Animal-Genome cDNA 20060611S-042241


Search to RefSeqSP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611S-042241
         (971 letters)

Database: RefSeqSP 
           1040 sequences; 434,620 total letters

Searching...done

 ***** No hits found ******

  Database: RefSeqSP
    Posted date:  Aug 1, 2006  7:14 PM
  Number of letters in database: 434,620
  Number of sequences in database:  1040
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 922,620
Number of Sequences: 1040
Number of extensions: 23364
Number of successful extensions: 103
Number of sequences better than 1.0e-05: 0
Number of HSP's better than  0.0 without gapping: 83
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 103
length of database: 434,620
effective HSP length: 77
effective length of database: 354,540
effective search space used: 87216840
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqBP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611S-042241
         (971 letters)

Database: RefSeqBP 
           33,508 sequences; 16,112,626 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|XP_584500.2| PREDICTED: similar to NAD-dependent malic enzym...   271   e-124
Alignment   gi|XP_604169.2| PREDICTED: similar to malic enzyme 3, NADP(+)-d...   144   2e-63
Alignment   gi|XP_613987.2| PREDICTED: similar to NADP-dependent malic enzy...   120   1e-27
Alignment   gi|XP_596455.2| PREDICTED: similar to NADP-dependent malic enzy...    86   6e-17

>ref|XP_584500.2| PREDICTED: similar to NAD-dependent malic enzyme, mitochondrial
           precursor (NAD-ME) (Malic enzyme 2), partial [Bos
           taurus]
          Length = 513

 Score =  271 bits (692), Expect(2) = e-124
 Identities = 133/144 (92%), Positives = 137/144 (95%)
 Frame = +1

Query: 196 RGARLVVREMMLSRFKIVATPCTLACRHLHIKEKGKPLMLNPRTNKGMAFTLQERQMLGL 375
           +G    VR+ MLSRFKIVATPCTLACRHLH KEKGKPLMLNPRTNKGMAFTLQERQMLGL
Sbjct: 66  KGPVASVRKKMLSRFKIVATPCTLACRHLHTKEKGKPLMLNPRTNKGMAFTLQERQMLGL 125

Query: 376 QGLLPPKIETQDIQALRFHRNVKKLNGPLEKYIYIMGIQERNEKLFYRILQDDIETLMPI 555
           QGLLPPKIETQDIQALRFHRN+KKLNGPLEKYIYIMGIQERNEKLFYRILQDDIETLMPI
Sbjct: 126 QGLLPPKIETQDIQALRFHRNLKKLNGPLEKYIYIMGIQERNEKLFYRILQDDIETLMPI 185

Query: 556 VYTPTVGLACSQYGHIFRRPKLLW 627
           VYTPTVGLACSQYGHIFRRPK L+
Sbjct: 186 VYTPTVGLACSQYGHIFRRPKGLF 209



 Score =  193 bits (490), Expect(2) = e-124
 Identities = 96/116 (82%), Positives = 100/116 (86%), Gaps = 1/116 (0%)
 Frame = +3

Query: 615 QAVVVTDGERILGLGDLGVYGMGIPVXKLCLYTACAGIRPDRCLPVCIDVGTRYPALLKD 794
           +AVVVTDGERILGLGDLGVYGMGIPV KLCLYTACAGIRPDRCLPVCIDVGT  PALLKD
Sbjct: 231 KAVVVTDGERILGLGDLGVYGMGIPVGKLCLYTACAGIRPDRCLPVCIDVGTDNPALLKD 290

Query: 795 PFYMGLYQKRDRSQRYDDPIDEFMKAITDRYGTNILIPFETL-ES*CIRFLKNYQK 959
           PFYMGLYQKRDRSQRYDD IDEFMKAITDRYG N LI FE        RFL+ Y++
Sbjct: 291 PFYMGLYQKRDRSQRYDDLIDEFMKAITDRYGQNTLIQFEDFGNHNAFRFLRKYRE 346


>ref|XP_604169.2| PREDICTED: similar to malic enzyme 3, NADP(+)-dependent,
           mitochondrial [Bos taurus]
          Length = 564

 Score =  144 bits (362), Expect(2) = 2e-63
 Identities = 70/115 (60%), Positives = 84/115 (73%), Gaps = 1/115 (0%)
 Frame = +3

Query: 615 QAVVVTDGERILGLGDLGVYGMGIPVXKLCLYTACAGIRPDRCLPVCIDVGTRYPALLKD 794
           +AVVVTDGERILGLGDLG YGMGIPV KL LYTAC G+ P +CLPV +DVGT    LL+D
Sbjct: 119 KAVVVTDGERILGLGDLGCYGMGIPVGKLALYTACGGVNPRQCLPVLLDVGTNNEELLRD 178

Query: 795 PFYMGLYQKRDRSQRYDDPIDEFMKAITDRYGTNILIPFETL-ES*CIRFLKNYQ 956
           P Y+GL  +R R Q YDD +DEFM+A+TD++G N LI FE    +   R L  Y+
Sbjct: 179 PLYIGLKHRRVRGQEYDDLLDEFMQAVTDKFGINCLIQFEDFANANAFRLLNKYR 233



 Score =  117 bits (293), Expect(2) = 2e-63
 Identities = 55/97 (56%), Positives = 71/97 (73%)
 Frame = +1

Query: 337 MAFTLQERQMLGLQGLLPPKIETQDIQALRFHRNVKKLNGPLEKYIYIMGIQERNEKLFY 516
           MAFTL+ER  LG+ GL+PP   +QD+Q LR  R  ++    L+KYI +M +Q+RNEKLFY
Sbjct: 1   MAFTLEERLQLGIHGLIPPCFLSQDVQLLRVMRYYERQQSDLDKYIILMTLQDRNEKLFY 60

Query: 517 RILQDDIETLMPIVYTPTVGLACSQYGHIFRRPKLLW 627
           R+L  D+E  +PIVYTPTVGLAC  YG  FRRP+ L+
Sbjct: 61  RVLTSDVEKFLPIVYTPTVGLACQHYGLTFRRPRGLF 97


>ref|XP_613987.2| PREDICTED: similar to NADP-dependent malic enzyme (NADP-ME) (Malic
           enzyme 1) [Bos taurus]
          Length = 472

 Score =  120 bits (302), Expect = 1e-27
 Identities = 53/94 (56%), Positives = 71/94 (75%)
 Frame = +1

Query: 337 MAFTLQERQMLGLQGLLPPKIETQDIQALRFHRNVKKLNGPLEKYIYIMGIQERNEKLFY 516
           +AFTL+ERQ L + GLLPP   +QD+Q LR  +N ++LN   ++Y+ +M +Q+RNEKLFY
Sbjct: 15  LAFTLEERQQLNIHGLLPPSFISQDVQVLRVLKNFERLNSDFDRYLLLMDLQDRNEKLFY 74

Query: 517 RILQDDIETLMPIVYTPTVGLACSQYGHIFRRPK 618
           ++L  DIE  MPIVYTPTVGLAC QY   FR+P+
Sbjct: 75  KVLMSDIEKFMPIVYTPTVGLACQQYSLAFRKPR 108


>ref|XP_596455.2| PREDICTED: similar to NADP-dependent malic enzyme (NADP-ME) (Malic
           enzyme 1) [Bos taurus]
          Length = 157

 Score = 85.5 bits (210), Expect = 6e-17
 Identities = 39/52 (75%), Positives = 44/52 (84%)
 Frame = +3

Query: 615 QAVVVTDGERILGLGDLGVYGMGIPVXKLCLYTACAGIRPDRCLPVCIDVGT 770
           +A+VVTDGERILGLGDLG  GMGIPV KL LYTAC G+ P +CLPV +DVGT
Sbjct: 97  KAIVVTDGERILGLGDLGCNGMGIPVGKLALYTACGGMNPQQCLPVMLDVGT 148


  Database: RefSeqBP
    Posted date:  Aug 1, 2006  7:14 PM
  Number of letters in database: 16,112,626
  Number of sequences in database:  33,508
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 33,634,010
Number of Sequences: 33508
Number of extensions: 863596
Number of successful extensions: 3784
Number of sequences better than 1.0e-05: 4
Number of HSP's better than  0.0 without gapping: 3076
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3782
length of database: 16,112,626
effective HSP length: 102
effective length of database: 12,694,810
effective search space used: 2805553010
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqHP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611S-042241
         (971 letters)

Database: RefSeqHP 
           39,411 sequences; 17,774,539 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_002387.1| malic enzyme 2, NAD(+)-dependent, mitochondrial...   254   e-117
Alignment   gi|NP_001014811.1| malic enzyme 3, NADP(+)-dependent, mitochond...   140   1e-67
Alignment   gi|NP_006671.2| malic enzyme 3, NADP(+)-dependent, mitochondria...   140   1e-67
Alignment   gi|NP_002386.1| cytosolic malic enzyme 1 [Homo sapiens]              137   2e-67
Alignment   gi|XP_934770.1| PREDICTED: similar to NAD-dependent malic enzym...   164   4e-64
Alignment   gi|XP_944182.1| PREDICTED: similar to NAD-dependent malic enzym...   164   4e-64
Alignment   gi|XP_948952.1| PREDICTED: hypothetical protein XP_948952 [Homo...    34   8e-06
Alignment   gi|XP_939453.1| PREDICTED: hypothetical protein XP_939453 [Homo...    34   8e-06

>ref|NP_002387.1| malic enzyme 2, NAD(+)-dependent, mitochondrial [Homo sapiens]
          Length = 584

 Score =  254 bits (648), Expect(2) = e-117
 Identities = 122/134 (91%), Positives = 129/134 (96%)
 Frame = +1

Query: 226 MLSRFKIVATPCTLACRHLHIKEKGKPLMLNPRTNKGMAFTLQERQMLGLQGLLPPKIET 405
           MLSR ++V+T CTLACRHLHIKEKGKPLMLNPRTNKGMAFTLQERQMLGLQGLLPPKIET
Sbjct: 1   MLSRLRVVSTTCTLACRHLHIKEKGKPLMLNPRTNKGMAFTLQERQMLGLQGLLPPKIET 60

Query: 406 QDIQALRFHRNVKKLNGPLEKYIYIMGIQERNEKLFYRILQDDIETLMPIVYTPTVGLAC 585
           QDIQALRFHRN+KK+  PLEKYIYIMGIQERNEKLFYRILQDDIE+LMPIVYTPTVGLAC
Sbjct: 61  QDIQALRFHRNLKKMTSPLEKYIYIMGIQERNEKLFYRILQDDIESLMPIVYTPTVGLAC 120

Query: 586 SQYGHIFRRPKLLW 627
           SQYGHIFRRPK L+
Sbjct: 121 SQYGHIFRRPKGLF 134



 Score =  186 bits (473), Expect(2) = e-117
 Identities = 93/116 (80%), Positives = 99/116 (85%), Gaps = 1/116 (0%)
 Frame = +3

Query: 615 QAVVVTDGERILGLGDLGVYGMGIPVXKLCLYTACAGIRPDRCLPVCIDVGTRYPALLKD 794
           +AVVVTDGERILGLGDLGVYGMGIPV KLCLYTACAGIRPDRCLPVCIDVGT   ALLKD
Sbjct: 156 KAVVVTDGERILGLGDLGVYGMGIPVGKLCLYTACAGIRPDRCLPVCIDVGTDNIALLKD 215

Query: 795 PFYMGLYQKRDRSQRYDDPIDEFMKAITDRYGTNILIPFETL-ES*CIRFLKNYQK 959
           PFYMGLYQKRDR+Q+YDD IDEFMKAITDRYG N LI FE        RFL+ Y++
Sbjct: 216 PFYMGLYQKRDRTQQYDDLIDEFMKAITDRYGRNTLIQFEDFGNHNAFRFLRKYRE 271


>ref|NP_001014811.1| malic enzyme 3, NADP(+)-dependent, mitochondrial [Homo sapiens]
          Length = 604

 Score =  140 bits (353), Expect(2) = 1e-67
 Identities = 68/115 (59%), Positives = 83/115 (72%), Gaps = 1/115 (0%)
 Frame = +3

Query: 615 QAVVVTDGERILGLGDLGVYGMGIPVXKLCLYTACAGIRPDRCLPVCIDVGTRYPALLKD 794
           +AVVVTDGERILGLGDLG YGMGIPV KL LYTAC G+ P +CLPV +DVGT    LL+D
Sbjct: 181 KAVVVTDGERILGLGDLGCYGMGIPVGKLALYTACGGVNPQQCLPVLLDVGTNNEELLRD 240

Query: 795 PFYMGLYQKRDRSQRYDDPIDEFMKAITDRYGTNILIPFETL-ES*CIRFLKNYQ 956
           P Y+GL  +R   + YDD +DEFM+A+TD++G N LI FE    +   R L  Y+
Sbjct: 241 PLYIGLKHQRVHGKAYDDLLDEFMQAVTDKFGINCLIQFEDFANANAFRLLNKYR 295



 Score =  135 bits (339), Expect(2) = 1e-67
 Identities = 64/118 (54%), Positives = 84/118 (71%)
 Frame = +1

Query: 274 RHLHIKEKGKPLMLNPRTNKGMAFTLQERQMLGLQGLLPPKIETQDIQALRFHRNVKKLN 453
           R + +K++G  +  NP  NKGMAFTL+ER  LG+ GL+PP   +QD+Q LR  R  ++  
Sbjct: 42  RPVPLKKRGYDVTRNPHLNKGMAFTLEERLQLGIHGLIPPCFLSQDVQLLRIMRYYERQQ 101

Query: 454 GPLEKYIYIMGIQERNEKLFYRILQDDIETLMPIVYTPTVGLACSQYGHIFRRPKLLW 627
             L+KYI +M +Q+RNEKLFYR+L  D+E  MPIVYTPTVGLAC  YG  FRRP+ L+
Sbjct: 102 SDLDKYIILMTLQDRNEKLFYRVLTSDVEKFMPIVYTPTVGLACQHYGLTFRRPRGLF 159


>ref|NP_006671.2| malic enzyme 3, NADP(+)-dependent, mitochondrial [Homo sapiens]
          Length = 604

 Score =  140 bits (353), Expect(2) = 1e-67
 Identities = 68/115 (59%), Positives = 83/115 (72%), Gaps = 1/115 (0%)
 Frame = +3

Query: 615 QAVVVTDGERILGLGDLGVYGMGIPVXKLCLYTACAGIRPDRCLPVCIDVGTRYPALLKD 794
           +AVVVTDGERILGLGDLG YGMGIPV KL LYTAC G+ P +CLPV +DVGT    LL+D
Sbjct: 181 KAVVVTDGERILGLGDLGCYGMGIPVGKLALYTACGGVNPQQCLPVLLDVGTNNEELLRD 240

Query: 795 PFYMGLYQKRDRSQRYDDPIDEFMKAITDRYGTNILIPFETL-ES*CIRFLKNYQ 956
           P Y+GL  +R   + YDD +DEFM+A+TD++G N LI FE    +   R L  Y+
Sbjct: 241 PLYIGLKHQRVHGKAYDDLLDEFMQAVTDKFGINCLIQFEDFANANAFRLLNKYR 295



 Score =  135 bits (339), Expect(2) = 1e-67
 Identities = 64/118 (54%), Positives = 84/118 (71%)
 Frame = +1

Query: 274 RHLHIKEKGKPLMLNPRTNKGMAFTLQERQMLGLQGLLPPKIETQDIQALRFHRNVKKLN 453
           R + +K++G  +  NP  NKGMAFTL+ER  LG+ GL+PP   +QD+Q LR  R  ++  
Sbjct: 42  RPVPLKKRGYDVTRNPHLNKGMAFTLEERLQLGIHGLIPPCFLSQDVQLLRIMRYYERQQ 101

Query: 454 GPLEKYIYIMGIQERNEKLFYRILQDDIETLMPIVYTPTVGLACSQYGHIFRRPKLLW 627
             L+KYI +M +Q+RNEKLFYR+L  D+E  MPIVYTPTVGLAC  YG  FRRP+ L+
Sbjct: 102 SDLDKYIILMTLQDRNEKLFYRVLTSDVEKFMPIVYTPTVGLACQHYGLTFRRPRGLF 159


>ref|NP_002386.1| cytosolic malic enzyme 1 [Homo sapiens]
          Length = 572

 Score =  137 bits (346), Expect(2) = 2e-67
 Identities = 65/100 (65%), Positives = 76/100 (76%)
 Frame = +3

Query: 615 QAVVVTDGERILGLGDLGVYGMGIPVXKLCLYTACAGIRPDRCLPVCIDVGTRYPALLKD 794
           +A+VVTDGERILGLGDLG  GMGIPV KL LYTAC G+ P  CLPV +DVGT    LLKD
Sbjct: 146 KAIVVTDGERILGLGDLGCNGMGIPVGKLALYTACGGMNPQECLPVILDVGTENEELLKD 205

Query: 795 PFYMGLYQKRDRSQRYDDPIDEFMKAITDRYGTNILIPFE 914
           P Y+GL Q+R R   YDD +DEFM+A++ +YG N LI FE
Sbjct: 206 PLYIGLRQRRVRGSEYDDFLDEFMEAVSSKYGMNCLIQFE 245



 Score =  137 bits (344), Expect(2) = 2e-67
 Identities = 64/120 (53%), Positives = 84/120 (70%)
 Frame = +1

Query: 268 ACRHLHIKEKGKPLMLNPRTNKGMAFTLQERQMLGLQGLLPPKIETQDIQALRFHRNVKK 447
           A R  H  ++G  L  NP  NK +AFTL+ERQ L + GLLPP   +Q+IQ LR  +N + 
Sbjct: 5   APRRRHTHQRGYLLTRNPHLNKDLAFTLEERQQLNIHGLLPPSFNSQEIQVLRVVKNFEH 64

Query: 448 LNGPLEKYIYIMGIQERNEKLFYRILQDDIETLMPIVYTPTVGLACSQYGHIFRRPKLLW 627
           LN   ++Y+ +M +Q+RNEKLFYR+L  DIE  MPIVYTPTVGLAC QY  +FR+P+ L+
Sbjct: 65  LNSDFDRYLLLMDLQDRNEKLFYRVLTSDIEKFMPIVYTPTVGLACQQYSLVFRKPRGLF 124


>ref|XP_934770.1| PREDICTED: similar to NAD-dependent malic enzyme, mitochondrial
           precursor (NAD-ME) (Malic enzyme 2) [Homo sapiens]
          Length = 196

 Score =  164 bits (414), Expect(2) = 4e-64
 Identities = 83/115 (72%), Positives = 90/115 (78%), Gaps = 1/115 (0%)
 Frame = +3

Query: 615 QAVVVTDGERILGLGDLGVYGMGIPVXKLCLYTACAGIRPDRCLPVCIDVGTRYPALLKD 794
           +AV+VTDGERILG GDLGVYGMGIPV K+CLYT C GI PDRCL VCIDVG    ALLK 
Sbjct: 82  KAVLVTDGERILGHGDLGVYGMGIPVGKICLYTVCPGIWPDRCLLVCIDVGADNIALLKG 141

Query: 795 PFYMGLYQKRDRSQRYDDPIDEFMKAITDRYGTNILIPFETL-ES*CIRFLKNYQ 956
            FYMGLYQKRDR+Q+ DDPIDEFMKAITDRYG N L+ FE        RFL+ YQ
Sbjct: 142 TFYMGLYQKRDRTQQSDDPIDEFMKAITDRYGWNTLLQFEGFGHHNAFRFLRKYQ 196



 Score =  100 bits (248), Expect(2) = 4e-64
 Identities = 46/60 (76%), Positives = 51/60 (85%)
 Frame = +1

Query: 448 LNGPLEKYIYIMGIQERNEKLFYRILQDDIETLMPIVYTPTVGLACSQYGHIFRRPKLLW 627
           +  P E YIYIMGIQERN+KLFYRILQDD E+LMPI YTPTVGL CSQ GH+FRRPK L+
Sbjct: 1   MTSPSENYIYIMGIQERNDKLFYRILQDDTESLMPIAYTPTVGLVCSQCGHLFRRPKGLF 60


>ref|XP_944182.1| PREDICTED: similar to NAD-dependent malic enzyme, mitochondrial
           precursor (NAD-ME) (Malic enzyme 2) [Homo sapiens]
          Length = 196

 Score =  164 bits (414), Expect(2) = 4e-64
 Identities = 83/115 (72%), Positives = 90/115 (78%), Gaps = 1/115 (0%)
 Frame = +3

Query: 615 QAVVVTDGERILGLGDLGVYGMGIPVXKLCLYTACAGIRPDRCLPVCIDVGTRYPALLKD 794
           +AV+VTDGERILG GDLGVYGMGIPV K+CLYT C GI PDRCL VCIDVG    ALLK 
Sbjct: 82  KAVLVTDGERILGHGDLGVYGMGIPVGKICLYTVCPGIWPDRCLLVCIDVGADNIALLKG 141

Query: 795 PFYMGLYQKRDRSQRYDDPIDEFMKAITDRYGTNILIPFETL-ES*CIRFLKNYQ 956
            FYMGLYQKRDR+Q+ DDPIDEFMKAITDRYG N L+ FE        RFL+ YQ
Sbjct: 142 TFYMGLYQKRDRTQQSDDPIDEFMKAITDRYGWNTLLQFEGFGHHNAFRFLRKYQ 196



 Score =  100 bits (248), Expect(2) = 4e-64
 Identities = 46/60 (76%), Positives = 51/60 (85%)
 Frame = +1

Query: 448 LNGPLEKYIYIMGIQERNEKLFYRILQDDIETLMPIVYTPTVGLACSQYGHIFRRPKLLW 627
           +  P E YIYIMGIQERN+KLFYRILQDD E+LMPI YTPTVGL CSQ GH+FRRPK L+
Sbjct: 1   MTSPSENYIYIMGIQERNDKLFYRILQDDTESLMPIAYTPTVGLVCSQCGHLFRRPKGLF 60


>ref|XP_948952.1| PREDICTED: hypothetical protein XP_948952 [Homo sapiens]
          Length = 250

 Score = 34.3 bits (77), Expect(2) = 8e-06
 Identities = 19/37 (51%), Positives = 20/37 (54%)
 Frame = -2

Query: 160 SAHPDDAQLQLSPPLPFSRLPGAGAS*GSTRPGRLDT 50
           +A P DAQL   P LPF   PGA  S GS   GR  T
Sbjct: 129 AARPGDAQLPRRPALPFCEPPGAAVSSGSHWRGRPHT 165



 Score = 33.9 bits (76), Expect(2) = 8e-06
 Identities = 16/24 (66%), Positives = 17/24 (70%)
 Frame = -1

Query: 218 LTTSLAPRQVVLRTERPRPLSPPG 147
           LT  LAPRQVV   ERPRP + PG
Sbjct: 110 LTRGLAPRQVVHPAERPRPAARPG 133


>ref|XP_939453.1| PREDICTED: hypothetical protein XP_939453 [Homo sapiens]
          Length = 250

 Score = 34.3 bits (77), Expect(2) = 8e-06
 Identities = 19/37 (51%), Positives = 20/37 (54%)
 Frame = -2

Query: 160 SAHPDDAQLQLSPPLPFSRLPGAGAS*GSTRPGRLDT 50
           +A P DAQL   P LPF   PGA  S GS   GR  T
Sbjct: 129 AARPGDAQLPRRPALPFCEPPGAAVSSGSHWRGRPHT 165



 Score = 33.9 bits (76), Expect(2) = 8e-06
 Identities = 16/24 (66%), Positives = 17/24 (70%)
 Frame = -1

Query: 218 LTTSLAPRQVVLRTERPRPLSPPG 147
           LT  LAPRQVV   ERPRP + PG
Sbjct: 110 LTRGLAPRQVVHPAERPRPAARPG 133


  Database: RefSeqHP
    Posted date:  Aug 2, 2006 12:57 AM
  Number of letters in database: 17,774,539
  Number of sequences in database:  39,411
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 37,736,683
Number of Sequences: 39411
Number of extensions: 983015
Number of successful extensions: 4455
Number of sequences better than 1.0e-05: 8
Number of HSP's better than  0.0 without gapping: 3550
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4442
length of database: 17,774,539
effective HSP length: 102
effective length of database: 13,754,617
effective search space used: 3039770357
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqCP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611S-042241
         (971 letters)

Database: RefSeqCP 
           33,732 sequences; 19,266,565 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|XP_849530.1| PREDICTED: similar to NAD-dependent malic enzym...   256   e-120
Alignment   gi|XP_533402.2| PREDICTED: similar to NAD-dependent malic enzym...   193   5e-72
Alignment   gi|XP_848770.1| PREDICTED: similar to malic enzyme 3, NADP(+)-d...   142   1e-68
Alignment   gi|XP_857135.1| PREDICTED: similar to malic enzyme 3, NADP(+)-d...   142   8e-64
Alignment   gi|XP_857227.1| PREDICTED: similar to malic enzyme 3, NADP(+)-d...   142   8e-64
Alignment   gi|XP_857177.1| PREDICTED: similar to malic enzyme 3, NADP(+)-d...   142   8e-64
Alignment   gi|XP_857051.1| PREDICTED: similar to malic enzyme 3, NADP(+)-d...   142   8e-64
Alignment   gi|XP_532217.2| PREDICTED: similar to NADP-dependent malic enzy...   142   1e-62
Alignment   gi|XP_542269.2| PREDICTED: similar to malic enzyme 3, NADP(+)-d...   142   5e-34

>ref|XP_849530.1| PREDICTED: similar to NAD-dependent malic enzyme, mitochondrial
           precursor (NAD-ME) (Malic enzyme 2) isoform 2 [Canis
           familiaris]
          Length = 584

 Score =  256 bits (655), Expect(2) = e-120
 Identities = 124/134 (92%), Positives = 130/134 (97%)
 Frame = +1

Query: 226 MLSRFKIVATPCTLACRHLHIKEKGKPLMLNPRTNKGMAFTLQERQMLGLQGLLPPKIET 405
           MLSR +IVA P TLACRH+HIKEKGKPLMLNPRTNKGMAFTLQERQMLGLQGLLPPKIET
Sbjct: 1   MLSRLRIVAVPSTLACRHIHIKEKGKPLMLNPRTNKGMAFTLQERQMLGLQGLLPPKIET 60

Query: 406 QDIQALRFHRNVKKLNGPLEKYIYIMGIQERNEKLFYRILQDDIETLMPIVYTPTVGLAC 585
           QDIQALRFH+NVKK+NGPLEKYIYIMGIQERNEKLFYRILQDDIE+LMPIVYTPTVGLAC
Sbjct: 61  QDIQALRFHKNVKKMNGPLEKYIYIMGIQERNEKLFYRILQDDIESLMPIVYTPTVGLAC 120

Query: 586 SQYGHIFRRPKLLW 627
           SQYGHIFRRPK L+
Sbjct: 121 SQYGHIFRRPKGLF 134



 Score =  193 bits (490), Expect(2) = e-120
 Identities = 96/116 (82%), Positives = 100/116 (86%), Gaps = 1/116 (0%)
 Frame = +3

Query: 615 QAVVVTDGERILGLGDLGVYGMGIPVXKLCLYTACAGIRPDRCLPVCIDVGTRYPALLKD 794
           +AVVVTDGERILGLGDLGVYGMGIPV KLCLYTACAGIRPDRCLPVCIDVGT  PALLKD
Sbjct: 156 KAVVVTDGERILGLGDLGVYGMGIPVGKLCLYTACAGIRPDRCLPVCIDVGTDNPALLKD 215

Query: 795 PFYMGLYQKRDRSQRYDDPIDEFMKAITDRYGTNILIPFETL-ES*CIRFLKNYQK 959
           PFYMGLYQKRDRSQRYDD IDEFMKAITDRYG N LI FE        RFL+ Y++
Sbjct: 216 PFYMGLYQKRDRSQRYDDLIDEFMKAITDRYGQNTLIQFEDFGNHNAFRFLRKYRE 271


>ref|XP_533402.2| PREDICTED: similar to NAD-dependent malic enzyme, mitochondrial
           precursor (NAD-ME) (Malic enzyme 2) isoform 1 [Canis
           familiaris]
          Length = 499

 Score =  193 bits (490), Expect(2) = 5e-72
 Identities = 96/116 (82%), Positives = 100/116 (86%), Gaps = 1/116 (0%)
 Frame = +3

Query: 615 QAVVVTDGERILGLGDLGVYGMGIPVXKLCLYTACAGIRPDRCLPVCIDVGTRYPALLKD 794
           +AVVVTDGERILGLGDLGVYGMGIPV KLCLYTACAGIRPDRCLPVCIDVGT  PALLKD
Sbjct: 71  KAVVVTDGERILGLGDLGVYGMGIPVGKLCLYTACAGIRPDRCLPVCIDVGTDNPALLKD 130

Query: 795 PFYMGLYQKRDRSQRYDDPIDEFMKAITDRYGTNILIPFETL-ES*CIRFLKNYQK 959
           PFYMGLYQKRDRSQRYDD IDEFMKAITDRYG N LI FE        RFL+ Y++
Sbjct: 131 PFYMGLYQKRDRSQRYDDLIDEFMKAITDRYGQNTLIQFEDFGNHNAFRFLRKYRE 186



 Score = 97.4 bits (241), Expect(2) = 5e-72
 Identities = 46/49 (93%), Positives = 48/49 (97%)
 Frame = +1

Query: 481 MGIQERNEKLFYRILQDDIETLMPIVYTPTVGLACSQYGHIFRRPKLLW 627
           MGIQERNEKLFYRILQDDIE+LMPIVYTPTVGLACSQYGHIFRRPK L+
Sbjct: 1   MGIQERNEKLFYRILQDDIESLMPIVYTPTVGLACSQYGHIFRRPKGLF 49


>ref|XP_848770.1| PREDICTED: similar to malic enzyme 3, NADP(+)-dependent,
           mitochondrial isoform 2 [Canis familiaris]
          Length = 604

 Score =  142 bits (358), Expect(2) = 1e-68
 Identities = 69/115 (60%), Positives = 84/115 (73%), Gaps = 1/115 (0%)
 Frame = +3

Query: 615 QAVVVTDGERILGLGDLGVYGMGIPVXKLCLYTACAGIRPDRCLPVCIDVGTRYPALLKD 794
           +AVVVTDGERILGLGDLG YGMGIPV KL LYTAC G+ P +CLPV +DVGT    LL+D
Sbjct: 181 KAVVVTDGERILGLGDLGCYGMGIPVGKLALYTACGGVSPQQCLPVLLDVGTNNEELLRD 240

Query: 795 PFYMGLYQKRDRSQRYDDPIDEFMKAITDRYGTNILIPFETL-ES*CIRFLKNYQ 956
           P Y+GL  +R R + YDD +DEFM+A+TD++G N LI FE    +   R L  Y+
Sbjct: 241 PLYIGLKHQRVRGKEYDDLLDEFMQAVTDKFGINCLIQFEDFANANAFRLLNKYR 295



 Score =  137 bits (344), Expect(2) = 1e-68
 Identities = 65/118 (55%), Positives = 85/118 (72%)
 Frame = +1

Query: 274 RHLHIKEKGKPLMLNPRTNKGMAFTLQERQMLGLQGLLPPKIETQDIQALRFHRNVKKLN 453
           R + +K++G  +  NP  NKGMAFTL+ER  LG+ GL+PP   +QD+Q LR  R  ++  
Sbjct: 42  RPVPLKKRGYDVTRNPHLNKGMAFTLEERLQLGIHGLIPPCFLSQDVQLLRIMRYYERQQ 101

Query: 454 GPLEKYIYIMGIQERNEKLFYRILQDDIETLMPIVYTPTVGLACSQYGHIFRRPKLLW 627
             L+KYI +M +Q+RNEKLFYR+L  D+E  MPIVYTPTVGLAC QYG  FRRP+ L+
Sbjct: 102 SDLDKYIILMTLQDRNEKLFYRVLTSDVEKFMPIVYTPTVGLACQQYGLTFRRPRGLF 159


>ref|XP_857135.1| PREDICTED: similar to malic enzyme 3, NADP(+)-dependent,
           mitochondrial isoform 5 [Canis familiaris]
          Length = 573

 Score =  142 bits (358), Expect(2) = 8e-64
 Identities = 69/115 (60%), Positives = 84/115 (73%), Gaps = 1/115 (0%)
 Frame = +3

Query: 615 QAVVVTDGERILGLGDLGVYGMGIPVXKLCLYTACAGIRPDRCLPVCIDVGTRYPALLKD 794
           +AVVVTDGERILGLGDLG YGMGIPV KL LYTAC G+ P +CLPV +DVGT    LL+D
Sbjct: 119 KAVVVTDGERILGLGDLGCYGMGIPVGKLALYTACGGVSPQQCLPVLLDVGTNNEELLRD 178

Query: 795 PFYMGLYQKRDRSQRYDDPIDEFMKAITDRYGTNILIPFETL-ES*CIRFLKNYQ 956
           P Y+GL  +R R + YDD +DEFM+A+TD++G N LI FE    +   R L  Y+
Sbjct: 179 PLYIGLKHQRVRGKEYDDLLDEFMQAVTDKFGINCLIQFEDFANANAFRLLNKYR 233



 Score =  120 bits (302), Expect(2) = 8e-64
 Identities = 57/97 (58%), Positives = 72/97 (74%)
 Frame = +1

Query: 337 MAFTLQERQMLGLQGLLPPKIETQDIQALRFHRNVKKLNGPLEKYIYIMGIQERNEKLFY 516
           MAFTL+ER  LG+ GL+PP   +QD+Q LR  R  ++    L+KYI +M +Q+RNEKLFY
Sbjct: 1   MAFTLEERLQLGIHGLIPPCFLSQDVQLLRIMRYYERQQSDLDKYIILMTLQDRNEKLFY 60

Query: 517 RILQDDIETLMPIVYTPTVGLACSQYGHIFRRPKLLW 627
           R+L  D+E  MPIVYTPTVGLAC QYG  FRRP+ L+
Sbjct: 61  RVLTSDVEKFMPIVYTPTVGLACQQYGLTFRRPRGLF 97


>ref|XP_857227.1| PREDICTED: similar to malic enzyme 3, NADP(+)-dependent,
           mitochondrial isoform 7 [Canis familiaris]
          Length = 562

 Score =  142 bits (358), Expect(2) = 8e-64
 Identities = 69/115 (60%), Positives = 84/115 (73%), Gaps = 1/115 (0%)
 Frame = +3

Query: 615 QAVVVTDGERILGLGDLGVYGMGIPVXKLCLYTACAGIRPDRCLPVCIDVGTRYPALLKD 794
           +AVVVTDGERILGLGDLG YGMGIPV KL LYTAC G+ P +CLPV +DVGT    LL+D
Sbjct: 119 KAVVVTDGERILGLGDLGCYGMGIPVGKLALYTACGGVSPQQCLPVLLDVGTNNEELLRD 178

Query: 795 PFYMGLYQKRDRSQRYDDPIDEFMKAITDRYGTNILIPFETL-ES*CIRFLKNYQ 956
           P Y+GL  +R R + YDD +DEFM+A+TD++G N LI FE    +   R L  Y+
Sbjct: 179 PLYIGLKHQRVRGKEYDDLLDEFMQAVTDKFGINCLIQFEDFANANAFRLLNKYR 233



 Score =  120 bits (302), Expect(2) = 8e-64
 Identities = 57/97 (58%), Positives = 72/97 (74%)
 Frame = +1

Query: 337 MAFTLQERQMLGLQGLLPPKIETQDIQALRFHRNVKKLNGPLEKYIYIMGIQERNEKLFY 516
           MAFTL+ER  LG+ GL+PP   +QD+Q LR  R  ++    L+KYI +M +Q+RNEKLFY
Sbjct: 1   MAFTLEERLQLGIHGLIPPCFLSQDVQLLRIMRYYERQQSDLDKYIILMTLQDRNEKLFY 60

Query: 517 RILQDDIETLMPIVYTPTVGLACSQYGHIFRRPKLLW 627
           R+L  D+E  MPIVYTPTVGLAC QYG  FRRP+ L+
Sbjct: 61  RVLTSDVEKFMPIVYTPTVGLACQQYGLTFRRPRGLF 97


>ref|XP_857177.1| PREDICTED: similar to malic enzyme 3, NADP(+)-dependent,
           mitochondrial isoform 6 [Canis familiaris]
          Length = 513

 Score =  142 bits (358), Expect(2) = 8e-64
 Identities = 69/115 (60%), Positives = 84/115 (73%), Gaps = 1/115 (0%)
 Frame = +3

Query: 615 QAVVVTDGERILGLGDLGVYGMGIPVXKLCLYTACAGIRPDRCLPVCIDVGTRYPALLKD 794
           +AVVVTDGERILGLGDLG YGMGIPV KL LYTAC G+ P +CLPV +DVGT    LL+D
Sbjct: 119 KAVVVTDGERILGLGDLGCYGMGIPVGKLALYTACGGVSPQQCLPVLLDVGTNNEELLRD 178

Query: 795 PFYMGLYQKRDRSQRYDDPIDEFMKAITDRYGTNILIPFETL-ES*CIRFLKNYQ 956
           P Y+GL  +R R + YDD +DEFM+A+TD++G N LI FE    +   R L  Y+
Sbjct: 179 PLYIGLKHQRVRGKEYDDLLDEFMQAVTDKFGINCLIQFEDFANANAFRLLNKYR 233



 Score =  120 bits (302), Expect(2) = 8e-64
 Identities = 57/97 (58%), Positives = 72/97 (74%)
 Frame = +1

Query: 337 MAFTLQERQMLGLQGLLPPKIETQDIQALRFHRNVKKLNGPLEKYIYIMGIQERNEKLFY 516
           MAFTL+ER  LG+ GL+PP   +QD+Q LR  R  ++    L+KYI +M +Q+RNEKLFY
Sbjct: 1   MAFTLEERLQLGIHGLIPPCFLSQDVQLLRIMRYYERQQSDLDKYIILMTLQDRNEKLFY 60

Query: 517 RILQDDIETLMPIVYTPTVGLACSQYGHIFRRPKLLW 627
           R+L  D+E  MPIVYTPTVGLAC QYG  FRRP+ L+
Sbjct: 61  RVLTSDVEKFMPIVYTPTVGLACQQYGLTFRRPRGLF 97


>ref|XP_857051.1| PREDICTED: similar to malic enzyme 3, NADP(+)-dependent,
           mitochondrial isoform 3 [Canis familiaris]
          Length = 361

 Score =  142 bits (358), Expect(2) = 8e-64
 Identities = 69/115 (60%), Positives = 84/115 (73%), Gaps = 1/115 (0%)
 Frame = +3

Query: 615 QAVVVTDGERILGLGDLGVYGMGIPVXKLCLYTACAGIRPDRCLPVCIDVGTRYPALLKD 794
           +AVVVTDGERILGLGDLG YGMGIPV KL LYTAC G+ P +CLPV +DVGT    LL+D
Sbjct: 119 KAVVVTDGERILGLGDLGCYGMGIPVGKLALYTACGGVSPQQCLPVLLDVGTNNEELLRD 178

Query: 795 PFYMGLYQKRDRSQRYDDPIDEFMKAITDRYGTNILIPFETL-ES*CIRFLKNYQ 956
           P Y+GL  +R R + YDD +DEFM+A+TD++G N LI FE    +   R L  Y+
Sbjct: 179 PLYIGLKHQRVRGKEYDDLLDEFMQAVTDKFGINCLIQFEDFANANAFRLLNKYR 233



 Score =  120 bits (302), Expect(2) = 8e-64
 Identities = 57/97 (58%), Positives = 72/97 (74%)
 Frame = +1

Query: 337 MAFTLQERQMLGLQGLLPPKIETQDIQALRFHRNVKKLNGPLEKYIYIMGIQERNEKLFY 516
           MAFTL+ER  LG+ GL+PP   +QD+Q LR  R  ++    L+KYI +M +Q+RNEKLFY
Sbjct: 1   MAFTLEERLQLGIHGLIPPCFLSQDVQLLRIMRYYERQQSDLDKYIILMTLQDRNEKLFY 60

Query: 517 RILQDDIETLMPIVYTPTVGLACSQYGHIFRRPKLLW 627
           R+L  D+E  MPIVYTPTVGLAC QYG  FRRP+ L+
Sbjct: 61  RVLTSDVEKFMPIVYTPTVGLACQQYGLTFRRPRGLF 97


>ref|XP_532217.2| PREDICTED: similar to NADP-dependent malic enzyme (NADP-ME) (Malic
           enzyme 1) [Canis familiaris]
          Length = 634

 Score =  142 bits (359), Expect(2) = 1e-62
 Identities = 71/115 (61%), Positives = 83/115 (72%), Gaps = 1/115 (0%)
 Frame = +3

Query: 615 QAVVVTDGERILGLGDLGVYGMGIPVXKLCLYTACAGIRPDRCLPVCIDVGTRYPALLKD 794
           +A+VVTDGERILGLGDLG  GMGIPV KL LYTAC G+ P  CLPV +DVGT   ALLKD
Sbjct: 208 KAIVVTDGERILGLGDLGCNGMGIPVGKLALYTACGGMNPQECLPVILDVGTENEALLKD 267

Query: 795 PFYMGLYQKRDRSQRYDDPIDEFMKAITDRYGTNILIPFETLES-*CIRFLKNYQ 956
           P Y+GL Q+R R   YDD +DEFM+A++ +YG N LI FE   +    R LK YQ
Sbjct: 268 PLYIGLRQRRVRGPEYDDFLDEFMEAVSSKYGMNCLIQFEDFANINAFRLLKKYQ 322



 Score =  116 bits (291), Expect(2) = 1e-62
 Identities = 53/97 (54%), Positives = 71/97 (73%)
 Frame = +1

Query: 337 MAFTLQERQMLGLQGLLPPKIETQDIQALRFHRNVKKLNGPLEKYIYIMGIQERNEKLFY 516
           +AFTL+ERQ L + GLLPP   +QDIQ LR  +N ++L    ++Y+ +M +Q+RNEKLFY
Sbjct: 90  LAFTLEERQQLNIHGLLPPCFISQDIQVLRIIKNFERLTSDFDRYLLLMDLQDRNEKLFY 149

Query: 517 RILQDDIETLMPIVYTPTVGLACSQYGHIFRRPKLLW 627
            +L  D+E  MPIVYTPTVGLAC QY   FR+P+ L+
Sbjct: 150 SVLMSDLEKFMPIVYTPTVGLACQQYSLAFRKPRGLF 186


>ref|XP_542269.2| PREDICTED: similar to malic enzyme 3, NADP(+)-dependent,
           mitochondrial isoform 1 [Canis familiaris]
          Length = 569

 Score =  142 bits (358), Expect = 5e-34
 Identities = 69/115 (60%), Positives = 84/115 (73%), Gaps = 1/115 (0%)
 Frame = +3

Query: 615 QAVVVTDGERILGLGDLGVYGMGIPVXKLCLYTACAGIRPDRCLPVCIDVGTRYPALLKD 794
           +AVVVTDGERILGLGDLG YGMGIPV KL LYTAC G+ P +CLPV +DVGT    LL+D
Sbjct: 146 KAVVVTDGERILGLGDLGCYGMGIPVGKLALYTACGGVSPQQCLPVLLDVGTNNEELLRD 205

Query: 795 PFYMGLYQKRDRSQRYDDPIDEFMKAITDRYGTNILIPFETL-ES*CIRFLKNYQ 956
           P Y+GL  +R R + YDD +DEFM+A+TD++G N LI FE    +   R L  Y+
Sbjct: 206 PLYIGLKHQRVRGKEYDDLLDEFMQAVTDKFGINCLIQFEDFANANAFRLLNKYR 260



 Score =  120 bits (301), Expect = 2e-27
 Identities = 56/94 (59%), Positives = 70/94 (74%)
 Frame = +1

Query: 337 MAFTLQERQMLGLQGLLPPKIETQDIQALRFHRNVKKLNGPLEKYIYIMGIQERNEKLFY 516
           MAFTL+ER  LG+ GL+PP   +QD+Q LR  R  ++    L+KYI +M +Q+RNEKLFY
Sbjct: 1   MAFTLEERLQLGIHGLIPPCFLSQDVQLLRIMRYYERQQSDLDKYIILMTLQDRNEKLFY 60

Query: 517 RILQDDIETLMPIVYTPTVGLACSQYGHIFRRPK 618
           R+L  D+E  MPIVYTPTVGLAC QYG  FRRP+
Sbjct: 61  RVLTSDVEKFMPIVYTPTVGLACQQYGLTFRRPR 94


  Database: RefSeqCP
    Posted date:  Aug 1, 2006  9:25 PM
  Number of letters in database: 19,266,565
  Number of sequences in database:  33,732
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 39,579,075
Number of Sequences: 33732
Number of extensions: 1015063
Number of successful extensions: 4231
Number of sequences better than 1.0e-05: 9
Number of HSP's better than  0.0 without gapping: 3424
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4218
length of database: 19,266,565
effective HSP length: 103
effective length of database: 15,792,169
effective search space used: 3474277180
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqMP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611S-042241
         (971 letters)

Database: RefSeqMP 
           45,328 sequences; 21,768,885 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_663469.1| malic enzyme 2, NAD(+)-dependent, mitochondrial...   245   e-113
Alignment   gi|NP_852072.1| malic enzyme 3, NADP(+)-dependent, mitochondria...   143   2e-67
Alignment   gi|NP_032641.1| malic enzyme, supernatant [Mus musculus]             131   1e-63
Alignment   gi|XP_001004679.1| PREDICTED: similar to NADP-dependent malic e...   131   7e-60
Alignment   gi|XP_001004685.1| PREDICTED: similar to NADP-dependent malic e...   131   7e-60
Alignment   gi|XP_001004683.1| PREDICTED: similar to NADP-dependent malic e...    99   9e-21

>ref|NP_663469.1| malic enzyme 2, NAD(+)-dependent, mitochondrial [Mus musculus]
          Length = 589

 Score =  245 bits (625), Expect(2) = e-113
 Identities = 117/134 (87%), Positives = 124/134 (92%)
 Frame = +1

Query: 226 MLSRFKIVATPCTLACRHLHIKEKGKPLMLNPRTNKGMAFTLQERQMLGLQGLLPPKIET 405
           M SR + V TPCTL CR +H+KEKGKPLMLNPRTNKGMAFTLQERQMLGLQGLLPPKIET
Sbjct: 1   MFSRLRAVTTPCTLTCRRVHLKEKGKPLMLNPRTNKGMAFTLQERQMLGLQGLLPPKIET 60

Query: 406 QDIQALRFHRNVKKLNGPLEKYIYIMGIQERNEKLFYRILQDDIETLMPIVYTPTVGLAC 585
           QDIQALRFHRN+KK+  PLEKYIYIMGIQERNEKLFYRILQDDIE+LMPIVYTPTVGLAC
Sbjct: 61  QDIQALRFHRNLKKMTSPLEKYIYIMGIQERNEKLFYRILQDDIESLMPIVYTPTVGLAC 120

Query: 586 SQYGHIFRRPKLLW 627
            QYGHIFRRPK L+
Sbjct: 121 CQYGHIFRRPKGLF 134



 Score =  183 bits (464), Expect(2) = e-113
 Identities = 91/116 (78%), Positives = 98/116 (84%), Gaps = 1/116 (0%)
 Frame = +3

Query: 615 QAVVVTDGERILGLGDLGVYGMGIPVXKLCLYTACAGIRPDRCLPVCIDVGTRYPALLKD 794
           +AVVVTDGERILGLGDLGVYGMGIPV KLCLYTACAGI+P++CLPVCIDVGT   ALLKD
Sbjct: 156 KAVVVTDGERILGLGDLGVYGMGIPVGKLCLYTACAGIQPEKCLPVCIDVGTDNMALLKD 215

Query: 795 PFYMGLYQKRDRSQRYDDPIDEFMKAITDRYGTNILIPFETL-ES*CIRFLKNYQK 959
           PFYMGLYQKRDRSQ YDD +DEFMKAITDRYG N LI FE        RFL+ YQ+
Sbjct: 216 PFYMGLYQKRDRSQLYDDLMDEFMKAITDRYGRNTLIQFEDFGNHNAFRFLRKYQQ 271


>ref|NP_852072.1| malic enzyme 3, NADP(+)-dependent, mitochondrial [Mus musculus]
          Length = 604

 Score =  143 bits (360), Expect(2) = 2e-67
 Identities = 69/115 (60%), Positives = 84/115 (73%), Gaps = 1/115 (0%)
 Frame = +3

Query: 615 QAVVVTDGERILGLGDLGVYGMGIPVXKLCLYTACAGIRPDRCLPVCIDVGTRYPALLKD 794
           +AVVVTDGERILGLGDLG YGMGIPV KL LYTAC G+ P +CLPV +DVGT    LL+D
Sbjct: 181 KAVVVTDGERILGLGDLGCYGMGIPVGKLALYTACGGVNPQQCLPVLLDVGTNNEELLRD 240

Query: 795 PFYMGLYQKRDRSQRYDDPIDEFMKAITDRYGTNILIPFETL-ES*CIRFLKNYQ 956
           P Y+GL  +R R + YDD +DEFM+A+TD++G N LI FE    +   R L  Y+
Sbjct: 241 PLYIGLKHQRVRGEEYDDLLDEFMQAVTDKFGINCLIQFEDFANANAFRLLNKYR 295



 Score =  132 bits (332), Expect(2) = 2e-67
 Identities = 64/118 (54%), Positives = 82/118 (69%)
 Frame = +1

Query: 274 RHLHIKEKGKPLMLNPRTNKGMAFTLQERQMLGLQGLLPPKIETQDIQALRFHRNVKKLN 453
           R + +K++G  +  NP  NKGMAFTL+ER  LG+ GL+PP   +QD+Q LR  R  +   
Sbjct: 42  RPVPLKKRGYDVTRNPHLNKGMAFTLEERLQLGIHGLIPPCFLSQDVQLLRIMRYYENQQ 101

Query: 454 GPLEKYIYIMGIQERNEKLFYRILQDDIETLMPIVYTPTVGLACSQYGHIFRRPKLLW 627
             L+KYI +M  Q+RNEKLFYR+L  D+E  MPIVYTPTVGLAC  YG  FRRP+ L+
Sbjct: 102 SDLDKYIILMTHQDRNEKLFYRVLTSDVEKFMPIVYTPTVGLACQHYGLTFRRPRGLF 159


>ref|NP_032641.1| malic enzyme, supernatant [Mus musculus]
          Length = 572

 Score =  131 bits (330), Expect(2) = 1e-63
 Identities = 62/100 (62%), Positives = 74/100 (74%)
 Frame = +3

Query: 615 QAVVVTDGERILGLGDLGVYGMGIPVXKLCLYTACAGIRPDRCLPVCIDVGTRYPALLKD 794
           +A+VVTDGERILGLGDLG  GMGIPV KL LYTAC G+ P +CLP+ +DVGT    LLKD
Sbjct: 146 KAIVVTDGERILGLGDLGCNGMGIPVGKLALYTACGGVNPQQCLPITLDVGTENEELLKD 205

Query: 795 PFYMGLYQKRDRSQRYDDPIDEFMKAITDRYGTNILIPFE 914
           P Y+GL  +R R   YD  +DEFM+A + +YG N LI FE
Sbjct: 206 PLYIGLRHRRVRGPEYDAFLDEFMEAASSKYGMNCLIQFE 245



 Score =  131 bits (329), Expect(2) = 1e-63
 Identities = 61/120 (50%), Positives = 84/120 (70%)
 Frame = +1

Query: 268 ACRHLHIKEKGKPLMLNPRTNKGMAFTLQERQMLGLQGLLPPKIETQDIQALRFHRNVKK 447
           A R  H  ++G  L  +P  NK +AFTL+ERQ L + GLLPP I +Q++Q LR  +N ++
Sbjct: 5   APRRRHTHQRGYLLTRDPHLNKDLAFTLEERQQLNIHGLLPPCIISQELQVLRIIKNFER 64

Query: 448 LNGPLEKYIYIMGIQERNEKLFYRILQDDIETLMPIVYTPTVGLACSQYGHIFRRPKLLW 627
           LN   ++Y+ +M +Q+RNEKLFY +L  D+E  MPIVYTPTVGLAC QY   FR+P+ L+
Sbjct: 65  LNSDFDRYLLLMDLQDRNEKLFYSVLMSDVEKFMPIVYTPTVGLACQQYSLAFRKPRGLF 124


>ref|XP_001004679.1| PREDICTED: similar to NADP-dependent malic enzyme (NADP-ME) (Malic
           enzyme 1) isoform 1 [Mus musculus]
          Length = 554

 Score =  131 bits (330), Expect(2) = 7e-60
 Identities = 62/100 (62%), Positives = 74/100 (74%)
 Frame = +3

Query: 615 QAVVVTDGERILGLGDLGVYGMGIPVXKLCLYTACAGIRPDRCLPVCIDVGTRYPALLKD 794
           +A+VVTDGERILGLGDLG  GMGIPV KL LYTAC G+ P +CLP+ +DVGT    LLKD
Sbjct: 126 KAIVVTDGERILGLGDLGCNGMGIPVGKLALYTACGGVNPQQCLPITLDVGTENEELLKD 185

Query: 795 PFYMGLYQKRDRSQRYDDPIDEFMKAITDRYGTNILIPFE 914
           P Y+GL  +R R   YD  +DEFM+A + +YG N LI FE
Sbjct: 186 PLYIGLRHRRVRGPEYDAFLDEFMEAASSKYGMNCLIQFE 225



 Score =  118 bits (296), Expect(2) = 7e-60
 Identities = 53/97 (54%), Positives = 73/97 (75%)
 Frame = +1

Query: 337 MAFTLQERQMLGLQGLLPPKIETQDIQALRFHRNVKKLNGPLEKYIYIMGIQERNEKLFY 516
           +AFTL+ERQ L + GLLPP I +Q++Q LR  +N ++LN   ++Y+ +M +Q+RNEKLFY
Sbjct: 8   LAFTLEERQQLNIHGLLPPCIISQELQVLRIIKNFERLNSDFDRYLLLMDLQDRNEKLFY 67

Query: 517 RILQDDIETLMPIVYTPTVGLACSQYGHIFRRPKLLW 627
            +L  D+E  MPIVYTPTVGLAC QY   FR+P+ L+
Sbjct: 68  SVLMSDVEKFMPIVYTPTVGLACQQYSLAFRKPRGLF 104


>ref|XP_001004685.1| PREDICTED: similar to NADP-dependent malic enzyme (NADP-ME) (Malic
           enzyme 1) isoform 4 [Mus musculus]
          Length = 552

 Score =  131 bits (330), Expect(2) = 7e-60
 Identities = 62/100 (62%), Positives = 74/100 (74%)
 Frame = +3

Query: 615 QAVVVTDGERILGLGDLGVYGMGIPVXKLCLYTACAGIRPDRCLPVCIDVGTRYPALLKD 794
           +A+VVTDGERILGLGDLG  GMGIPV KL LYTAC G+ P +CLP+ +DVGT    LLKD
Sbjct: 126 KAIVVTDGERILGLGDLGCNGMGIPVGKLALYTACGGVNPQQCLPITLDVGTENEELLKD 185

Query: 795 PFYMGLYQKRDRSQRYDDPIDEFMKAITDRYGTNILIPFE 914
           P Y+GL  +R R   YD  +DEFM+A + +YG N LI FE
Sbjct: 186 PLYIGLRHRRVRGPEYDAFLDEFMEAASSKYGMNCLIQFE 225



 Score =  118 bits (296), Expect(2) = 7e-60
 Identities = 53/97 (54%), Positives = 73/97 (75%)
 Frame = +1

Query: 337 MAFTLQERQMLGLQGLLPPKIETQDIQALRFHRNVKKLNGPLEKYIYIMGIQERNEKLFY 516
           +AFTL+ERQ L + GLLPP I +Q++Q LR  +N ++LN   ++Y+ +M +Q+RNEKLFY
Sbjct: 8   LAFTLEERQQLNIHGLLPPCIISQELQVLRIIKNFERLNSDFDRYLLLMDLQDRNEKLFY 67

Query: 517 RILQDDIETLMPIVYTPTVGLACSQYGHIFRRPKLLW 627
            +L  D+E  MPIVYTPTVGLAC QY   FR+P+ L+
Sbjct: 68  SVLMSDVEKFMPIVYTPTVGLACQQYSLAFRKPRGLF 104


>ref|XP_001004683.1| PREDICTED: similar to NADP-dependent malic enzyme (NADP-ME) (Malic
           enzyme 1) isoform 3 [Mus musculus]
          Length = 406

 Score = 98.6 bits (244), Expect = 9e-21
 Identities = 45/79 (56%), Positives = 55/79 (69%)
 Frame = +3

Query: 678 MGIPVXKLCLYTACAGIRPDRCLPVCIDVGTRYPALLKDPFYMGLYQKRDRSQRYDDPID 857
           MGIPV KL LYTAC G+ P +CLP+ +DVGT    LLKDP Y+GL  +R R   YD  +D
Sbjct: 1   MGIPVGKLALYTACGGVNPQQCLPITLDVGTENEELLKDPLYIGLRHRRVRGPEYDAFLD 60

Query: 858 EFMKAITDRYGTNILIPFE 914
           EFM+A + +YG N LI FE
Sbjct: 61  EFMEAASSKYGMNCLIQFE 79


  Database: RefSeqMP
    Posted date:  Aug 2, 2006 12:58 AM
  Number of letters in database: 21,768,885
  Number of sequences in database:  45,328
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 45,332,497
Number of Sequences: 45328
Number of extensions: 1153138
Number of successful extensions: 4779
Number of sequences better than 1.0e-05: 6
Number of HSP's better than  0.0 without gapping: 3899
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4765
length of database: 21,768,885
effective HSP length: 104
effective length of database: 17,054,773
effective search space used: 3734995287
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)