKLDLADTKSIRAFAKGFLAEEKHLHILINNAGVMMCPY 400
           LK ES A EI+  T N QVLVRKLDL+DTKSIRAFA+GFLAEEK LHILINNAGVMMCPY
Sbjct: 74  LKGESAASEIRVDTKNSQVLVRKLDLSDTKSIRAFAEGFLAEEKQLHILINNAGVMMCPY 133

Query: 401 SKTADGFETRIGVNXXXXXXXXXXXXXXXKESAPSRVVNVSSLAHHMGRIHFHNLQGEKF 580
           SKTADGFET +GVN               K SAP+RVVNVSS+AHH+G+I FH+LQ EK 
Sbjct: 134 SKTADGFETHLGVNHLGHFLLTYLLLEQLKVSAPARVVNVSSVAHHIGKIPFHDLQSEKR 193

Query: 581 YHAGLAYCNSKLANVLFTQELARRLKGSGVTTYSVHPGTVDSELGRH 721
           Y  G AYC+SKLANVLFT+ELA+RL+G+GVTTY+VHPG V SEL RH
Sbjct: 194 YSRGFAYCHSKLANVLFTRELAKRLQGTGVTTYAVHPGVVRSELVRH 240



 Score = 73.2 bits (178), Expect(2) = 8e-76
 Identities = 33/48 (68%), Positives = 38/48 (79%)
 Frame = +1

Query: 88  YIAVPQIRKMLSSGVCTSTVQLPGKVAVVTGANTGIGKETAKELAKRG 231
           Y+  P IRK  + GVC + VQLPGKV V+TGANTGIGKETA+ELA RG
Sbjct: 16  YMVAPSIRKFFAGGVCRTNVQLPGKVVVITGANTGIGKETARELASRG 63


>ref|NP_065956.1| retinol dehydrogenase 14 (all-trans and 9-cis) [Homo sapiens]
          Length = 336

 Score =  147 bits (372), Expect(2) = 2e-39
 Identities = 75/155 (48%), Positives = 99/155 (63%)
 Frame = +2

Query: 257 MTGNQQVLVRKLDLADTKSIRAFAKGFLAEEKHLHILINNAGVMMCPYSKTADGFETRIG 436
           ++G  +++VR+LDLA  +S+RAF +  L EE  L +LINNAG+  CPY KT DGFE + G
Sbjct: 103 VSGVGELIVRELDLASLRSVRAFCQEMLQEEPRLDVLINNAGIFQCPYMKTEDGFEMQFG 162

Query: 437 VNXXXXXXXXXXXXXXXKESAPSRVVNVSSLAHHMGRIHFHNLQGEKFYHAGLAYCNSKL 616
           VN               K SAPSR+V VSS  +  G I+F +L  E+ Y+    Y  SKL
Sbjct: 163 VNHLGHFLLTNLLLGLLKSSAPSRIVVVSSKLYKYGDINFDDLNSEQSYNKSFCYSRSKL 222

Query: 617 ANVLFTQELARRLKGSGVTTYSVHPGTVDSELGRH 721
           AN+LFT+ELARRL+G+ VT   +HPG V + LGRH
Sbjct: 223 ANILFTRELARRLEGTNVTVNVLHPGIVRTNLGRH 257



 Score = 33.1 bits (74), Expect(2) = 2e-39
 Identities = 13/25 (52%), Positives = 19/25 (76%)
 Frame = +1

Query: 157 GKVAVVTGANTGIGKETAKELAKRG 231
           GK  ++TGAN+G+G+ TA EL + G
Sbjct: 43  GKTVLITGANSGLGRATAAELLRLG 67


>ref|NP_612421.1| retinol dehydrogenase 13 (all-trans and 9-cis) [Homo sapiens]
          Length = 260

 Score =  155 bits (392), Expect = 3e-38
 Identities = 85/167 (50%), Positives = 107/167 (64%), Gaps = 1/167 (0%)
 Frame = +2

Query: 224 KEESVAREIQNMTGNQQVLVRKLDLADTKSIRAFAKGFLAEEKHLHILINNAGVMMCPYS 403
           K E+ A++I+  T N  V  R LDLA  KSIR FA   + EE+ + ILINNAGVM CP+ 
Sbjct: 3   KCEAAAKDIRGETLNHHVNARHLDLASLKSIREFAAKIIEEEERVDILINNAGVMRCPHW 62

Query: 404 KTADGFETRIGVNXXXXXXXXXXXXXXXKESAPSRVVNVSSLAHHMGRIHFHNLQGE-KF 580
            T DGFE + GVN               K SAPSR++N+SSLAH  G I F +L  + + 
Sbjct: 63  TTEDGFEMQFGVNHLGHFLLTNLLLDKLKASAPSRIINLSSLAHVAGHIDFDDLNWQTRK 122

Query: 581 YHAGLAYCNSKLANVLFTQELARRLKGSGVTTYSVHPGTVDSELGRH 721
           Y+   AYC SKLA VLFT+EL+RRL+GSGVT  ++HPG   +ELGRH
Sbjct: 123 YNTKAAYCQSKLAIVLFTKELSRRLQGSGVTVNALHPGVARTELGRH 169


>ref|NP_660160.1| dehydrogenase/reductase (SDR family) X-linked [Homo sapiens]
          Length = 330

 Score =  109 bits (272), Expect(2) = 4e-28
 Identities = 70/172 (40%), Positives = 90/172 (52%), Gaps = 6/172 (3%)
 Frame = +2

Query: 224 KEESVAREIQNMTGNQQVLVRKLDLADTKSIRAFAKGFLAEEKHLHILINNAGVMMCPYS 403
           K + V  +I+  T N +V     DLA   SIR F + F  ++  LH+LINNAGVMM P  
Sbjct: 79  KAKQVVSKIKEETLNDKVEFLYCDLASMTSIRQFVQKFKMKKIPLHVLINNAGVMMVPQR 138

Query: 404 KTADGFETRIGVNXXXXXXXXXXXXXXXKESA----PSRVVNVSSLAHHMGRIHFHNLQG 571
           KT DGFE   G+N               KES      +RVV VSS  H++  ++  +LQ 
Sbjct: 139 KTRDGFEEHFGLNYLGHFLLTNLLLDTLKESGSPGHSARVVTVSSATHYVAELNMDDLQS 198

Query: 572 EKFYHAGLAYCNSKLANVLFTQELARRL--KGSGVTTYSVHPGTVDSELGRH 721
              Y    AY  SKLA VLFT  L R L  +GS VT   V PG V+++L +H
Sbjct: 199 SACYSPHAAYAQSKLALVLFTYHLQRLLAAEGSHVTANVVDPGVVNTDLYKH 250



 Score = 33.9 bits (76), Expect(2) = 4e-28
 Identities = 15/27 (55%), Positives = 19/27 (70%)
 Frame = +1

Query: 154 PGKVAVVTGANTGIGKETAKELAKRGI 234
           P +VA+VTG   GIG  TAK LA+ G+
Sbjct: 42  PDRVAIVTGGTDGIGYSTAKHLARLGM 68


>ref|NP_653284.1| hypothetical protein LOC147015 [Homo sapiens]
          Length = 327

 Score =  114 bits (284), Expect = 1e-25
 Identities = 69/169 (40%), Positives = 96/169 (56%), Gaps = 2/169 (1%)
 Frame = +2

Query: 212 KSWLKEESVAREIQNMTGNQQVLVRKLDLADTKSIRAFAKGFLAEEKHLHILINNAGVMM 391
           +S  + E+ A +++  +GN +V+   LDLA   S+RAFA  FL+ E  L ILI+NAG+  
Sbjct: 18  RSQERGEAAAFDLRQESGNNEVIFMALDLASLASVRAFATAFLSSEPRLDILIHNAGISS 77

Query: 392 CPYSKTADGFETRIGVNXXXXXXXXXXXXXXXKESAPSRVVNVSSLAHHMGRIHFHNLQG 571
           C   +T + F   + VN               K  APSRVV V+S AH  GR+ F  L  
Sbjct: 78  C--GRTREAFNLLLRVNHIGPFLLTHLLLPCLKACAPSRVVVVASAAHCRGRLDFKRLDR 135

Query: 572 E--KFYHAGLAYCNSKLANVLFTQELARRLKGSGVTTYSVHPGTVDSEL 712
               +     AY ++KLANVLF +ELA +L+ +GVT Y+ HPG V+SEL
Sbjct: 136 PVVGWRQELRAYADTKLANVLFARELANQLEATGVTCYAAHPGPVNSEL 184


>ref|NP_057457.1| WW domain-containing oxidoreductase isoform 1 [Homo sapiens]
          Length = 414

 Score = 94.4 bits (233), Expect(2) = 1e-24
 Identities = 63/165 (38%), Positives = 87/165 (52%), Gaps = 8/165 (4%)
 Frame = +2

Query: 230 ESVAREIQNMTGNQQVLVRKLDLADTKSIRAFAKGFLAEEKHLHILINNAGVMMCPYSKT 409
           E+V+R ++      +V    LDLA  +S++ FA+ F A+   LH+L+ NA     P+S T
Sbjct: 163 EAVSRILEEWH-KAKVEAMTLDLALLRSVQHFAEAFKAKNVPLHVLVCNAATFALPWSLT 221

Query: 410 ADGFETRIGVNXXXXXXXXXXXXXXXKESAPSRVVNVSSLAHH-------MGRIHFHNLQ 568
            DG ET   VN                 SAP+RV+ VSS +H        +G++ F  L 
Sbjct: 222 KDGLETTFQVNHLGHFYLVQLLQDVLCRSAPARVIVVSSESHRFTDINDSLGKLDFSRLS 281

Query: 569 GEKF-YHAGLAYCNSKLANVLFTQELARRLKGSGVTTYSVHPGTV 700
             K  Y A LAY  SKL N+LF+ EL RRL   GVT+ +VHPG +
Sbjct: 282 PTKNDYWAMLAYNRSKLCNILFSNELHRRLSPRGVTSNAVHPGNM 326



 Score = 37.4 bits (85), Expect(2) = 1e-24
 Identities = 18/25 (72%), Positives = 19/25 (76%)
 Frame = +1

Query: 157 GKVAVVTGANTGIGKETAKELAKRG 231
           GKV VVTGAN+GIG ETAK  A  G
Sbjct: 124 GKVVVVTGANSGIGFETAKSFALHG 148


>ref|NP_078981.1| hypothetical protein FLJ13639 isoform 2 [Homo sapiens]
          Length = 242

 Score = 73.6 bits (179), Expect = 2e-13
 Identities = 56/188 (29%), Positives = 86/188 (45%), Gaps = 1/188 (0%)
 Frame = +2

Query: 146 SSFLGKSLWSLEPTQALGRRRPKSWLKEESVAREIQNMTGNQQVLVRKLDLADTKSIRAF 325
           S FL +S WSLE T AL ++ P   LK  S           + + +  +DL+D K I  F
Sbjct: 15  SRFLEESFWSLEETAALAKQLP---LKSPS-----------ENIFLHIVDLSDPKQIWKF 60

Query: 326 AKGFLAEEKHLHILINNAGVMMCPYSKTADGFETRIGVNXXXXXXXXXXXXXXXKESAPS 505
            + F  E K LH+LINNAG M+     T DG E     N               ++    
Sbjct: 61  VENFKQEHK-LHVLINNAGCMVNKRELTEDGLEKNFAANTLGVYILTTGLIPVLEKEHDP 119

Query: 506 RVVNVSSLAHHMGRIHFHNLQGEKF-YHAGLAYCNSKLANVLFTQELARRLKGSGVTTYS 682
           RV+ VSS    + +++ ++LQ E+  +   + Y  +K   V+ T+  A+      +   S
Sbjct: 120 RVITVSSGGMLVQKLNTNDLQSERTPFDGTMVYAQNKRQQVVLTERWAQ--GHPAIHFSS 177

Query: 683 VHPGTVDS 706
           +HPG  D+
Sbjct: 178 MHPGWADT 185


>ref|NP_001026889.1| hypothetical protein FLJ13639 isoform 1 [Homo sapiens]
          Length = 271

 Score = 73.6 bits (179), Expect = 2e-13
 Identities = 56/188 (29%), Positives = 86/188 (45%), Gaps = 1/188 (0%)
 Frame = +2

Query: 146 SSFLGKSLWSLEPTQALGRRRPKSWLKEESVAREIQNMTGNQQVLVRKLDLADTKSIRAF 325
           S FL +S WSLE T AL ++ P   LK  S           + + +  +DL+D K I  F
Sbjct: 15  SRFLEESFWSLEETAALAKQLP---LKSPS-----------ENIFLHIVDLSDPKQIWKF 60

Query: 326 AKGFLAEEKHLHILINNAGVMMCPYSKTADGFETRIGVNXXXXXXXXXXXXXXXKESAPS 505
            + F  E K LH+LINNAG M+     T DG E     N               ++    
Sbjct: 61  VENFKQEHK-LHVLINNAGCMVNKRELTEDGLEKNFAANTLGVYILTTGLIPVLEKEHDP 119

Query: 506 RVVNVSSLAHHMGRIHFHNLQGEKF-YHAGLAYCNSKLANVLFTQELARRLKGSGVTTYS 682
           RV+ VSS    + +++ ++LQ E+  +   + Y  +K   V+ T+  A+      +   S
Sbjct: 120 RVITVSSGGMLVQKLNTNDLQSERTPFDGTMVYAQNKRQQVVLTERWAQ--GHPAIHFSS 177

Query: 683 VHPGTVDS 706
           +HPG  D+
Sbjct: 178 MHPGWADT 185


>ref|XP_947127.1| PREDICTED: similar to short-chain dehydrogenase/reductase 1 [Homo
           sapiens]
          Length = 916

 Score = 47.8 bits (112), Expect(2) = 2e-11
 Identities = 25/67 (37%), Positives = 40/67 (59%), Gaps = 1/67 (1%)
 Frame = +2

Query: 245 EIQNMTGNQQVLVRKLDLADTKSIRAFAKGFLAEEKHLHILINNAGVM-MCPYSKTADGF 421
           EIQ  + + ++L+ ++DL+   SIR+FA+  L E   +H+L+NNAGV  M P + T  G 
Sbjct: 670 EIQAASNSNRLLLGEVDLSSMTSIRSFARRLLQENPEIHLLVNNAGVSGMIPKTLTPGGL 729

Query: 422 ETRIGVN 442
           +     N
Sbjct: 730 DLTFVTN 736



 Score = 39.3 bits (90), Expect(2) = 2e-11
 Identities = 21/41 (51%), Positives = 30/41 (73%), Gaps = 2/41 (4%)
 Frame = +1

Query: 115 MLSSGVCTSTVQ--LPGKVAVVTGANTGIGKETAKELAKRG 231
           +LSSGV     +  L GK+A+VTGAN+GIGK  +++LA+ G
Sbjct: 611 LLSSGVPEQEDKEDLTGKIAIVTGANSGIGKVVSQDLARCG 651


  Database: RefSeqHP
    Posted date:  Aug 2, 2006 12:57 AM
  Number of letters in database: 17,774,539
  Number of sequences in database:  39,411
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 29,624,997
Number of Sequences: 39411
Number of extensions: 782976
Number of successful extensions: 2397
Number of sequences better than 1.0e-05: 10
Number of HSP's better than  0.0 without gapping: 2144
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2385
length of database: 17,774,539
effective HSP length: 100
effective length of database: 13,833,439
effective search space used: 2144183045
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqMP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611S-034822
         (769 letters)

Database: RefSeqMP 
           45,328 sequences; 21,768,885 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_067532.2| short-chain dehydrogenase/reductase 1 [Mus musc...   256   2e-87
Alignment   gi|NP_084293.1| retinol dehydrogenase 12 [Mus musculus]              209   1e-70
Alignment   gi|NP_780581.1| retinol dehydrogenase 13 (all-trans and 9-cis) ...   150   7e-47
Alignment   gi|NP_076186.1| alcohol dehydrogenase PAN2 [Mus musculus]            147   3e-39
Alignment   gi|NP_899109.1| hypothetical protein LOC70451 [Mus musculus]         115   4e-32
Alignment   gi|NP_062519.2| WW-domain oxidoreductase [Mus musculus]               91   3e-23
Alignment   gi|NP_001028498.1| dehydrogenase/reductase (SDR family) X chrom...   102   3e-22
Alignment   gi|NP_079798.1| retinal short-chain dehydrogenase/reductase 4 [...    42   3e-07

>ref|NP_067532.2| short-chain dehydrogenase/reductase 1 [Mus musculus]
          Length = 316

 Score =  256 bits (653), Expect(2) = 2e-87
 Identities = 128/166 (77%), Positives = 138/166 (83%)
 Frame = +2

Query: 224 KEESVAREIQNMTGNQQVLVRKLDLADTKSIRAFAKGFLAEEKHLHILINNAGVMMCPYS 403
           K E  AREIQ +TGN QV VRKLDLADTKSIRAFAK FLAEEKHLH+LINNAGVMMCPYS
Sbjct: 74  KGELAAREIQAVTGNSQVFVRKLDLADTKSIRAFAKDFLAEEKHLHLLINNAGVMMCPYS 133

Query: 404 KTADGFETRIGVNXXXXXXXXXXXXXXXKESAPSRVVNVSSLAHHMGRIHFHNLQGEKFY 583
           KTADGFE  IGVN               KESAPSR+VN+SSL HH+GRIHFHNLQGEKFY
Sbjct: 134 KTADGFEMHIGVNHLGHFLLTHLLLEKLKESAPSRIVNLSSLGHHLGRIHFHNLQGEKFY 193

Query: 584 HAGLAYCNSKLANVLFTQELARRLKGSGVTTYSVHPGTVDSELGRH 721
            AGLAYC+SKLAN+LFT+ELA+RLKGSGVTTYSVHPGTV SEL R+
Sbjct: 194 SAGLAYCHSKLANILFTKELAKRLKGSGVTTYSVHPGTVHSELTRY 239



 Score = 85.5 bits (210), Expect(2) = 2e-87
 Identities = 40/48 (83%), Positives = 45/48 (93%)
 Frame = +1

Query: 88  YIAVPQIRKMLSSGVCTSTVQLPGKVAVVTGANTGIGKETAKELAKRG 231
           Y+  P+IRKMLSSGVCTS VQLPGKVA+VTGANTGIGKETAK+LA+RG
Sbjct: 15  YLVTPKIRKMLSSGVCTSNVQLPGKVAIVTGANTGIGKETAKDLAQRG 62


>ref|NP_084293.1| retinol dehydrogenase 12 [Mus musculus]
          Length = 316

 Score =  209 bits (533), Expect(2) = 1e-70
 Identities = 109/167 (65%), Positives = 129/167 (77%)
 Frame = +2

Query: 221 LKEESVAREIQNMTGNQQVLVRKLDLADTKSIRAFAKGFLAEEKHLHILINNAGVMMCPY 400
           LK ES A EI+  T N QVLVRKLDL+DTKSIRAFA+ FLAEEK LHILINNAGVMMCPY
Sbjct: 74  LKGESAASEIRADTKNSQVLVRKLDLSDTKSIRAFAERFLAEEKKLHILINNAGVMMCPY 133

Query: 401 SKTADGFETRIGVNXXXXXXXXXXXXXXXKESAPSRVVNVSSLAHHMGRIHFHNLQGEKF 580
           SKT DGFET  GVN               KESAP+RVVN+SS+AH +G+I FH+LQG+K 
Sbjct: 134 SKTTDGFETHFGVNHLGHFLLTYLLLERLKESAPARVVNLSSIAHLIGKIRFHDLQGQKR 193

Query: 581 YHAGLAYCNSKLANVLFTQELARRLKGSGVTTYSVHPGTVDSELGRH 721
           Y +  AY +SKLAN+LFT+ELA+RL+G+GVT Y+VHPG V SE+ R+
Sbjct: 194 YCSAFAYGHSKLANLLFTRELAKRLQGTGVTAYAVHPGVVLSEITRN 240



 Score = 75.9 bits (185), Expect(2) = 1e-70
 Identities = 33/48 (68%), Positives = 40/48 (83%)
 Frame = +1

Query: 88  YIAVPQIRKMLSSGVCTSTVQLPGKVAVVTGANTGIGKETAKELAKRG 231
           Y+  P IRK  + GVCT+ VQ+PGKV V+TGANTGIGKETA+ELA+RG
Sbjct: 16  YLTAPSIRKFFAGGVCTTNVQIPGKVVVITGANTGIGKETARELARRG 63


>ref|NP_780581.1| retinol dehydrogenase 13 (all-trans and 9-cis) [Mus musculus]
          Length = 334

 Score =  150 bits (380), Expect(2) = 7e-47
 Identities = 82/167 (49%), Positives = 105/167 (62%), Gaps = 1/167 (0%)
 Frame = +2

Query: 224 KEESVAREIQNMTGNQQVLVRKLDLADTKSIRAFAKGFLAEEKHLHILINNAGVMMCPYS 403
           K E  A++I+  T N +V   +LDLA  KSIR FA+  + EE+ + IL+NNA VM CP+ 
Sbjct: 74  KCEVAAKDIRGETLNPRVRAERLDLASLKSIREFARKVIKEEERVDILVNNAAVMRCPHW 133

Query: 404 KTADGFETRIGVNXXXXXXXXXXXXXXXKESAPSRVVNVSSLAHHMGRIHFHNLQGE-KF 580
            T DGFE + GVN               K SAPSR++N+SSLAH  G I F +L  + K 
Sbjct: 134 TTEDGFEMQFGVNYLGHFLLTNLLLDKLKASAPSRIINLSSLAHVAGHIDFEDLNWQMKK 193

Query: 581 YHAGLAYCNSKLANVLFTQELARRLKGSGVTTYSVHPGTVDSELGRH 721
           Y    AYC SKLA VLFT+EL+ RL+GSGVT  ++HPG   +ELGRH
Sbjct: 194 YDTKAAYCQSKLAVVLFTKELSHRLQGSGVTVNALHPGVARTELGRH 240



 Score = 55.5 bits (132), Expect(2) = 7e-47
 Identities = 24/42 (57%), Positives = 31/42 (73%)
 Frame = +1

Query: 106 IRKMLSSGVCTSTVQLPGKVAVVTGANTGIGKETAKELAKRG 231
           ++  ++ G C S   +PGK  +VTGANTGIGK+TA ELAKRG
Sbjct: 21  LKDYVAGGACPSKATIPGKTVIVTGANTGIGKQTALELAKRG 62


>ref|NP_076186.1| alcohol dehydrogenase PAN2 [Mus musculus]
          Length = 334

 Score =  147 bits (372), Expect(2) = 3e-39
 Identities = 75/150 (50%), Positives = 97/150 (64%)
 Frame = +2

Query: 272 QVLVRKLDLADTKSIRAFAKGFLAEEKHLHILINNAGVMMCPYSKTADGFETRIGVNXXX 451
           Q++V++LDLA  +S+RAF +  L EE  L +LINNAGV  CPY+KT DGFE + GVN   
Sbjct: 106 QLVVKELDLASLRSVRAFCQELLQEEPRLDVLINNAGVFHCPYTKTEDGFEMQFGVNHLG 165

Query: 452 XXXXXXXXXXXXKESAPSRVVNVSSLAHHMGRIHFHNLQGEKFYHAGLAYCNSKLANVLF 631
                       K SAPSR+V VSS  +  G I+F +L  E+ Y+    Y  SKLAN+LF
Sbjct: 166 HFLLTNLLLGLLKSSAPSRIVVVSSKLYKYGEINFEDLNSEQSYNKSFCYSRSKLANILF 225

Query: 632 TQELARRLKGSGVTTYSVHPGTVDSELGRH 721
           T+ELARRL+G+ VT   +HPG V + LGRH
Sbjct: 226 TRELARRLEGTNVTVNVLHPGIVRTNLGRH 255



 Score = 33.1 bits (74), Expect(2) = 3e-39
 Identities = 13/25 (52%), Positives = 19/25 (76%)
 Frame = +1

Query: 157 GKVAVVTGANTGIGKETAKELAKRG 231
           GK  ++TGAN+G+G+ TA EL + G
Sbjct: 44  GKTVLITGANSGLGRATAAELLRLG 68


>ref|NP_899109.1| hypothetical protein LOC70451 [Mus musculus]
          Length = 260

 Score =  115 bits (288), Expect(2) = 4e-32
 Identities = 68/163 (41%), Positives = 94/163 (57%), Gaps = 2/163 (1%)
 Frame = +2

Query: 230 ESVAREIQNMTGNQQVLVRKLDLADTKSIRAFAKGFLAEEKHLHILINNAGVMMCPYSKT 409
           E+ A +++  +GN +V+   LDLA   S++AFA  FL+ E  L +LI+NAG+  C   +T
Sbjct: 74  EAAAFDLRQESGNNEVIFMALDLASLASVQAFATAFLSSEPRLDVLIHNAGISSC--GRT 131

Query: 410 ADGFETRIGVNXXXXXXXXXXXXXXXKESAPSRVVNVSSLAHHMGRIHFHNLQGEK--FY 583
            + F   + VN               +  APSRVV VSS AH  GR+ F  L      + 
Sbjct: 132 RETFNLLLRVNHVGPFLLTHLLLPRLRSCAPSRVVIVSSAAHRRGRLDFTRLDCPVVGWQ 191

Query: 584 HAGLAYCNSKLANVLFTQELARRLKGSGVTTYSVHPGTVDSEL 712
               AY +SKLANVLF +ELA +L+G+GVT Y+ HPG V+SEL
Sbjct: 192 QELRAYADSKLANVLFARELATQLEGTGVTCYAAHPGPVNSEL 234



 Score = 41.2 bits (95), Expect(2) = 4e-32
 Identities = 20/33 (60%), Positives = 23/33 (69%)
 Frame = +1

Query: 133 CTSTVQLPGKVAVVTGANTGIGKETAKELAKRG 231
           C     L G+  VVTGAN+GIGK TA ELA+RG
Sbjct: 28  CGGIGSLRGRTVVVTGANSGIGKMTALELARRG 60


>ref|NP_062519.2| WW-domain oxidoreductase [Mus musculus]
          Length = 414

 Score = 90.9 bits (224), Expect(2) = 3e-23
 Identities = 60/165 (36%), Positives = 85/165 (51%), Gaps = 8/165 (4%)
 Frame = +2

Query: 230 ESVAREIQNMTGNQQVLVRKLDLADTKSIRAFAKGFLAEEKHLHILINNAGVMMCPYSKT 409
           E+V+R ++      +V    LDLA  +S++ FA+ F A+   LH+L+ NAG    P+  T
Sbjct: 163 EAVSRILEEWH-KAKVEAMTLDLAVLRSVQHFAEAFKAKNVSLHVLVCNAGTFALPWGLT 221

Query: 410 ADGFETRIGVNXXXXXXXXXXXXXXXKESAPSRVVNVSSLAHHM-------GRIHFHNLQ 568
            DG ET   VN                 S+P+RV+ VSS +H         G++    L 
Sbjct: 222 KDGLETTFQVNHLGHFYLVQLLQDVLCRSSPARVIVVSSESHRFTDINDSSGKLDLSRLS 281

Query: 569 GEKF-YHAGLAYCNSKLANVLFTQELARRLKGSGVTTYSVHPGTV 700
             +  Y A LAY  SKL N+LF+ EL RRL   GVT+ +VHPG +
Sbjct: 282 PPRSDYWAMLAYNRSKLCNILFSNELHRRLSPRGVTSNAVHPGNM 326



 Score = 36.2 bits (82), Expect(2) = 3e-23
 Identities = 17/25 (68%), Positives = 19/25 (76%)
 Frame = +1

Query: 157 GKVAVVTGANTGIGKETAKELAKRG 231
           GKV +VTGAN+GIG ETAK  A  G
Sbjct: 124 GKVVLVTGANSGIGFETAKSFALHG 148


>ref|NP_001028498.1| dehydrogenase/reductase (SDR family) X chromosome [Mus musculus]
          Length = 335

 Score =  102 bits (255), Expect = 3e-22
 Identities = 65/170 (38%), Positives = 85/170 (50%), Gaps = 6/170 (3%)
 Frame = +2

Query: 230 ESVAREIQNMTGNQQVLVRKLDLADTKSIRAFAKGFLAEEKHLHILINNAGVMMCPYSKT 409
           + V   I+   G+ +     LDLA   S+R FA+ F A    LH+L+NNAGVM+ P ++T
Sbjct: 81  QEVVSSIRAEMGSDRAHFLPLDLASLASVRGFARDFQALGLPLHLLVNNAGVMLEPRAET 140

Query: 410 ADGFETRIGVNXXXXXXXXX----XXXXXXKESAPSRVVNVSSLAHHMGRIHFHNLQGEK 577
            DGFE  +GVN                    E   SRVV V S  H++G +   +L G  
Sbjct: 141 EDGFERHLGVNFLGHFLLTLLLLPALRASGAEGRGSRVVTVGSATHYVGTVDMADLHGRH 200

Query: 578 FYHAGLAYCNSKLANVLFTQELARRL--KGSGVTTYSVHPGTVDSELGRH 721
            Y    AY  SKLA  LF  +L R L  +G  VT+    PG VD+EL RH
Sbjct: 201 AYSPYAAYAQSKLALALFALQLQRILDARGDPVTSNMADPGVVDTELYRH 250


>ref|NP_079798.1| retinal short-chain dehydrogenase/reductase 4 [Mus musculus]
          Length = 288

 Score = 42.4 bits (98), Expect(2) = 3e-07
 Identities = 39/162 (24%), Positives = 62/162 (38%), Gaps = 23/162 (14%)
 Frame = +2

Query: 269 QQVLVRKLDLADTKSIRAFAKGFLAEEKHLHILINNAG--VMMCPYSKTADGFETRIGVN 442
           + +LV  LDL DT S  A  K  L E   + IL+NN G            D F+  I +N
Sbjct: 53  KDILVLPLDLTDTSSHEAATKAVLQEFGKIDILVNNGGRSQRSLVLETNLDVFKELINLN 112

Query: 443 XXXXXXXXXXXXXXXKESAPSRVVNVSSLA--------------HHMGRIHFHNLQGEKF 580
                           E    ++V V+S+A               H  R  F+ L  E  
Sbjct: 113 YIGTVSLTKCVLPHMIERKQGKIVTVNSIAGIASVSLSSGYCASKHALRGFFNALHSELG 172

Query: 581 YHAGLAYCN-------SKLANVLFTQELARRLKGSGVTTYSV 685
            + G+ +CN       S +    FT+E+ + ++ +   +Y +
Sbjct: 173 QYPGITFCNVYPGPVQSDIVKNAFTEEVTKSMRNNIDQSYKM 214



 Score = 30.4 bits (67), Expect(2) = 3e-07
 Identities = 14/25 (56%), Positives = 20/25 (80%)
 Frame = +1

Query: 163 VAVVTGANTGIGKETAKELAKRGIS 237
           V  VTGA++GIG+E A +L+K G+S
Sbjct: 2   VVWVTGASSGIGEELAFQLSKLGVS 26


  Database: RefSeqMP
    Posted date:  Aug 2, 2006 12:58 AM
  Number of letters in database: 21,768,885
  Number of sequences in database:  45,328
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 35,226,538
Number of Sequences: 45328
Number of extensions: 901529
Number of successful extensions: 2639
Number of sequences better than 1.0e-05: 8
Number of HSP's better than  0.0 without gapping: 2418
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2628
length of database: 21,768,885
effective HSP length: 101
effective length of database: 17,190,757
effective search space used: 2647376578
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqCP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611S-034822
         (769 letters)

Database: RefSeqCP 
           33,732 sequences; 19,266,565 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|XP_854354.1| PREDICTED: similar to Retinol dehydrogenase 11 ...   265   7e-88
Alignment   gi|XP_547866.2| PREDICTED: similar to retinol dehydrogenase 12 ...   235   6e-76
Alignment   gi|XP_854127.1| PREDICTED: similar to Retinol dehydrogenase 13 ...   155   3e-48
Alignment   gi|XP_540096.2| PREDICTED: similar to retinol dehydrogenase 14 ...   146   3e-38
Alignment   gi|XP_548293.2| PREDICTED: similar to retinol dehydrogenase 11 ...   117   2e-33
Alignment   gi|XP_852222.1| PREDICTED: similar to dehydrogenase/reductase (...   115   1e-29
Alignment   gi|XP_852623.1| PREDICTED: similar to WW domain-containing oxid...    95   9e-25
Alignment   gi|XP_857582.1| PREDICTED: similar to retinol dehydrogenase 14 ...    92   4e-19
Alignment   gi|XP_533000.2| PREDICTED: similar to Retinol dehydrogenase 12 ...    91   1e-18

>ref|XP_854354.1| PREDICTED: similar to Retinol dehydrogenase 11 (Retinal reductase
           1) (RalR1) (Prostate short-chain dehydrogenase/reductase
           1) (Androgen-regulated short-chain
           dehydrogenase/reductase 1) (HCV core-binding protein
           HCBP12) [Canis familiaris]
          Length = 337

 Score =  265 bits (678), Expect(2) = 7e-88
 Identities = 132/167 (79%), Positives = 143/167 (85%)
 Frame = +2

Query: 221 LKEESVAREIQNMTGNQQVLVRKLDLADTKSIRAFAKGFLAEEKHLHILINNAGVMMCPY 400
           LK E VAREIQ MTGN+QVLVRKLDLADTKSIRAFAKGFLAEEKHLHILINNAGVMMCPY
Sbjct: 95  LKGELVAREIQTMTGNKQVLVRKLDLADTKSIRAFAKGFLAEEKHLHILINNAGVMMCPY 154

Query: 401 SKTADGFETRIGVNXXXXXXXXXXXXXXXKESAPSRVVNVSSLAHHMGRIHFHNLQGEKF 580
           +KT DGFE  +GVN               KESAPSR+VNVSSLAHH+GRIHFH+LQGEKF
Sbjct: 155 TKTVDGFEMHMGVNHLGHFLLTHLLLEKLKESAPSRIVNVSSLAHHLGRIHFHDLQGEKF 214

Query: 581 YHAGLAYCNSKLANVLFTQELARRLKGSGVTTYSVHPGTVDSELGRH 721
           Y++GLAYC+SKLAN+LFTQELARRLKGSG+T YSVHPGTV SEL RH
Sbjct: 215 YNSGLAYCHSKLANILFTQELARRLKGSGITAYSVHPGTVKSELVRH 261



 Score = 77.4 bits (189), Expect(2) = 7e-88
 Identities = 38/45 (84%), Positives = 42/45 (93%)
 Frame = +1

Query: 97  VPQIRKMLSSGVCTSTVQLPGKVAVVTGANTGIGKETAKELAKRG 231
           V ++ K+LS GVCTSTVQLPGKVAVVTGANTGIGKETAKELA+RG
Sbjct: 40  VDRLMKILSRGVCTSTVQLPGKVAVVTGANTGIGKETAKELAQRG 84


>ref|XP_547866.2| PREDICTED: similar to retinol dehydrogenase 12 (all-trans and
           9-cis) [Canis familiaris]
          Length = 303

 Score =  235 bits (600), Expect(2) = 6e-76
 Identities = 118/167 (70%), Positives = 135/167 (80%)
 Frame = +2

Query: 221 LKEESVAREIQNMTGNQQVLVRKLDLADTKSIRAFAKGFLAEEKHLHILINNAGVMMCPY 400
           LK ES A EI+  T N QVLVRKLDL+DTKSIRAFA+GFLAEEK LHILINNAGVMMCPY
Sbjct: 61  LKGESAASEIRADTKNSQVLVRKLDLSDTKSIRAFAEGFLAEEKQLHILINNAGVMMCPY 120

Query: 401 SKTADGFETRIGVNXXXXXXXXXXXXXXXKESAPSRVVNVSSLAHHMGRIHFHNLQGEKF 580
           SKTADGFET +GVN               KES P+RVVN+SS+AHH+G+IHFH+LQGEK 
Sbjct: 121 SKTADGFETHLGVNHLGHFLLTHLLLERLKESTPARVVNLSSVAHHIGKIHFHDLQGEKR 180

Query: 581 YHAGLAYCNSKLANVLFTQELARRLKGSGVTTYSVHPGTVDSELGRH 721
           Y  G AYC+SKLAN+LFT+ELA+RL+G+GVTTY+VHPG V SEL RH
Sbjct: 181 YSRGFAYCHSKLANMLFTRELAKRLQGTGVTTYAVHPGVVSSELVRH 227



 Score = 67.8 bits (164), Expect(2) = 6e-76
 Identities = 31/41 (75%), Positives = 35/41 (85%)
 Frame = +1

Query: 109 RKMLSSGVCTSTVQLPGKVAVVTGANTGIGKETAKELAKRG 231
           RK  + GVC S VQLPGKV V+TGANTGIGKETA+ELA+RG
Sbjct: 10  RKFFAGGVCRSNVQLPGKVVVITGANTGIGKETARELARRG 50


>ref|XP_854127.1| PREDICTED: similar to Retinol dehydrogenase 13 [Canis familiaris]
          Length = 334

 Score =  155 bits (391), Expect(2) = 3e-48
 Identities = 84/167 (50%), Positives = 106/167 (63%), Gaps = 1/167 (0%)
 Frame = +2

Query: 224 KEESVAREIQNMTGNQQVLVRKLDLADTKSIRAFAKGFLAEEKHLHILINNAGVMMCPYS 403
           K E+ A+EI+  T N +V    LDLA  KSIR FA   + EE+ +HIL+NNA VM CP+ 
Sbjct: 74  KCEAAAKEIRGETLNHRVSAWHLDLASLKSIREFAAKIIEEEEQVHILVNNAAVMRCPHW 133

Query: 404 KTADGFETRIGVNXXXXXXXXXXXXXXXKESAPSRVVNVSSLAHHMGRIHFHNLQGEK-F 580
            T DGFE + GVN               K SAPSR++N+SSLAH  G I F +L  EK  
Sbjct: 134 TTKDGFEMQFGVNHLGHFLLTNLLLDKLKASAPSRIINLSSLAHVAGHIDFDDLNWEKRK 193

Query: 581 YHAGLAYCNSKLANVLFTQELARRLKGSGVTTYSVHPGTVDSELGRH 721
           Y    AYC SKLA +LFT+EL+RRL+G+GVT  ++HPG   +ELGRH
Sbjct: 194 YDTKAAYCQSKLAVILFTKELSRRLQGTGVTVNALHPGVARTELGRH 240



 Score = 55.8 bits (133), Expect(2) = 3e-48
 Identities = 24/42 (57%), Positives = 31/42 (73%)
 Frame = +1

Query: 106 IRKMLSSGVCTSTVQLPGKVAVVTGANTGIGKETAKELAKRG 231
           +R  ++ G C S   +PGK  +VTGANTGIGK+TA ELA+RG
Sbjct: 21  LRDYIAGGACPSKATIPGKTVIVTGANTGIGKQTALELARRG 62


>ref|XP_540096.2| PREDICTED: similar to retinol dehydrogenase 14 (all-trans and
           9-cis) isoform 1 [Canis familiaris]
          Length = 336

 Score =  146 bits (368), Expect(2) = 3e-38
 Identities = 74/150 (49%), Positives = 96/150 (64%)
 Frame = +2

Query: 272 QVLVRKLDLADTKSIRAFAKGFLAEEKHLHILINNAGVMMCPYSKTADGFETRIGVNXXX 451
           +++VR+LDLA  +S+RAF +  L EE  L +LINNAG+  CPY KT DGFE + GVN   
Sbjct: 108 ELVVRELDLASLRSVRAFCQEVLQEEPRLDVLINNAGIFQCPYMKTEDGFEMQFGVNHLG 167

Query: 452 XXXXXXXXXXXXKESAPSRVVNVSSLAHHMGRIHFHNLQGEKFYHAGLAYCNSKLANVLF 631
                       K SAPSR+V VSS  +  G I+F +L  E+ Y+    Y  SKLAN+LF
Sbjct: 168 HFLLTNLLLGLLKNSAPSRIVVVSSKLYKYGDINFEDLNSEQSYNKSFCYSRSKLANILF 227

Query: 632 TQELARRLKGSGVTTYSVHPGTVDSELGRH 721
           T+ELARRL+G+ VT   +HPG V + LGRH
Sbjct: 228 TRELARRLEGTNVTVNVLHPGIVRTNLGRH 257



 Score = 30.8 bits (68), Expect(2) = 3e-38
 Identities = 12/25 (48%), Positives = 18/25 (72%)
 Frame = +1

Query: 157 GKVAVVTGANTGIGKETAKELAKRG 231
           GK  ++TGAN+G+G+ TA  L + G
Sbjct: 43  GKTVLITGANSGLGRATAAALLRLG 67


>ref|XP_548293.2| PREDICTED: similar to retinol dehydrogenase 11 (predicted) [Canis
           familiaris]
          Length = 377

 Score =  117 bits (292), Expect(2) = 2e-33
 Identities = 71/163 (43%), Positives = 93/163 (57%), Gaps = 2/163 (1%)
 Frame = +2

Query: 230 ESVAREIQNMTGNQQVLVRKLDLADTKSIRAFAKGFLAEEKHLHILINNAGVMMCPYSKT 409
           E+ A +++  +GN +V+   LDLA   S+RAFA  FL+ E  L ILI+NAG+  C   +T
Sbjct: 74  EAAAFDLRQESGNNEVIFMALDLASLASVRAFATAFLSSEPRLDILIHNAGISSC--GRT 131

Query: 410 ADGFETRIGVNXXXXXXXXXXXXXXXKESAPSRVVNVSSLAHHMGRIHFHNLQGEK--FY 583
              F   + VN               K  APSRVV VSS AH  GR+ F  L      + 
Sbjct: 132 HKPFNLLLRVNHIGPFLLTHLLLPRLKTCAPSRVVVVSSAAHRRGRLDFTRLDRPVVGWQ 191

Query: 584 HAGLAYCNSKLANVLFTQELARRLKGSGVTTYSVHPGTVDSEL 712
               AY +SKLANVLF +ELA +L+G+GVT Y+ HPG V+SEL
Sbjct: 192 QELRAYADSKLANVLFARELATQLEGTGVTCYAAHPGPVNSEL 234



 Score = 43.9 bits (102), Expect(2) = 2e-33
 Identities = 21/33 (63%), Positives = 24/33 (72%)
 Frame = +1

Query: 133 CTSTVQLPGKVAVVTGANTGIGKETAKELAKRG 231
           C     L G+ AVVTGAN+GIGK TA ELA+RG
Sbjct: 28  CGGIASLRGRTAVVTGANSGIGKMTALELARRG 60


>ref|XP_852222.1| PREDICTED: similar to dehydrogenase/reductase (SDR family) X-linked
           [Canis familiaris]
          Length = 387

 Score =  115 bits (287), Expect(2) = 1e-29
 Identities = 74/168 (44%), Positives = 92/168 (54%), Gaps = 6/168 (3%)
 Frame = +2

Query: 236 VAREIQNMTGNQQVLVRKLDLADTKSIRAFAKGFLAEEKHLHILINNAGVMMCPYSKTAD 415
           V R+IQ  T N +V     DLA  +SIR F + F  ++  LH+L+NNAGVMM P   T D
Sbjct: 135 VVRKIQEETLNDKVEFLYCDLASLRSIRQFVQKFKKKKIPLHVLVNNAGVMMVPERTTED 194

Query: 416 GFETRIGVNXXXXXXXXXXXXXXXKES-AP---SRVVNVSSLAHHMGRIHFHNLQGEKFY 583
           GFE   G+N               KES AP   +RVV VSS  H++G +   +LQG + Y
Sbjct: 195 GFEEHFGLNYLGHFLLTNLLLDTLKESGAPGRCARVVTVSSATHYIGELDMDDLQGSRCY 254

Query: 584 HAGLAYCNSKLANVLFTQELARRL--KGSGVTTYSVHPGTVDSELGRH 721
               AY  SKLA VLFT  L R L  +GS VT   V PG V++ L RH
Sbjct: 255 SPHAAYAQSKLALVLFTYHLQRLLAAQGSPVTANVVDPGVVNTNLYRH 302



 Score = 33.5 bits (75), Expect(2) = 1e-29
 Identities = 15/27 (55%), Positives = 19/27 (70%)
 Frame = +1

Query: 154 PGKVAVVTGANTGIGKETAKELAKRGI 234
           P +VA+VTG   GIG  TAK LA+ G+
Sbjct: 94  PERVAIVTGGTDGIGYSTAKHLARLGM 120


>ref|XP_852623.1| PREDICTED: similar to WW domain-containing oxidoreductase isoform 1
           [Canis familiaris]
          Length = 383

 Score = 94.7 bits (234), Expect(2) = 9e-25
 Identities = 60/145 (41%), Positives = 77/145 (53%), Gaps = 8/145 (5%)
 Frame = +2

Query: 290 LDLADTKSIRAFAKGFLAEEKHLHILINNAGVMMCPYSKTADGFETRIGVNXXXXXXXXX 469
           LDLA  +S++ FA+ F A+   LH+L+ NA     P+S T DG ET   VN         
Sbjct: 182 LDLALLRSVQHFAQAFKAKNVSLHVLVCNAAAFALPWSLTKDGLETTFQVNHLGHFYLVQ 241

Query: 470 XXXXXXKESAPSRVVNVSSLAHHM-------GRIHFHNLQGEKF-YHAGLAYCNSKLANV 625
                   SAP+RVV VSS +H         G++ F  L   K  Y A LAY  SKL N+
Sbjct: 242 LLQDVLCRSAPARVVVVSSESHRFTDINDSSGKLDFSRLSPSKSDYWAMLAYNRSKLCNI 301

Query: 626 LFTQELARRLKGSGVTTYSVHPGTV 700
           LF+ EL RRL   GVT+ +VHPG +
Sbjct: 302 LFSNELHRRLSPRGVTSNAVHPGNM 326



 Score = 37.4 bits (85), Expect(2) = 9e-25
 Identities = 18/25 (72%), Positives = 19/25 (76%)
 Frame = +1

Query: 157 GKVAVVTGANTGIGKETAKELAKRG 231
           GKV VVTGAN+GIG ETAK  A  G
Sbjct: 124 GKVVVVTGANSGIGFETAKSFALHG 148


>ref|XP_857582.1| PREDICTED: similar to retinol dehydrogenase 14 (all-trans and
           9-cis) isoform 4 [Canis familiaris]
          Length = 307

 Score = 92.4 bits (228), Expect = 4e-19
 Identities = 56/150 (37%), Positives = 76/150 (50%)
 Frame = +2

Query: 272 QVLVRKLDLADTKSIRAFAKGFLAEEKHLHILINNAGVMMCPYSKTADGFETRIGVNXXX 451
           +++VR+LDLA  +S+RAF +  L                             + GVN   
Sbjct: 108 ELVVRELDLASLRSVRAFCQEVL-----------------------------QFGVNHLG 138

Query: 452 XXXXXXXXXXXXKESAPSRVVNVSSLAHHMGRIHFHNLQGEKFYHAGLAYCNSKLANVLF 631
                       K SAPSR+V VSS  +  G I+F +L  E+ Y+    Y  SKLAN+LF
Sbjct: 139 HFLLTNLLLGLLKNSAPSRIVVVSSKLYKYGDINFEDLNSEQSYNKSFCYSRSKLANILF 198

Query: 632 TQELARRLKGSGVTTYSVHPGTVDSELGRH 721
           T+ELARRL+G+ VT   +HPG V + LGRH
Sbjct: 199 TRELARRLEGTNVTVNVLHPGIVRTNLGRH 228


>ref|XP_533000.2| PREDICTED: similar to Retinol dehydrogenase 12 [Canis familiaris]
          Length = 596

 Score = 90.9 bits (224), Expect = 1e-18
 Identities = 57/168 (33%), Positives = 87/168 (51%), Gaps = 1/168 (0%)
 Frame = +2

Query: 212 KSWLKEESVAREIQNMTGNQQVLVRKLDLADTKSIRAFAKGFLAEEKHLHILINNAGVMM 391
           ++W + +    EIQ  +    +L+ ++DL+   SIR+FA+  L E   +H+L+NNA +  
Sbjct: 347 RNWERGQKALAEIQVASKGTCLLLGQVDLSSMASIRSFARWLLQEYPEIHLLVNNAAISG 406

Query: 392 CPYSKTADGFETRIGVNXXXXXXXXXXXXXXXKESAPSRVVNVSSLAHHMGRIHFHNLQG 571
            P + T +G +     N               + +  +RVVNVSS  H  G +   +L G
Sbjct: 407 FPKTLTPEGLDLTFATNYVGPFLLTNLLQGALQRAGSARVVNVSSFRHAHGYVDEKHLTG 466

Query: 572 E-KFYHAGLAYCNSKLANVLFTQELARRLKGSGVTTYSVHPGTVDSEL 712
             K  +   +Y  SKL    FT ELARRL+G+GVT  SV PG V +E+
Sbjct: 467 AGKPLNLIQSYDCSKLLLTSFTGELARRLQGTGVTVNSVDPGVVYTEI 514


  Database: RefSeqCP
    Posted date:  Aug 1, 2006  9:25 PM
  Number of letters in database: 19,266,565
  Number of sequences in database:  33,732
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 30,623,126
Number of Sequences: 33732
Number of extensions: 784937
Number of successful extensions: 2387
Number of sequences better than 1.0e-05: 9
Number of HSP's better than  0.0 without gapping: 2155
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2376
length of database: 19,266,565
effective HSP length: 101
effective length of database: 15,859,633
effective search space used: 2442383482
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)