Animal-Genome cDNA 20060611S-035040


Search to RefSeqSP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611S-035040
         (751 letters)

Database: RefSeqSP 
           1040 sequences; 434,620 total letters

Searching...done

 ***** No hits found ******

  Database: RefSeqSP
    Posted date:  Aug 1, 2006  7:14 PM
  Number of letters in database: 434,620
  Number of sequences in database:  1040
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 694,979
Number of Sequences: 1040
Number of extensions: 17319
Number of successful extensions: 56
Number of sequences better than 1.0e-05: 0
Number of HSP's better than  0.0 without gapping: 50
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 56
length of database: 434,620
effective HSP length: 74
effective length of database: 357,660
effective search space used: 62590500
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqBP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611S-035040
         (751 letters)

Database: RefSeqBP 
           33,508 sequences; 16,112,626 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|XP_604169.2| PREDICTED: similar to malic enzyme 3, NADP(+)-d...   189   2e-48
Alignment   gi|XP_613987.2| PREDICTED: similar to NADP-dependent malic enzy...   147   6e-36
Alignment   gi|XP_875137.1| PREDICTED: similar to NAD-dependent malic enzym...   115   4e-26

>ref|XP_604169.2| PREDICTED: similar to malic enzyme 3, NADP(+)-dependent,
           mitochondrial [Bos taurus]
          Length = 564

 Score =  189 bits (480), Expect = 2e-48
 Identities = 94/97 (96%), Positives = 94/97 (96%)
 Frame = +1

Query: 1   CYRVTEGRGIFASGSPFKSVTLEDGRTFIPGQGNNAYVFPGVALGVIAGGIRHIPDEIFL 180
           CYRVTEGRGIFASGSPF SVTLEDGRTF PGQGNNAYVFPGVALGVIAGGIRHIPDEIFL
Sbjct: 386 CYRVTEGRGIFASGSPFPSVTLEDGRTFFPGQGNNAYVFPGVALGVIAGGIRHIPDEIFL 445

Query: 181 LTAEQIAQEVSEQHLSQGRLYPPLSTIRDVSLRIAIK 291
           LTAEQIAQEVSE HLSQGRLYPPLSTIRDVSLRIAIK
Sbjct: 446 LTAEQIAQEVSEHHLSQGRLYPPLSTIRDVSLRIAIK 482


>ref|XP_613987.2| PREDICTED: similar to NADP-dependent malic enzyme (NADP-ME) (Malic
           enzyme 1) [Bos taurus]
          Length = 472

 Score =  147 bits (372), Expect = 6e-36
 Identities = 70/97 (72%), Positives = 83/97 (85%)
 Frame = +1

Query: 1   CYRVTEGRGIFASGSPFKSVTLEDGRTFIPGQGNNAYVFPGVALGVIAGGIRHIPDEIFL 180
           CY++T+GR IFASGSPF  VTL  G+T  PGQGNN+YVFPGVALGV+A G+RHI D+IFL
Sbjct: 321 CYKLTKGRAIFASGSPFDPVTLPSGKTLYPGQGNNSYVFPGVALGVVACGLRHITDKIFL 380

Query: 181 LTAEQIAQEVSEQHLSQGRLYPPLSTIRDVSLRIAIK 291
            TAE IAQ+VS++HL +GRLYPPL TIRDVSL+IA K
Sbjct: 381 TTAEVIAQQVSDKHLEEGRLYPPLDTIRDVSLKIAEK 417


>ref|XP_875137.1| PREDICTED: similar to NAD-dependent malic enzyme, mitochondrial
           precursor (NAD-ME) (Malic enzyme 2), partial [Bos
           taurus]
          Length = 152

 Score =  115 bits (288), Expect = 4e-26
 Identities = 54/98 (55%), Positives = 73/98 (74%)
 Frame = +1

Query: 16  EGRGIFASGSPFKSVTLEDGRTFIPGQGNNAYVFPGVALGVIAGGIRHIPDEIFLLTAEQ 195
           +GR +FASGSPF+ V L DG+ F PGQGNN Y+FPGVAL VI    RHI D +FL  A+ 
Sbjct: 6   QGRCLFASGSPFEPVKLSDGQVFTPGQGNNVYIFPGVALAVILCNTRHISDHVFLEAAKA 65

Query: 196 IAQEVSEQHLSQGRLYPPLSTIRDVSLRIAIKGFLHLF 309
           +  +++++ L+QGRLYPPLS I++VS+ IAIK   +L+
Sbjct: 66  LTSQLTDKELAQGRLYPPLSNIQEVSINIAIKVTEYLY 103


  Database: RefSeqBP
    Posted date:  Aug 1, 2006  7:14 PM
  Number of letters in database: 16,112,626
  Number of sequences in database:  33,508
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 26,469,117
Number of Sequences: 33508
Number of extensions: 693676
Number of successful extensions: 2180
Number of sequences better than 1.0e-05: 3
Number of HSP's better than  0.0 without gapping: 2022
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2179
length of database: 16,112,626
effective HSP length: 99
effective length of database: 12,795,334
effective search space used: 1919300100
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqHP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611S-035040
         (751 letters)

Database: RefSeqHP 
           39,411 sequences; 17,774,539 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_001014811.1| malic enzyme 3, NADP(+)-dependent, mitochond...   194   8e-50
Alignment   gi|NP_006671.2| malic enzyme 3, NADP(+)-dependent, mitochondria...   194   8e-50
Alignment   gi|NP_002386.1| cytosolic malic enzyme 1 [Homo sapiens]              145   3e-35
Alignment   gi|NP_002387.1| malic enzyme 2, NAD(+)-dependent, mitochondrial...   120   1e-27

>ref|NP_001014811.1| malic enzyme 3, NADP(+)-dependent, mitochondrial [Homo sapiens]
          Length = 604

 Score =  194 bits (492), Expect = 8e-50
 Identities = 96/97 (98%), Positives = 97/97 (100%)
 Frame = +1

Query: 1   CYRVTEGRGIFASGSPFKSVTLEDGRTFIPGQGNNAYVFPGVALGVIAGGIRHIPDEIFL 180
           CYRVTEGRGIFASGSPFKSVTLEDG+TFIPGQGNNAYVFPGVALGVIAGGIRHIPDEIFL
Sbjct: 455 CYRVTEGRGIFASGSPFKSVTLEDGKTFIPGQGNNAYVFPGVALGVIAGGIRHIPDEIFL 514

Query: 181 LTAEQIAQEVSEQHLSQGRLYPPLSTIRDVSLRIAIK 291
           LTAEQIAQEVSEQHLSQGRLYPPLSTIRDVSLRIAIK
Sbjct: 515 LTAEQIAQEVSEQHLSQGRLYPPLSTIRDVSLRIAIK 551


>ref|NP_006671.2| malic enzyme 3, NADP(+)-dependent, mitochondrial [Homo sapiens]
          Length = 604

 Score =  194 bits (492), Expect = 8e-50
 Identities = 96/97 (98%), Positives = 97/97 (100%)
 Frame = +1

Query: 1   CYRVTEGRGIFASGSPFKSVTLEDGRTFIPGQGNNAYVFPGVALGVIAGGIRHIPDEIFL 180
           CYRVTEGRGIFASGSPFKSVTLEDG+TFIPGQGNNAYVFPGVALGVIAGGIRHIPDEIFL
Sbjct: 455 CYRVTEGRGIFASGSPFKSVTLEDGKTFIPGQGNNAYVFPGVALGVIAGGIRHIPDEIFL 514

Query: 181 LTAEQIAQEVSEQHLSQGRLYPPLSTIRDVSLRIAIK 291
           LTAEQIAQEVSEQHLSQGRLYPPLSTIRDVSLRIAIK
Sbjct: 515 LTAEQIAQEVSEQHLSQGRLYPPLSTIRDVSLRIAIK 551


>ref|NP_002386.1| cytosolic malic enzyme 1 [Homo sapiens]
          Length = 572

 Score =  145 bits (366), Expect = 3e-35
 Identities = 69/97 (71%), Positives = 83/97 (85%)
 Frame = +1

Query: 1   CYRVTEGRGIFASGSPFKSVTLEDGRTFIPGQGNNAYVFPGVALGVIAGGIRHIPDEIFL 180
           CY++T+GR IFASGSPF  VTL +G+T  PGQGNN+YVFPGVALGV+A G+R I D IFL
Sbjct: 420 CYKITKGRAIFASGSPFDPVTLPNGQTLYPGQGNNSYVFPGVALGVVACGLRQITDNIFL 479

Query: 181 LTAEQIAQEVSEQHLSQGRLYPPLSTIRDVSLRIAIK 291
            TAE IAQ+VS++HL +GRLYPPL+TIRDVSL+IA K
Sbjct: 480 TTAEVIAQQVSDKHLEEGRLYPPLNTIRDVSLKIAEK 516


>ref|NP_002387.1| malic enzyme 2, NAD(+)-dependent, mitochondrial [Homo sapiens]
          Length = 584

 Score =  120 bits (301), Expect = 1e-27
 Identities = 57/102 (55%), Positives = 75/102 (73%)
 Frame = +1

Query: 4   YRVTEGRGIFASGSPFKSVTLEDGRTFIPGQGNNAYVFPGVALGVIAGGIRHIPDEIFLL 183
           Y +TEGR +FASGSPF  V L DGR F PGQGNN Y+FPGVAL VI    RHI D +FL 
Sbjct: 434 YTLTEGRCLFASGSPFGPVKLTDGRVFTPGQGNNVYIFPGVALAVILCNTRHISDSVFLE 493

Query: 184 TAEQIAQEVSEQHLSQGRLYPPLSTIRDVSLRIAIKGFLHLF 309
            A+ +  +++++ L+QGRLYPPL+ I++VS+ IAIK   +L+
Sbjct: 494 AAKALTSQLTDEELAQGRLYPPLANIQEVSINIAIKVTEYLY 535


  Database: RefSeqHP
    Posted date:  Aug 2, 2006 12:57 AM
  Number of letters in database: 17,774,539
  Number of sequences in database:  39,411
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 30,056,526
Number of Sequences: 39411
Number of extensions: 815637
Number of successful extensions: 2846
Number of sequences better than 1.0e-05: 4
Number of HSP's better than  0.0 without gapping: 2456
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2845
length of database: 17,774,539
effective HSP length: 99
effective length of database: 13,872,850
effective search space used: 2080927500
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqMP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611S-035040
         (751 letters)

Database: RefSeqMP 
           45,328 sequences; 21,768,885 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_852072.1| malic enzyme 3, NADP(+)-dependent, mitochondria...   192   2e-49
Alignment   gi|XP_001004682.1| PREDICTED: similar to NADP-dependent malic e...   154   1e-37
Alignment   gi|XP_001004683.1| PREDICTED: similar to NADP-dependent malic e...   154   1e-37
Alignment   gi|XP_001004679.1| PREDICTED: similar to NADP-dependent malic e...   154   1e-37
Alignment   gi|XP_001004685.1| PREDICTED: similar to NADP-dependent malic e...   154   1e-37
Alignment   gi|NP_032641.1| malic enzyme, supernatant [Mus musculus]             149   3e-36
Alignment   gi|NP_663469.1| malic enzyme 2, NAD(+)-dependent, mitochondrial...   117   2e-26
Alignment   gi|XP_001004303.1| PREDICTED: similar to NADP-dependent malic e...    95   9e-20

>ref|NP_852072.1| malic enzyme 3, NADP(+)-dependent, mitochondrial [Mus musculus]
          Length = 604

 Score =  192 bits (489), Expect = 2e-49
 Identities = 95/97 (97%), Positives = 96/97 (98%)
 Frame = +1

Query: 1   CYRVTEGRGIFASGSPFKSVTLEDGRTFIPGQGNNAYVFPGVALGVIAGGIRHIPDEIFL 180
           CYRVTEGRGIFASGSPFKSVTLEDGRTF PGQGNNAYVFPGVALGVIAGGIRHIPDEIFL
Sbjct: 455 CYRVTEGRGIFASGSPFKSVTLEDGRTFTPGQGNNAYVFPGVALGVIAGGIRHIPDEIFL 514

Query: 181 LTAEQIAQEVSEQHLSQGRLYPPLSTIRDVSLRIAIK 291
           LTAEQIAQEVSEQHLSQGRLYPPLSTIRDVSLRIA+K
Sbjct: 515 LTAEQIAQEVSEQHLSQGRLYPPLSTIRDVSLRIAVK 551


>ref|XP_001004682.1| PREDICTED: similar to NADP-dependent malic enzyme (NADP-ME) (Malic
           enzyme 1) isoform 2 [Mus musculus]
          Length = 258

 Score =  154 bits (388), Expect = 1e-37
 Identities = 71/97 (73%), Positives = 86/97 (88%)
 Frame = +1

Query: 1   CYRVTEGRGIFASGSPFKSVTLEDGRTFIPGQGNNAYVFPGVALGVIAGGIRHIPDEIFL 180
           CY+VT+GR IFASGSPF  VTL DGRT  PGQGNN+YVFPGVALGV+A G+RHI D++FL
Sbjct: 106 CYKVTKGRAIFASGSPFDPVTLPDGRTLFPGQGNNSYVFPGVALGVVACGLRHIDDKVFL 165

Query: 181 LTAEQIAQEVSEQHLSQGRLYPPLSTIRDVSLRIAIK 291
            TAE I+Q+VS++HL +GRLYPPL+TIRDVSL+IA+K
Sbjct: 166 TTAEVISQQVSDKHLQEGRLYPPLNTIRDVSLKIAVK 202


>ref|XP_001004683.1| PREDICTED: similar to NADP-dependent malic enzyme (NADP-ME) (Malic
           enzyme 1) isoform 3 [Mus musculus]
          Length = 406

 Score =  154 bits (388), Expect = 1e-37
 Identities = 71/97 (73%), Positives = 86/97 (88%)
 Frame = +1

Query: 1   CYRVTEGRGIFASGSPFKSVTLEDGRTFIPGQGNNAYVFPGVALGVIAGGIRHIPDEIFL 180
           CY+VT+GR IFASGSPF  VTL DGRT  PGQGNN+YVFPGVALGV+A G+RHI D++FL
Sbjct: 254 CYKVTKGRAIFASGSPFDPVTLPDGRTLFPGQGNNSYVFPGVALGVVACGLRHIDDKVFL 313

Query: 181 LTAEQIAQEVSEQHLSQGRLYPPLSTIRDVSLRIAIK 291
            TAE I+Q+VS++HL +GRLYPPL+TIRDVSL+IA+K
Sbjct: 314 TTAEVISQQVSDKHLQEGRLYPPLNTIRDVSLKIAVK 350


>ref|XP_001004679.1| PREDICTED: similar to NADP-dependent malic enzyme (NADP-ME) (Malic
           enzyme 1) isoform 1 [Mus musculus]
          Length = 554

 Score =  154 bits (388), Expect = 1e-37
 Identities = 71/97 (73%), Positives = 86/97 (88%)
 Frame = +1

Query: 1   CYRVTEGRGIFASGSPFKSVTLEDGRTFIPGQGNNAYVFPGVALGVIAGGIRHIPDEIFL 180
           CY+VT+GR IFASGSPF  VTL DGRT  PGQGNN+YVFPGVALGV+A G+RHI D++FL
Sbjct: 402 CYKVTKGRAIFASGSPFDPVTLPDGRTLFPGQGNNSYVFPGVALGVVACGLRHIDDKVFL 461

Query: 181 LTAEQIAQEVSEQHLSQGRLYPPLSTIRDVSLRIAIK 291
            TAE I+Q+VS++HL +GRLYPPL+TIRDVSL+IA+K
Sbjct: 462 TTAEVISQQVSDKHLQEGRLYPPLNTIRDVSLKIAVK 498


>ref|XP_001004685.1| PREDICTED: similar to NADP-dependent malic enzyme (NADP-ME) (Malic
           enzyme 1) isoform 4 [Mus musculus]
          Length = 552

 Score =  154 bits (388), Expect = 1e-37
 Identities = 71/97 (73%), Positives = 86/97 (88%)
 Frame = +1

Query: 1   CYRVTEGRGIFASGSPFKSVTLEDGRTFIPGQGNNAYVFPGVALGVIAGGIRHIPDEIFL 180
           CY+VT+GR IFASGSPF  VTL DGRT  PGQGNN+YVFPGVALGV+A G+RHI D++FL
Sbjct: 400 CYKVTKGRAIFASGSPFDPVTLPDGRTLFPGQGNNSYVFPGVALGVVACGLRHIDDKVFL 459

Query: 181 LTAEQIAQEVSEQHLSQGRLYPPLSTIRDVSLRIAIK 291
            TAE I+Q+VS++HL +GRLYPPL+TIRDVSL+IA+K
Sbjct: 460 TTAEVISQQVSDKHLQEGRLYPPLNTIRDVSLKIAVK 496


>ref|NP_032641.1| malic enzyme, supernatant [Mus musculus]
          Length = 572

 Score =  149 bits (376), Expect = 3e-36
 Identities = 69/97 (71%), Positives = 84/97 (86%)
 Frame = +1

Query: 1   CYRVTEGRGIFASGSPFKSVTLEDGRTFIPGQGNNAYVFPGVALGVIAGGIRHIPDEIFL 180
           CY+VT+GR IFASGSPF  VTL DGRT  PGQGNN+YVFPGVALGV+A G+RHI D++FL
Sbjct: 420 CYKVTKGRAIFASGSPFDPVTLPDGRTLFPGQGNNSYVFPGVALGVVACGLRHIDDKVFL 479

Query: 181 LTAEQIAQEVSEQHLSQGRLYPPLSTIRDVSLRIAIK 291
            T E I+Q+VS++HL +GRLYPPL+TIR VSL+IA+K
Sbjct: 480 TTREVISQQVSDKHLQEGRLYPPLNTIRGVSLKIAVK 516


>ref|NP_663469.1| malic enzyme 2, NAD(+)-dependent, mitochondrial [Mus musculus]
          Length = 589

 Score =  117 bits (292), Expect = 2e-26
 Identities = 56/96 (58%), Positives = 72/96 (75%)
 Frame = +1

Query: 4   YRVTEGRGIFASGSPFKSVTLEDGRTFIPGQGNNAYVFPGVALGVIAGGIRHIPDEIFLL 183
           Y +TEGR +FASGSPF+ V L+DGR F PGQGNNAY+FPGVAL VI    RHI D +FL 
Sbjct: 434 YTLTEGRCLFASGSPFEPVKLQDGRVFTPGQGNNAYIFPGVALAVILCEARHISDTVFLE 493

Query: 184 TAEQIAQEVSEQHLSQGRLYPPLSTIRDVSLRIAIK 291
            A+ +  ++++  L+QGRLYP L+ I++VS  IAIK
Sbjct: 494 AAKALTTQLTDAELAQGRLYPSLANIQEVSANIAIK 529


>ref|XP_001004303.1| PREDICTED: similar to NADP-dependent malic enzyme (NADP-ME) (Malic
           enzyme 1) [Mus musculus]
          Length = 66

 Score = 94.7 bits (234), Expect = 9e-20
 Identities = 44/58 (75%), Positives = 49/58 (84%)
 Frame = +1

Query: 19  GRGIFASGSPFKSVTLEDGRTFIPGQGNNAYVFPGVALGVIAGGIRHIPDEIFLLTAE 192
           GR IFASGSPF  VTL DGRT  PGQGNN+YVFPGVALGV+A G+RHI D++FL TAE
Sbjct: 7   GRAIFASGSPFDPVTLPDGRTLFPGQGNNSYVFPGVALGVVACGLRHIDDKVFLTTAE 64


  Database: RefSeqMP
    Posted date:  Aug 2, 2006 12:58 AM
  Number of letters in database: 21,768,885
  Number of sequences in database:  45,328
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 35,429,648
Number of Sequences: 45328
Number of extensions: 916955
Number of successful extensions: 2918
Number of sequences better than 1.0e-05: 8
Number of HSP's better than  0.0 without gapping: 2614
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2916
length of database: 21,768,885
effective HSP length: 101
effective length of database: 17,190,757
effective search space used: 2544232036
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqCP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611S-035040
         (751 letters)

Database: RefSeqCP 
           33,732 sequences; 19,266,565 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|XP_542269.2| PREDICTED: similar to malic enzyme 3, NADP(+)-d...   195   4e-50
Alignment   gi|XP_857227.1| PREDICTED: similar to malic enzyme 3, NADP(+)-d...   195   4e-50
Alignment   gi|XP_857177.1| PREDICTED: similar to malic enzyme 3, NADP(+)-d...   195   4e-50
Alignment   gi|XP_857091.1| PREDICTED: similar to NADP-dependent malic enzy...   195   4e-50
Alignment   gi|XP_848770.1| PREDICTED: similar to malic enzyme 3, NADP(+)-d...   195   4e-50
Alignment   gi|XP_857135.1| PREDICTED: similar to malic enzyme 3, NADP(+)-d...   184   6e-47
Alignment   gi|XP_532217.2| PREDICTED: similar to NADP-dependent malic enzy...   149   3e-36
Alignment   gi|XP_849530.1| PREDICTED: similar to NAD-dependent malic enzym...   120   1e-27
Alignment   gi|XP_533402.2| PREDICTED: similar to NAD-dependent malic enzym...   120   1e-27

>ref|XP_542269.2| PREDICTED: similar to malic enzyme 3, NADP(+)-dependent,
           mitochondrial isoform 1 [Canis familiaris]
          Length = 569

 Score =  195 bits (495), Expect = 4e-50
 Identities = 97/97 (100%), Positives = 97/97 (100%)
 Frame = +1

Query: 1   CYRVTEGRGIFASGSPFKSVTLEDGRTFIPGQGNNAYVFPGVALGVIAGGIRHIPDEIFL 180
           CYRVTEGRGIFASGSPFKSVTLEDGRTFIPGQGNNAYVFPGVALGVIAGGIRHIPDEIFL
Sbjct: 420 CYRVTEGRGIFASGSPFKSVTLEDGRTFIPGQGNNAYVFPGVALGVIAGGIRHIPDEIFL 479

Query: 181 LTAEQIAQEVSEQHLSQGRLYPPLSTIRDVSLRIAIK 291
           LTAEQIAQEVSEQHLSQGRLYPPLSTIRDVSLRIAIK
Sbjct: 480 LTAEQIAQEVSEQHLSQGRLYPPLSTIRDVSLRIAIK 516


>ref|XP_857227.1| PREDICTED: similar to malic enzyme 3, NADP(+)-dependent,
           mitochondrial isoform 7 [Canis familiaris]
          Length = 562

 Score =  195 bits (495), Expect = 4e-50
 Identities = 97/97 (100%), Positives = 97/97 (100%)
 Frame = +1

Query: 1   CYRVTEGRGIFASGSPFKSVTLEDGRTFIPGQGNNAYVFPGVALGVIAGGIRHIPDEIFL 180
           CYRVTEGRGIFASGSPFKSVTLEDGRTFIPGQGNNAYVFPGVALGVIAGGIRHIPDEIFL
Sbjct: 413 CYRVTEGRGIFASGSPFKSVTLEDGRTFIPGQGNNAYVFPGVALGVIAGGIRHIPDEIFL 472

Query: 181 LTAEQIAQEVSEQHLSQGRLYPPLSTIRDVSLRIAIK 291
           LTAEQIAQEVSEQHLSQGRLYPPLSTIRDVSLRIAIK
Sbjct: 473 LTAEQIAQEVSEQHLSQGRLYPPLSTIRDVSLRIAIK 509


>ref|XP_857177.1| PREDICTED: similar to malic enzyme 3, NADP(+)-dependent,
           mitochondrial isoform 6 [Canis familiaris]
          Length = 513

 Score =  195 bits (495), Expect = 4e-50
 Identities = 97/97 (100%), Positives = 97/97 (100%)
 Frame = +1

Query: 1   CYRVTEGRGIFASGSPFKSVTLEDGRTFIPGQGNNAYVFPGVALGVIAGGIRHIPDEIFL 180
           CYRVTEGRGIFASGSPFKSVTLEDGRTFIPGQGNNAYVFPGVALGVIAGGIRHIPDEIFL
Sbjct: 364 CYRVTEGRGIFASGSPFKSVTLEDGRTFIPGQGNNAYVFPGVALGVIAGGIRHIPDEIFL 423

Query: 181 LTAEQIAQEVSEQHLSQGRLYPPLSTIRDVSLRIAIK 291
           LTAEQIAQEVSEQHLSQGRLYPPLSTIRDVSLRIAIK
Sbjct: 424 LTAEQIAQEVSEQHLSQGRLYPPLSTIRDVSLRIAIK 460


>ref|XP_857091.1| PREDICTED: similar to NADP-dependent malic enzyme, mitochondrial
           precursor (NADP-ME) (Malic enzyme 3) isoform 4 [Canis
           familiaris]
          Length = 231

 Score =  195 bits (495), Expect = 4e-50
 Identities = 97/97 (100%), Positives = 97/97 (100%)
 Frame = +1

Query: 1   CYRVTEGRGIFASGSPFKSVTLEDGRTFIPGQGNNAYVFPGVALGVIAGGIRHIPDEIFL 180
           CYRVTEGRGIFASGSPFKSVTLEDGRTFIPGQGNNAYVFPGVALGVIAGGIRHIPDEIFL
Sbjct: 82  CYRVTEGRGIFASGSPFKSVTLEDGRTFIPGQGNNAYVFPGVALGVIAGGIRHIPDEIFL 141

Query: 181 LTAEQIAQEVSEQHLSQGRLYPPLSTIRDVSLRIAIK 291
           LTAEQIAQEVSEQHLSQGRLYPPLSTIRDVSLRIAIK
Sbjct: 142 LTAEQIAQEVSEQHLSQGRLYPPLSTIRDVSLRIAIK 178


>ref|XP_848770.1| PREDICTED: similar to malic enzyme 3, NADP(+)-dependent,
           mitochondrial isoform 2 [Canis familiaris]
          Length = 604

 Score =  195 bits (495), Expect = 4e-50
 Identities = 97/97 (100%), Positives = 97/97 (100%)
 Frame = +1

Query: 1   CYRVTEGRGIFASGSPFKSVTLEDGRTFIPGQGNNAYVFPGVALGVIAGGIRHIPDEIFL 180
           CYRVTEGRGIFASGSPFKSVTLEDGRTFIPGQGNNAYVFPGVALGVIAGGIRHIPDEIFL
Sbjct: 455 CYRVTEGRGIFASGSPFKSVTLEDGRTFIPGQGNNAYVFPGVALGVIAGGIRHIPDEIFL 514

Query: 181 LTAEQIAQEVSEQHLSQGRLYPPLSTIRDVSLRIAIK 291
           LTAEQIAQEVSEQHLSQGRLYPPLSTIRDVSLRIAIK
Sbjct: 515 LTAEQIAQEVSEQHLSQGRLYPPLSTIRDVSLRIAIK 551


>ref|XP_857135.1| PREDICTED: similar to malic enzyme 3, NADP(+)-dependent,
           mitochondrial isoform 5 [Canis familiaris]
          Length = 573

 Score =  184 bits (468), Expect = 6e-47
 Identities = 93/96 (96%), Positives = 94/96 (97%)
 Frame = +1

Query: 4   YRVTEGRGIFASGSPFKSVTLEDGRTFIPGQGNNAYVFPGVALGVIAGGIRHIPDEIFLL 183
           +RV  GRGIFASGSPFKSVTLEDGRTFIPGQGNNAYVFPGVALGVIAGGIRHIPDEIFLL
Sbjct: 425 FRVPLGRGIFASGSPFKSVTLEDGRTFIPGQGNNAYVFPGVALGVIAGGIRHIPDEIFLL 484

Query: 184 TAEQIAQEVSEQHLSQGRLYPPLSTIRDVSLRIAIK 291
           TAEQIAQEVSEQHLSQGRLYPPLSTIRDVSLRIAIK
Sbjct: 485 TAEQIAQEVSEQHLSQGRLYPPLSTIRDVSLRIAIK 520


>ref|XP_532217.2| PREDICTED: similar to NADP-dependent malic enzyme (NADP-ME) (Malic
           enzyme 1) [Canis familiaris]
          Length = 634

 Score =  149 bits (376), Expect = 3e-36
 Identities = 71/97 (73%), Positives = 83/97 (85%)
 Frame = +1

Query: 1   CYRVTEGRGIFASGSPFKSVTLEDGRTFIPGQGNNAYVFPGVALGVIAGGIRHIPDEIFL 180
           CY++T+GR IFASGSPF  VTL +GRT  PGQGNN+YVFPGVALGV+A G+RHI D IFL
Sbjct: 482 CYKLTKGRAIFASGSPFDPVTLPNGRTLYPGQGNNSYVFPGVALGVVACGLRHITDNIFL 541

Query: 181 LTAEQIAQEVSEQHLSQGRLYPPLSTIRDVSLRIAIK 291
            TAE IAQ+VS++HL +GRLYPPL TIRDVSL+IA K
Sbjct: 542 TTAEIIAQQVSDKHLEEGRLYPPLDTIRDVSLKIAAK 578


>ref|XP_849530.1| PREDICTED: similar to NAD-dependent malic enzyme, mitochondrial
           precursor (NAD-ME) (Malic enzyme 2) isoform 2 [Canis
           familiaris]
          Length = 584

 Score =  120 bits (302), Expect = 1e-27
 Identities = 57/102 (55%), Positives = 77/102 (75%)
 Frame = +1

Query: 4   YRVTEGRGIFASGSPFKSVTLEDGRTFIPGQGNNAYVFPGVALGVIAGGIRHIPDEIFLL 183
           Y +TEGR +FASGSPF+ V L DG+ F PGQGNN Y+FPGVAL VI    RHI D +FL 
Sbjct: 434 YTLTEGRCLFASGSPFEPVKLSDGQLFTPGQGNNVYIFPGVALAVILCNTRHISDHVFLE 493

Query: 184 TAEQIAQEVSEQHLSQGRLYPPLSTIRDVSLRIAIKGFLHLF 309
            A+ +A +++++ L+QGRLYPPL+ I++VS+ IAIK   +L+
Sbjct: 494 AAKALANQLTDKELAQGRLYPPLADIQEVSINIAIKVTEYLY 535


>ref|XP_533402.2| PREDICTED: similar to NAD-dependent malic enzyme, mitochondrial
           precursor (NAD-ME) (Malic enzyme 2) isoform 1 [Canis
           familiaris]
          Length = 499

 Score =  120 bits (302), Expect = 1e-27
 Identities = 57/102 (55%), Positives = 77/102 (75%)
 Frame = +1

Query: 4   YRVTEGRGIFASGSPFKSVTLEDGRTFIPGQGNNAYVFPGVALGVIAGGIRHIPDEIFLL 183
           Y +TEGR +FASGSPF+ V L DG+ F PGQGNN Y+FPGVAL VI    RHI D +FL 
Sbjct: 349 YTLTEGRCLFASGSPFEPVKLSDGQLFTPGQGNNVYIFPGVALAVILCNTRHISDHVFLE 408

Query: 184 TAEQIAQEVSEQHLSQGRLYPPLSTIRDVSLRIAIKGFLHLF 309
            A+ +A +++++ L+QGRLYPPL+ I++VS+ IAIK   +L+
Sbjct: 409 AAKALANQLTDKELAQGRLYPPLADIQEVSINIAIKVTEYLY 450


  Database: RefSeqCP
    Posted date:  Aug 1, 2006  9:25 PM
  Number of letters in database: 19,266,565
  Number of sequences in database:  33,732
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 31,035,647
Number of Sequences: 33732
Number of extensions: 808752
Number of successful extensions: 2772
Number of sequences better than 1.0e-05: 9
Number of HSP's better than  0.0 without gapping: 2509
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2770
length of database: 19,266,565
effective HSP length: 100
effective length of database: 15,893,365
effective search space used: 2368111385
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)