Animal-Genome cDNA 20060611S-045667


Search to RefSeqSP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611S-045667
         (1247 letters)

Database: RefSeqSP 
           1040 sequences; 434,620 total letters

Searching...done

 ***** No hits found ******

  Database: RefSeqSP
    Posted date:  Aug 1, 2006  7:14 PM
  Number of letters in database: 434,620
  Number of sequences in database:  1040
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,114,437
Number of Sequences: 1040
Number of extensions: 29991
Number of successful extensions: 118
Number of sequences better than 1.0e-05: 0
Number of HSP's better than  0.0 without gapping: 88
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 118
length of database: 434,620
effective HSP length: 79
effective length of database: 352,460
effective search space used: 118426560
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqBP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611S-045667
         (1247 letters)

Database: RefSeqBP 
           33,508 sequences; 16,112,626 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_776711.1| cAMP responsive element binding protein 3 (luma...   315   3e-95
Alignment   gi|XP_885877.1| PREDICTED: similar to cAMP responsive element b...   100   3e-21
Alignment   gi|XP_608017.2| PREDICTED: similar to cAMP responsive element b...   100   3e-21
Alignment   gi|NP_001029604.1| cAMP responsive element binding protein 3-li...    86   5e-17
Alignment   gi|XP_590741.2| PREDICTED: similar to cAMP responsive element b...    69   1e-11

>ref|NP_776711.1| cAMP responsive element binding protein 3 (luman) [Bos taurus]
          Length = 365

 Score =  315 bits (808), Expect(2) = 3e-95
 Identities = 172/251 (68%), Positives = 181/251 (72%)
 Frame = +2

Query: 74  AARDEALDAPLDWELPLSEALSDWDVEDFLSCLSSPPASLTDFSHSDPYLVHHDHTYSLS 253
           AA DEAL +P DWELPLSE+LSDWDVEDFLSCL SPPA L  FS+SDP LV HDHTYSLS
Sbjct: 25  AAPDEALTSPPDWELPLSESLSDWDVEDFLSCLPSPPAVLNVFSNSDPCLVQHDHTYSLS 84

Query: 254 QEYVSIDLDNEDYEKEGAQMTSLRVEAPAEQEIGXXXXXXXXXXXXXXXXXXXXXXXXXX 433
           QE+VSIDLDNE YEKE AQMT LRVE PA+QEI                           
Sbjct: 85  QEHVSIDLDNESYEKERAQMTPLRVEEPADQEIARLILTEEEKRLLEKEGLTLPGMLPLT 144

Query: 434 KMEEQVLRRVRRKIRNKKSAQESRRKKKVYVGSLESRVLKYSAQNLELQNKVQLLEEQNX 613
           KMEEQVL+RVRRKIRNKKSAQESRRKKKVYVG LESRVLKY+AQNLELQNKVQLLEEQN 
Sbjct: 145 KMEEQVLKRVRRKIRNKKSAQESRRKKKVYVGGLESRVLKYTAQNLELQNKVQLLEEQNL 204

Query: 614 XXXXXXXXXXXMVIQTANKASSSSTCIXXXXXXXXXXXXPAMYSSDTRGSPPAEHGVLSR 793
                      MVIQTANKASSSSTC+            PAMYSSDTRGS PAEH VLSR
Sbjct: 205 SLLDQLRRLQAMVIQTANKASSSSTCVLVLLFSFCLLLVPAMYSSDTRGSLPAEHRVLSR 264

Query: 794 QLRALPARTFP 826
           QLRALP+   P
Sbjct: 265 QLRALPSEDPP 275



 Score = 52.8 bits (125), Expect(2) = 3e-95
 Identities = 29/59 (49%), Positives = 32/59 (54%)
 Frame = +1

Query: 808 PSEDVPQRDLPALQSEVPQDSSTHELQAPGALCCLXHTWLGLLGADRP*SCHCPDASQG 984
           PSED PQ + PALQSEVP+DS   ELQA    CCL H       A+ P     PD   G
Sbjct: 270 PSEDPPQLEPPALQSEVPKDSLNPELQAASNSCCLFHLMPQAPRAEPPLQLPLPDGFSG 328


>ref|XP_885877.1| PREDICTED: similar to cAMP responsive element binding protein
           3-like 4 isoform 2 [Bos taurus]
          Length = 257

 Score =  100 bits (248), Expect = 3e-21
 Identities = 57/128 (44%), Positives = 76/128 (59%), Gaps = 6/128 (4%)
 Frame = +2

Query: 434 KMEEQVLRRVRRKIRNKKSAQESRRKKKVYVGSLESRVLKYSAQNLELQNKVQLLEEQNX 613
           K EE+VL++VRRKIRNK+SAQ+SRR+KK Y+  LESRV   +AQN ELQ KVQ LE  N 
Sbjct: 74  KAEERVLKKVRRKIRNKQSAQDSRRRKKEYIDGLESRVAACAAQNQELQRKVQELERHNI 133

Query: 614 XXXXXXXXXXXMVIQTANKASSSSTCIXXXXXXXXXXXXPAMYSSDTRGSPPA------E 775
                      +++QT+NKA+ +STC+            P+   S  +G P A       
Sbjct: 134 SLVTQLRQLQMLIVQTSNKAAQTSTCVLILLFSLALIILPSF--SPFQGLPEAGPEDYQP 191

Query: 776 HGVLSRQL 799
           HGV+SR +
Sbjct: 192 HGVISRNI 199


>ref|XP_608017.2| PREDICTED: similar to cAMP responsive element binding protein
           3-like 4 isoform 1 [Bos taurus]
          Length = 257

 Score =  100 bits (248), Expect = 3e-21
 Identities = 57/128 (44%), Positives = 76/128 (59%), Gaps = 6/128 (4%)
 Frame = +2

Query: 434 KMEEQVLRRVRRKIRNKKSAQESRRKKKVYVGSLESRVLKYSAQNLELQNKVQLLEEQNX 613
           K EE+VL++VRRKIRNK+SAQ+SRR+KK Y+  LESRV   +AQN ELQ KVQ LE  N 
Sbjct: 74  KAEERVLKKVRRKIRNKQSAQDSRRRKKEYIDGLESRVAACAAQNQELQRKVQELERHNI 133

Query: 614 XXXXXXXXXXXMVIQTANKASSSSTCIXXXXXXXXXXXXPAMYSSDTRGSPPA------E 775
                      +++QT+NKA+ +STC+            P+   S  +G P A       
Sbjct: 134 SLVTQLRQLQMLIVQTSNKAAQTSTCVLILLFSLALIILPSF--SPFQGLPEAGPEDYQP 191

Query: 776 HGVLSRQL 799
           HGV+SR +
Sbjct: 192 HGVISRNI 199


>ref|NP_001029604.1| cAMP responsive element binding protein 3-like 3 [Bos taurus]
          Length = 456

 Score = 86.3 bits (212), Expect = 5e-17
 Identities = 46/113 (40%), Positives = 70/113 (61%), Gaps = 2/113 (1%)
 Frame = +2

Query: 434 KMEEQVLRRVRRKIRNKKSAQESRRKKKVYVGSLESRVLKYSAQNLELQNKVQLLEEQNX 613
           K EE++L+++RRKIRNK+SAQESR+KKK Y+  LE+R+   +AQN ELQ KV  LE+QN 
Sbjct: 233 KYEERMLKKIRRKIRNKQSAQESRKKKKEYIDGLETRMSACTAQNQELQRKVLHLEKQNL 292

Query: 614 XXXXXXXXXXXMVIQTANKASSSSTCIXXXXXXXXXXXXPAM--YSSDTRGSP 766
                      +V+Q+ +K++ + TCI            P++  ++S+   SP
Sbjct: 293 SLLEQLKKLQAIVVQSTSKSAQTGTCIAVLLFSFALIVLPSISPFASNRAESP 345


>ref|XP_590741.2| PREDICTED: similar to cAMP responsive element binding protein
           3-like 1 [Bos taurus]
          Length = 520

 Score = 68.6 bits (166), Expect = 1e-11
 Identities = 39/92 (42%), Positives = 54/92 (58%), Gaps = 5/92 (5%)
 Frame = +2

Query: 434 KMEEQVLRRVRRKIRNKKSAQESRRKKKVYVGSLESRVLKYSAQNLELQNKVQLLEEQNX 613
           K EE+ L+RVRRKI+NK SAQESRRKKK YV  LE +V  ++++N EL  KV+ LE  N 
Sbjct: 285 KAEEKALKRVRRKIKNKISAQESRRKKKEYVECLEKKVETFTSENNELWKKVETLENANR 344

Query: 614 XXXXXXXXXXXMVIQTANK-----ASSSSTCI 694
                      +V    ++     A+ + TC+
Sbjct: 345 TLLQQLQKLQTLVTSKISRPYKMAATQTGTCL 376


  Database: RefSeqBP
    Posted date:  Aug 1, 2006  7:14 PM
  Number of letters in database: 16,112,626
  Number of sequences in database:  33,508
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 42,573,866
Number of Sequences: 33508
Number of extensions: 1200276
Number of successful extensions: 6381
Number of sequences better than 1.0e-05: 5
Number of HSP's better than  0.0 without gapping: 4761
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6360
length of database: 16,112,626
effective HSP length: 104
effective length of database: 12,627,794
effective search space used: 3927243934
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqCP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611S-045667
         (1247 letters)

Database: RefSeqCP 
           33,732 sequences; 19,266,565 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|XP_854750.1| PREDICTED: similar to cAMP responsive element b...   267   3e-81
Alignment   gi|XP_855139.1| PREDICTED: similar to cAMP responsive element b...    97   3e-20
Alignment   gi|XP_542164.2| PREDICTED: similar to cAMP responsive element b...    86   1e-16
Alignment   gi|XP_548490.2| PREDICTED: similar to cAMP responsive element b...    72   1e-12
Alignment   gi|XP_540756.2| PREDICTED: similar to cAMP responsive element b...    69   1e-11

>ref|XP_854750.1| PREDICTED: similar to cAMP responsive element binding protein 3
           [Canis familiaris]
          Length = 411

 Score =  267 bits (682), Expect(2) = 3e-81
 Identities = 146/232 (62%), Positives = 159/232 (68%)
 Frame = +2

Query: 119 PLSEALSDWDVEDFLSCLSSPPASLTDFSHSDPYLVHHDHTYSLSQEYVSIDLDNEDYEK 298
           PLSEALS+W+ EDFLS + SPPASL   S SD  LVHHDHTYSLSQ++VSIDLD   Y K
Sbjct: 86  PLSEALSEWEAEDFLSSMLSPPASLNVLSSSDSCLVHHDHTYSLSQQHVSIDLDGGSYGK 145

Query: 299 EGAQMTSLRVEAPAEQEIGXXXXXXXXXXXXXXXXXXXXXXXXXXKMEEQVLRRVRRKIR 478
           E AQ T L+VE PAEQEI                           KMEEQVL RVRRKIR
Sbjct: 146 EEAQTTPLQVEEPAEQEIARLILTDEEKRLLEKEGLTLHGTLPLTKMEEQVLTRVRRKIR 205

Query: 479 NKKSAQESRRKKKVYVGSLESRVLKYSAQNLELQNKVQLLEEQNXXXXXXXXXXXXMVIQ 658
           NKKSAQESRRKKKVY+G LE+RVLKY+AQNLELQNKVQLLEEQN            M+IQ
Sbjct: 206 NKKSAQESRRKKKVYLGGLENRVLKYTAQNLELQNKVQLLEEQNLSLLDQLRRLQAMLIQ 265

Query: 659 TANKASSSSTCIXXXXXXXXXXXXPAMYSSDTRGSPPAEHGVLSRQLRALPA 814
            +NK SSSSTC+            PAMYSSDTRGS PAEHGVLSRQLRALP+
Sbjct: 266 ISNKTSSSSTCVLVLLFSFCLLIVPAMYSSDTRGSLPAEHGVLSRQLRALPS 317



 Score = 54.7 bits (130), Expect(2) = 3e-81
 Identities = 41/106 (38%), Positives = 47/106 (44%)
 Frame = +1

Query: 808  PSEDVPQRDLPALQSEVPQDSSTHELQAPGALCCLXHTWLGLLGADRP*SCHCPDASQGL 987
            PSED  Q +LPALQSEVP+DSS  ELQAPG  CC  +      GA+ P     P      
Sbjct: 316  PSEDPHQLELPALQSEVPKDSSDQELQAPGNSCCPLYHLPQAPGAESPLKLPLPV----- 370

Query: 988  *PSPIFPCMQSHRRGRCSXTQPLSVPCRQYSANWENEGAHQNWGPT 1125
             PS   PC               S P     AN+  +G    W PT
Sbjct: 371  -PSSKSPC---------------SCPLLPLHANFTRDG---GWLPT 397


>ref|XP_855139.1| PREDICTED: similar to cAMP responsive element binding protein
           3-like 4 [Canis familiaris]
          Length = 384

 Score = 97.1 bits (240), Expect = 3e-20
 Identities = 56/128 (43%), Positives = 75/128 (58%), Gaps = 6/128 (4%)
 Frame = +2

Query: 434 KMEEQVLRRVRRKIRNKKSAQESRRKKKVYVGSLESRVLKYSAQNLELQNKVQLLEEQNX 613
           K EE+VL+++RRKIRNK+SAQ+SRR+KK Y+  LESRV   SAQN ELQ KVQ LE  N 
Sbjct: 201 KAEERVLKKIRRKIRNKQSAQDSRRRKKEYIDGLESRVAACSAQNQELQKKVQELERHNI 260

Query: 614 XXXXXXXXXXXMVIQTANKASSSSTCIXXXXXXXXXXXXPAMYSSDTRGSPPA------E 775
                      ++ QT+NKA+ +STC+            P++  S  +G   A       
Sbjct: 261 SLVTQLRQLQTLIAQTSNKAAQTSTCVLILLFSLALIVLPSV--SPLQGLREAGSEDYQP 318

Query: 776 HGVLSRQL 799
           HGV+SR +
Sbjct: 319 HGVISRNI 326


>ref|XP_542164.2| PREDICTED: similar to cAMP responsive element binding protein
           3-like 3 [Canis familiaris]
          Length = 609

 Score = 85.5 bits (210), Expect = 1e-16
 Identities = 42/87 (48%), Positives = 61/87 (70%)
 Frame = +2

Query: 434 KMEEQVLRRVRRKIRNKKSAQESRRKKKVYVGSLESRVLKYSAQNLELQNKVQLLEEQNX 613
           K EE+VL+++RRKIRNK+SAQESR+KKK Y+  LE+R+   +AQN ELQ KV  LE+QN 
Sbjct: 358 KYEERVLKKIRRKIRNKQSAQESRKKKKEYIDGLETRMSACTAQNQELQRKVLHLEKQNL 417

Query: 614 XXXXXXXXXXXMVIQTANKASSSSTCI 694
                      +V+Q+ +K++ + TC+
Sbjct: 418 SLLEQLKKLQAIVVQSTSKSAQTGTCL 444


>ref|XP_548490.2| PREDICTED: similar to cAMP responsive element binding protein
           3-like 2 [Canis familiaris]
          Length = 393

 Score = 71.6 bits (174), Expect = 1e-12
 Identities = 44/127 (34%), Positives = 66/127 (51%), Gaps = 10/127 (7%)
 Frame = +2

Query: 434 KMEEQVLRRVRRKIRNKKSAQESRRKKKVYVGSLESRVLKYSAQNLELQNKVQLLEEQNX 613
           K EE+ L+++RRKI+NK SAQESRRKKK Y+ SLE +V   S +NLEL+ KV++LE  N 
Sbjct: 186 KSEEKALKKIRRKIKNKISAQESRRKKKEYMDSLEKKVESCSTENLELRKKVEVLENTNR 245

Query: 614 XXXXXXXXXXXMVIQTANK-----ASSSSTCIX-----XXXXXXXXXXXPAMYSSDTRGS 763
                      +V+   ++      + + TC+                    Y S T+ +
Sbjct: 246 TLLQQLQKLQTLVMGKVSRTCKLAGTQTGTCLMVVVLCFAVAFGSFFQGYGPYPSATKMA 305

Query: 764 PPAEHGV 784
            P++H V
Sbjct: 306 LPSQHSV 312


>ref|XP_540756.2| PREDICTED: similar to cAMP responsive element binding protein
           3-like 1 [Canis familiaris]
          Length = 725

 Score = 68.6 bits (166), Expect = 1e-11
 Identities = 39/92 (42%), Positives = 54/92 (58%), Gaps = 5/92 (5%)
 Frame = +2

Query: 434 KMEEQVLRRVRRKIRNKKSAQESRRKKKVYVGSLESRVLKYSAQNLELQNKVQLLEEQNX 613
           K EE+ L+RVRRKI+NK SAQESRRKKK YV  LE +V  ++++N EL  KV+ LE  N 
Sbjct: 490 KAEEKALKRVRRKIKNKISAQESRRKKKEYVECLEKKVETFTSENNELWKKVETLENANR 549

Query: 614 XXXXXXXXXXXMVIQTANK-----ASSSSTCI 694
                      +V    ++     A+ + TC+
Sbjct: 550 TLLQQLQKLQTLVTNKISRPYKMAATQTGTCL 581


  Database: RefSeqCP
    Posted date:  Aug 1, 2006  9:25 PM
  Number of letters in database: 19,266,565
  Number of sequences in database:  33,732
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 49,921,383
Number of Sequences: 33732
Number of extensions: 1410995
Number of successful extensions: 7913
Number of sequences better than 1.0e-05: 5
Number of HSP's better than  0.0 without gapping: 5651
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7872
length of database: 19,266,565
effective HSP length: 105
effective length of database: 15,724,705
effective search space used: 4874658550
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqHP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611S-045667
         (1247 letters)

Database: RefSeqHP 
           39,411 sequences; 17,774,539 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_006359.3| cAMP responsive element binding protein 3 [Homo...   271   2e-80
Alignment   gi|NP_570968.1| cAMP responsive element binding protein 3-like ...   100   4e-21
Alignment   gi|NP_115996.1| cAMP responsive element binding protein 3-like ...    86   7e-17
Alignment   gi|NP_919047.2| cAMP responsive element binding protein 3-like ...    71   2e-12
Alignment   gi|NP_443086.1| cAMP responsive element binding protein 3-like ...    69   1e-11

>ref|NP_006359.3| cAMP responsive element binding protein 3 [Homo sapiens]
          Length = 371

 Score =  271 bits (692), Expect(2) = 2e-80
 Identities = 148/246 (60%), Positives = 165/246 (67%)
 Frame = +2

Query: 77  ARDEALDAPLDWELPLSEALSDWDVEDFLSCLSSPPASLTDFSHSDPYLVHHDHTYSLSQ 256
           A DEA+ APLDW LPLSE  SDW+V+D L  L SPPASL   S S+P LVHHDHTYSL +
Sbjct: 26  APDEAVRAPLDWALPLSEVPSDWEVDDLLCSLLSPPASLNILSSSNPCLVHHDHTYSLPR 85

Query: 257 EYVSIDLDNEDYEKEGAQMTSLRVEAPAEQEIGXXXXXXXXXXXXXXXXXXXXXXXXXXK 436
           E VS+DL++E   KEG QMT   +E  AEQEI                           K
Sbjct: 86  ETVSMDLESESCRKEGTQMTPQHMEELAEQEIARLVLTDEEKSLLEKEGLILPETLPLTK 145

Query: 437 MEEQVLRRVRRKIRNKKSAQESRRKKKVYVGSLESRVLKYSAQNLELQNKVQLLEEQNXX 616
            EEQ+L+RVRRKIRNK+SAQESRRKKKVYVG LESRVLKY+AQN+ELQNKVQLLEEQN  
Sbjct: 146 TEEQILKRVRRKIRNKRSAQESRRKKKVYVGGLESRVLKYTAQNMELQNKVQLLEEQNLS 205

Query: 617 XXXXXXXXXXMVIQTANKASSSSTCIXXXXXXXXXXXXPAMYSSDTRGSPPAEHGVLSRQ 796
                     MVI+ +NK SSSSTCI            PAMYSSDTRGS PAEHGVLSRQ
Sbjct: 206 LLDQLRKLQAMVIEISNKTSSSSTCILVLLVSFCLLLVPAMYSSDTRGSLPAEHGVLSRQ 265

Query: 797 LRALPA 814
           LRALP+
Sbjct: 266 LRALPS 271



 Score = 47.8 bits (112), Expect(2) = 2e-80
 Identities = 35/76 (46%), Positives = 40/76 (52%), Gaps = 9/76 (11%)
 Frame = +1

Query: 808  PSEDVPQRDLPALQSEVPQDSSTHE--------LQAPGALCCLXHTWLGLLGADRP*SCH 963
            PSED  Q +LPALQSEVP+D STH+        LQAPG   CL H       A+ P    
Sbjct: 270  PSEDPYQLELPALQSEVPKD-STHQWLDGSDCVLQAPGNTSCLLHYMPQAPSAEPPLEWP 328

Query: 964  CPDA-SQGL*PSPIFP 1008
             PD  S+ L   PI P
Sbjct: 329  FPDLFSEPLCRGPILP 344


>ref|NP_570968.1| cAMP responsive element binding protein 3-like 4 [Homo sapiens]
          Length = 395

 Score = 99.8 bits (247), Expect = 4e-21
 Identities = 56/126 (44%), Positives = 73/126 (57%), Gaps = 4/126 (3%)
 Frame = +2

Query: 434 KMEEQVLRRVRRKIRNKKSAQESRRKKKVYVGSLESRVLKYSAQNLELQNKVQLLEEQNX 613
           K EE+VL++VRRKIRNK+SAQ+SRR+KK Y+  LESRV   SAQN ELQ KVQ LE  N 
Sbjct: 212 KAEERVLKKVRRKIRNKQSAQDSRRRKKEYIDGLESRVAACSAQNQELQKKVQELERHNI 271

Query: 614 XXXXXXXXXXXMVIQTANKASSSSTCIXXXXXXXXXXXXPAMYSSDTRGSPPAE----HG 781
                      ++ QT+NKA+ +STC+            P+     +R    +E    HG
Sbjct: 272 SLVAQLRQLQTLIAQTSNKAAQTSTCVLILLFSLALIILPSFSPFQSRPEAGSEDYQPHG 331

Query: 782 VLSRQL 799
           V SR +
Sbjct: 332 VTSRNI 337


>ref|NP_115996.1| cAMP responsive element binding protein 3-like 3 [Homo sapiens]
          Length = 461

 Score = 85.9 bits (211), Expect = 7e-17
 Identities = 42/87 (48%), Positives = 61/87 (70%)
 Frame = +2

Query: 434 KMEEQVLRRVRRKIRNKKSAQESRRKKKVYVGSLESRVLKYSAQNLELQNKVQLLEEQNX 613
           K EE+VL+++RRKIRNK+SAQESR+KKK Y+  LE+R+   +AQN ELQ KV  LE+QN 
Sbjct: 238 KYEERVLKKIRRKIRNKQSAQESRKKKKEYIDGLETRMSACTAQNQELQRKVLHLEKQNL 297

Query: 614 XXXXXXXXXXXMVIQTANKASSSSTCI 694
                      +V+Q+ +K++ + TC+
Sbjct: 298 SLLEQLKKLQAIVVQSTSKSAQTGTCV 324


>ref|NP_919047.2| cAMP responsive element binding protein 3-like 2 [Homo sapiens]
          Length = 520

 Score = 71.2 bits (173), Expect = 2e-12
 Identities = 35/59 (59%), Positives = 46/59 (77%)
 Frame = +2

Query: 434 KMEEQVLRRVRRKIRNKKSAQESRRKKKVYVGSLESRVLKYSAQNLELQNKVQLLEEQN 610
           K EE+ L+++RRKI+NK SAQESRRKKK Y+ SLE +V   S +NLEL+ KV++LE  N
Sbjct: 289 KSEEKALKKIRRKIKNKISAQESRRKKKEYMDSLEKKVESCSTENLELRKKVEVLENTN 347


>ref|NP_443086.1| cAMP responsive element binding protein 3-like 1 [Homo sapiens]
          Length = 519

 Score = 68.6 bits (166), Expect = 1e-11
 Identities = 39/92 (42%), Positives = 54/92 (58%), Gaps = 5/92 (5%)
 Frame = +2

Query: 434 KMEEQVLRRVRRKIRNKKSAQESRRKKKVYVGSLESRVLKYSAQNLELQNKVQLLEEQNX 613
           K EE+ L+RVRRKI+NK SAQESRRKKK YV  LE +V  ++++N EL  KV+ LE  N 
Sbjct: 285 KAEEKALKRVRRKIKNKISAQESRRKKKEYVECLEKKVETFTSENNELWKKVETLENANR 344

Query: 614 XXXXXXXXXXXMVIQTANK-----ASSSSTCI 694
                      +V    ++     A+ + TC+
Sbjct: 345 TLLQQLQKLQTLVTNKISRPYKMAATQTGTCL 376


  Database: RefSeqHP
    Posted date:  Aug 2, 2006 12:57 AM
  Number of letters in database: 17,774,539
  Number of sequences in database:  39,411
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 48,680,116
Number of Sequences: 39411
Number of extensions: 1429009
Number of successful extensions: 8528
Number of sequences better than 1.0e-05: 5
Number of HSP's better than  0.0 without gapping: 5916
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 8489
length of database: 17,774,539
effective HSP length: 104
effective length of database: 13,675,795
effective search space used: 4253172245
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqMP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611S-045667
         (1247 letters)

Database: RefSeqMP 
           45,328 sequences; 21,768,885 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_038525.1| cAMP responsive element binding protein 3 [Mus ...   217   1e-57
Alignment   gi|NP_084356.1| androgen-induced basic leucine zipper [Mus musc...    91   2e-18
Alignment   gi|NP_663340.1| cAMP responsive element binding protein 3-like ...    86   6e-17
Alignment   gi|NP_848776.1| cAMP responsive element binding protein 3-like ...    72   1e-12
Alignment   gi|XP_919654.2| PREDICTED: similar to cAMP responsive element b...    71   2e-12
Alignment   gi|NP_036087.1| cAMP responsive element binding protein 3-like ...    70   6e-12

>ref|NP_038525.1| cAMP responsive element binding protein 3 [Mus musculus]
          Length = 379

 Score =  217 bits (553), Expect(2) = 1e-57
 Identities = 133/252 (52%), Positives = 152/252 (60%), Gaps = 5/252 (1%)
 Frame = +2

Query: 74  AARDEALDAPLDWELPLSE----ALSDWDVEDFLSCLSSPPASLTDFSHSDPYLVHHDHT 241
           AA +  + APLD EL  SE     LSDW+VED LS L SP AS  D   S    + HDH 
Sbjct: 31  AATEPDVKAPLDLELSPSENSVQELSDWEVEDLLSSLLSPSAS-RDVLGSSSSSILHDHN 89

Query: 242 YSLSQEYVSIDLDNEDYEKEGAQMTSLR-VEAPAEQEIGXXXXXXXXXXXXXXXXXXXXX 418
           YSL QE+VSIDLD E +EKEG  +T L   E  AEQE+                      
Sbjct: 90  YSLPQEHVSIDLDTESFEKEGFHVTPLPGEERAAEQEMSRLILTEEEKKLLEKEGLTLPS 149

Query: 419 XXXXXKMEEQVLRRVRRKIRNKKSAQESRRKKKVYVGSLESRVLKYSAQNLELQNKVQLL 598
                K+EEQVL+RVRRKIRNK++AQESR+KKKVYV  LESRVLKY+AQN ELQNKVQ L
Sbjct: 150 TLPLTKVEEQVLKRVRRKIRNKRAAQESRKKKKVYVVGLESRVLKYTAQNRELQNKVQRL 209

Query: 599 EEQNXXXXXXXXXXXXMVIQTANKASSSSTCIXXXXXXXXXXXXPAMYSSDTRGSPPAEH 778
           EEQN            MVI+ ANK SS STC+            PAMYSSD RGS PAE+
Sbjct: 210 EEQNLSLLDQLRKLQAMVIEIANKTSSGSTCVLVLVFSFCLLLVPAMYSSDARGSVPAEY 269

Query: 779 GVLSRQLRALPA 814
            VL R+LRALP+
Sbjct: 270 VVLHRKLRALPS 281



 Score = 25.8 bits (55), Expect(2) = 1e-57
 Identities = 19/60 (31%), Positives = 26/60 (43%)
 Frame = +1

Query: 808 PSEDVPQRDLPALQSEVPQDSSTHELQAPGALCCLXHTWLGLLGADRP*SCHCPDASQGL 987
           PSED  Q    AL SE+P DS+   L +   +  +   +  +L        H P A Q L
Sbjct: 280 PSEDDHQPKPSALSSELPMDSTHQSLDSSEHMFLVSSNFSCVL-------YHAPQAEQPL 332


>ref|NP_084356.1| androgen-induced basic leucine zipper [Mus musculus]
          Length = 370

 Score = 91.3 bits (225), Expect = 2e-18
 Identities = 51/126 (40%), Positives = 72/126 (57%), Gaps = 4/126 (3%)
 Frame = +2

Query: 434 KMEEQVLRRVRRKIRNKKSAQESRRKKKVYVGSLESRVLKYSAQNLELQNKVQLLEEQNX 613
           K EE++L+++RRKIRNK+SAQ+SRR+KK Y+  LESRV   S QN +LQ KVQ LE QN 
Sbjct: 188 KAEERILKKIRRKIRNKQSAQDSRRRKKEYLDGLESRVAACSEQNQKLQRKVQELERQNI 247

Query: 614 XXXXXXXXXXXMVIQTANKASSSSTCIXXXXXXXXXXXXPAMY----SSDTRGSPPAEHG 781
                      +  QT+++A+ +STC+            P+       S+ R      HG
Sbjct: 248 FLMEQVRQLQKLTAQTSSRAAQTSTCVLILLFSLALIILPSFSPFQGQSEARPEDYQLHG 307

Query: 782 VLSRQL 799
           V+SR +
Sbjct: 308 VISRNI 313


>ref|NP_663340.1| cAMP responsive element binding protein 3-like 3 [Mus musculus]
          Length = 479

 Score = 86.3 bits (212), Expect = 6e-17
 Identities = 47/113 (41%), Positives = 69/113 (61%), Gaps = 2/113 (1%)
 Frame = +2

Query: 434 KMEEQVLRRVRRKIRNKKSAQESRRKKKVYVGSLESRVLKYSAQNLELQNKVQLLEEQNX 613
           K EE+VL+++RRKIRNK+SAQESR+KKK Y+  LE+R+   +AQN ELQ KV  LE+QN 
Sbjct: 234 KYEERVLKKIRRKIRNKQSAQESRKKKKEYIDGLENRMSACTAQNQELQRKVLHLEKQNL 293

Query: 614 XXXXXXXXXXXMVIQTANKASSSSTCIXXXXXXXXXXXXPAM--YSSDTRGSP 766
                      +V+Q+ +K + + TCI            P++  ++S+   SP
Sbjct: 294 SLLEQLKHLQALVVQSTSKPAHAGTCIAVLLLSFALIILPSISPFNSNKVDSP 346


>ref|NP_848776.1| cAMP responsive element binding protein 3-like 2 [Mus musculus]
          Length = 521

 Score = 72.0 bits (175), Expect = 1e-12
 Identities = 35/59 (59%), Positives = 47/59 (79%)
 Frame = +2

Query: 434 KMEEQVLRRVRRKIRNKKSAQESRRKKKVYVGSLESRVLKYSAQNLELQNKVQLLEEQN 610
           K EE+ L+++RRKI+NK SAQESRRKKK Y+ SLE +V   S +NLEL+ KV++LE+ N
Sbjct: 289 KSEEKALKKIRRKIKNKISAQESRRKKKEYMDSLEKKVESCSTENLELRKKVEVLEDTN 347


>ref|XP_919654.2| PREDICTED: similar to cAMP responsive element binding protein
           3-like 2 [Mus musculus]
          Length = 477

 Score = 71.2 bits (173), Expect = 2e-12
 Identities = 35/59 (59%), Positives = 46/59 (77%)
 Frame = +2

Query: 434 KMEEQVLRRVRRKIRNKKSAQESRRKKKVYVGSLESRVLKYSAQNLELQNKVQLLEEQN 610
           K EE+ L+++RRKI+NK SAQESRRKKK Y+ SLE +V   S +NLEL+ KV++LE  N
Sbjct: 245 KSEEKALKKIRRKIKNKISAQESRRKKKEYMDSLEKKVESCSTENLELRKKVEVLENTN 303


>ref|NP_036087.1| cAMP responsive element binding protein 3-like 1 [Mus musculus]
          Length = 507

 Score = 69.7 bits (169), Expect = 6e-12
 Identities = 40/92 (43%), Positives = 54/92 (58%), Gaps = 5/92 (5%)
 Frame = +2

Query: 434 KMEEQVLRRVRRKIRNKKSAQESRRKKKVYVGSLESRVLKYSAQNLELQNKVQLLEEQNX 613
           K EE+ L+RVRRKI+NK SAQESRRKKK YV  LE +V  Y+++N EL  KV+ LE  N 
Sbjct: 285 KAEEKALKRVRRKIKNKISAQESRRKKKEYVECLEKKVETYTSENNELWKKVETLETANR 344

Query: 614 XXXXXXXXXXXMVIQTANK-----ASSSSTCI 694
                      +V    ++     A+ + TC+
Sbjct: 345 TLLQQLQKLQTLVTSKISRPYKMAATQTGTCL 376


  Database: RefSeqMP
    Posted date:  Aug 2, 2006 12:58 AM
  Number of letters in database: 21,768,885
  Number of sequences in database:  45,328
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 56,787,153
Number of Sequences: 45328
Number of extensions: 1575176
Number of successful extensions: 8772
Number of sequences better than 1.0e-05: 6
Number of HSP's better than  0.0 without gapping: 6309
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 8682
length of database: 21,768,885
effective HSP length: 106
effective length of database: 16,964,117
effective search space used: 5241912153
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)