Animal-Genome cDNA 20060611S-046491


Search to RefSeqSP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611S-046491
         (1173 letters)

Database: RefSeqSP 
           1040 sequences; 434,620 total letters

Searching...done

 ***** No hits found ******

  Database: RefSeqSP
    Posted date:  Aug 1, 2006  7:14 PM
  Number of letters in database: 434,620
  Number of sequences in database:  1040
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,078,907
Number of Sequences: 1040
Number of extensions: 26070
Number of successful extensions: 59
Number of sequences better than 1.0e-05: 0
Number of HSP's better than  0.0 without gapping: 56
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 59
length of database: 434,620
effective HSP length: 79
effective length of database: 352,460
effective search space used: 109615060
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqBP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611S-046491
         (1173 letters)

Database: RefSeqBP 
           33,508 sequences; 16,112,626 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_001030273.1| thioredoxin-like [Bos taurus]                     400   e-112
Alignment   gi|XP_873370.1| PREDICTED: similar to Thioredoxin-like protein ...   198   6e-51
Alignment   gi|XP_582303.1| PREDICTED: similar to CG14407-PA [Bos taurus]         89   5e-18

>ref|NP_001030273.1| thioredoxin-like [Bos taurus]
          Length = 334

 Score =  400 bits (1029), Expect = e-112
 Identities = 198/231 (85%), Positives = 210/231 (90%)
 Frame = +1

Query: 295 SSQDIHRLHGAHAPELTKKVQRHAXXXXXXXXXXEHLKEDLSLRLKKLTHAAPCMLFMKG 474
           +SQ I RL GAHAPELTKKVQRHA          EH KEDLSLRLKKLTHAAPCMLFMKG
Sbjct: 92  NSQKIDRLDGAHAPELTKKVQRHASSGSFSPSGSEHPKEDLSLRLKKLTHAAPCMLFMKG 151

Query: 475 TPQEPRCGFSKQMVEVLNKHNIQFSSFDIFSDEEVRQGLKTYSNWPTYPQLYVSGELIRG 654
           TPQEPRCGFSKQMVE+LNKHNIQFSSFDIFSDEEVRQGLKTYS+WPTYPQLYVSGELI G
Sbjct: 152 TPQEPRCGFSKQMVEILNKHNIQFSSFDIFSDEEVRQGLKTYSSWPTYPQLYVSGELIGG 211

Query: 655 LDIIKELEASKELDTICPTAPKLEERLKVLTNKASVMLYMKGNKQEAKCGFSRQILQILN 834
           LDIIKELEASKELDTICP APKLEERLKVLTNKASVML+MKGNKQEAKCGFSRQIL+ILN
Sbjct: 212 LDIIKELEASKELDTICPKAPKLEERLKVLTNKASVMLFMKGNKQEAKCGFSRQILEILN 271

Query: 835 STGVDYETFDILEDEVVRQGVETYSNWPTYPQLYVKGELGRGLNIVKD*KK 987
           STG++YETFDILEDE VRQG++ YSNWPTYPQLYVKGEL  GL+IVK+ K+
Sbjct: 272 STGIEYETFDILEDEEVRQGLKAYSNWPTYPQLYVKGELVGGLDIVKELKE 322



 Score =  128 bits (321), Expect = 1e-29
 Identities = 60/93 (64%), Positives = 73/93 (78%)
 Frame = +1

Query: 415 LSLRLKKLTHAAPCMLFMKGTPQEPRCGFSKQMVEVLNKHNIQFSSFDIFSDEEVRQGLK 594
           L  RLK LT+ A  MLFMKG  QE +CGFS+Q++E+LN   I++ +FDI  DEEVRQGLK
Sbjct: 234 LEERLKVLTNKASVMLFMKGNKQEAKCGFSRQILEILNSTGIEYETFDILEDEEVRQGLK 293

Query: 595 TYSNWPTYPQLYVSGELIRGLDIIKELEASKEL 693
            YSNWPTYPQLYV GEL+ GLDI+KEL+ + EL
Sbjct: 294 AYSNWPTYPQLYVKGELVGGLDIVKELKENGEL 326


>ref|XP_873370.1| PREDICTED: similar to Thioredoxin-like protein 2 (PKC-interacting
           cousin of thioredoxin) (PKC-theta-interacting protein)
           (PKCq-interacting protein) (HUSSY-22) [Bos taurus]
          Length = 164

 Score =  198 bits (504), Expect = 6e-51
 Identities = 116/219 (52%), Positives = 127/219 (57%)
 Frame = +1

Query: 331 APELTKKVQRHAXXXXXXXXXXEHLKEDLSLRLKKLTHAAPCMLFMKGTPQEPRCGFSKQ 510
           APEL+KKVQ+HA          EHLKEDL+  LKKL  AAPC+LFMKGTPQEPRCGF+  
Sbjct: 2   APELSKKVQQHASGGSFSPSGSEHLKEDLNQPLKKLFLAAPCILFMKGTPQEPRCGFN-- 59

Query: 511 MVEVLNKHNIQFSSFDIFSDEEVRQGLKTYSNWPTYPQLYVSGELIRGLDIIKELEASKE 690
                                EVRQ LKTYSNWPTYPQLYVSGELI GLDIIKELEASKE
Sbjct: 60  ---------------------EVRQALKTYSNWPTYPQLYVSGELIGGLDIIKELEASKE 98

Query: 691 LDTICPTAPKLEERLKVLTNKASVMLYMKGNKQEAKCGFSRQILQILNSTGVDYETFDIL 870
           LD ICP APKLEERLK                                            
Sbjct: 99  LDMICPKAPKLEERLK-------------------------------------------- 114

Query: 871 EDEVVRQGVETYSNWPTYPQLYVKGELGRGLNIVKD*KK 987
            DE V+QG++ YSNW TYPQL VKGEL RGL+IVK+ K+
Sbjct: 115 -DEEVQQGLKAYSNWLTYPQLNVKGELVRGLDIVKERKE 152


>ref|XP_582303.1| PREDICTED: similar to CG14407-PA [Bos taurus]
          Length = 158

 Score = 89.4 bits (220), Expect = 5e-18
 Identities = 36/93 (38%), Positives = 65/93 (69%), Gaps = 1/93 (1%)
 Frame = +1

Query: 418 SLRLKKLTHAAPCMLFMKGTPQEPRCGFSKQMVEVLNKHNIQ-FSSFDIFSDEEVRQGLK 594
           S  L  L      ++F+KGTP++P+CGFS  +V++L  H ++ ++++++  D ++RQG+K
Sbjct: 43  SEHLDALVKKDKVVVFLKGTPEQPQCGFSNAVVQILRLHGVRDYAAYNVLDDPQLRQGIK 102

Query: 595 TYSNWPTYPQLYVSGELIRGLDIIKELEASKEL 693
            YSNWPT PQ+Y++GE + G DI+ ++  + +L
Sbjct: 103 DYSNWPTIPQVYLNGEFVGGCDILLQMHQNGDL 135



 Score = 81.6 bits (200), Expect = 1e-15
 Identities = 36/83 (43%), Positives = 56/83 (67%), Gaps = 1/83 (1%)
 Frame = +1

Query: 727 ERLKVLTNKASVMLYMKGNKQEAKCGFSRQILQILNSTGV-DYETFDILEDEVVRQGVET 903
           E L  L  K  V++++KG  ++ +CGFS  ++QIL   GV DY  +++L+D  +RQG++ 
Sbjct: 44  EHLDALVKKDKVVVFLKGTPEQPQCGFSNAVVQILRLHGVRDYAAYNVLDDPQLRQGIKD 103

Query: 904 YSNWPTYPQLYVKGELGRGLNIV 972
           YSNWPT PQ+Y+ GE   G +I+
Sbjct: 104 YSNWPTIPQVYLNGEFVGGCDIL 126


  Database: RefSeqBP
    Posted date:  Aug 1, 2006  7:14 PM
  Number of letters in database: 16,112,626
  Number of sequences in database:  33,508
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 40,332,933
Number of Sequences: 33508
Number of extensions: 1002210
Number of successful extensions: 2932
Number of sequences better than 1.0e-05: 3
Number of HSP's better than  0.0 without gapping: 2597
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2927
length of database: 16,112,626
effective HSP length: 103
effective length of database: 12,661,302
effective search space used: 3633793674
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqCP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611S-046491
         (1173 letters)

Database: RefSeqCP 
           33,732 sequences; 19,266,565 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|XP_535061.2| PREDICTED: similar to Thioredoxin-like 2 protei...   397   e-110

>ref|XP_535061.2| PREDICTED: similar to Thioredoxin-like 2 protein (PKC-interacting
           cousin of thioredoxin) (PKCq-interacting protein)
           (PKC-theta-interacting protein) [Canis familiaris]
          Length = 333

 Score =  397 bits (1020), Expect = e-110
 Identities = 197/230 (85%), Positives = 208/230 (90%)
 Frame = +1

Query: 295 SSQDIHRLHGAHAPELTKKVQRHAXXXXXXXXXXEHLKEDLSLRLKKLTHAAPCMLFMKG 474
           +SQ I RL GAHAPELTKKVQRHA          EH KEDL +RLKKLTHAAPCMLFMKG
Sbjct: 91  NSQKIDRLDGAHAPELTKKVQRHASSGSFPPSTNEHPKEDLHVRLKKLTHAAPCMLFMKG 150

Query: 475 TPQEPRCGFSKQMVEVLNKHNIQFSSFDIFSDEEVRQGLKTYSNWPTYPQLYVSGELIRG 654
           TPQEPRCGFSKQMVE+LNKHNIQFSSFDIFSDEEVRQGLKTYSNWPTYPQLYVSGELI G
Sbjct: 151 TPQEPRCGFSKQMVEILNKHNIQFSSFDIFSDEEVRQGLKTYSNWPTYPQLYVSGELIGG 210

Query: 655 LDIIKELEASKELDTICPTAPKLEERLKVLTNKASVMLYMKGNKQEAKCGFSRQILQILN 834
           LDIIKELEAS ELDTICP APKLEERLKVLTNKASVML+MKGNKQEAKCGFS+QIL+ILN
Sbjct: 211 LDIIKELEASDELDTICPKAPKLEERLKVLTNKASVMLFMKGNKQEAKCGFSKQILEILN 270

Query: 835 STGVDYETFDILEDEVVRQGVETYSNWPTYPQLYVKGELGRGLNIVKD*K 984
           STGV+YETFDILEDE VRQG++TYSNWPTYPQLYVKGEL  GL+IVK+ K
Sbjct: 271 STGVEYETFDILEDEEVRQGLKTYSNWPTYPQLYVKGELVGGLDIVKELK 320



 Score =  130 bits (327), Expect = 2e-30
 Identities = 61/93 (65%), Positives = 74/93 (79%)
 Frame = +1

Query: 415 LSLRLKKLTHAAPCMLFMKGTPQEPRCGFSKQMVEVLNKHNIQFSSFDIFSDEEVRQGLK 594
           L  RLK LT+ A  MLFMKG  QE +CGFSKQ++E+LN   +++ +FDI  DEEVRQGLK
Sbjct: 233 LEERLKVLTNKASVMLFMKGNKQEAKCGFSKQILEILNSTGVEYETFDILEDEEVRQGLK 292

Query: 595 TYSNWPTYPQLYVSGELIRGLDIIKELEASKEL 693
           TYSNWPTYPQLYV GEL+ GLDI+KEL+ + EL
Sbjct: 293 TYSNWPTYPQLYVKGELVGGLDIVKELKDNGEL 325


  Database: RefSeqCP
    Posted date:  Aug 1, 2006  9:25 PM
  Number of letters in database: 19,266,565
  Number of sequences in database:  33,732
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 47,519,771
Number of Sequences: 33732
Number of extensions: 1185493
Number of successful extensions: 3397
Number of sequences better than 1.0e-05: 1
Number of HSP's better than  0.0 without gapping: 3029
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3393
length of database: 19,266,565
effective HSP length: 105
effective length of database: 15,724,705
effective search space used: 4481540925
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqHP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611S-046491
         (1173 letters)

Database: RefSeqHP 
           39,411 sequences; 17,774,539 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_006532.2| thioredoxin-like [Homo sapiens]                      395   e-110
Alignment   gi|NP_057501.2| glutaredoxin 5 [Homo sapiens]                         91   2e-18

>ref|NP_006532.2| thioredoxin-like [Homo sapiens]
          Length = 335

 Score =  395 bits (1016), Expect = e-110
 Identities = 195/231 (84%), Positives = 210/231 (90%)
 Frame = +1

Query: 295 SSQDIHRLHGAHAPELTKKVQRHAXXXXXXXXXXEHLKEDLSLRLKKLTHAAPCMLFMKG 474
           +SQ I RL GAHAPELTKKVQRHA          EHLKEDL+LRLKKLTHAAPCMLFMKG
Sbjct: 93  NSQKIDRLDGAHAPELTKKVQRHASSGSFLPSANEHLKEDLNLRLKKLTHAAPCMLFMKG 152

Query: 475 TPQEPRCGFSKQMVEVLNKHNIQFSSFDIFSDEEVRQGLKTYSNWPTYPQLYVSGELIRG 654
           TPQEPRCGFSKQMVE+L+KHNIQFSSFDIFSDEEVRQGLK YS+WPTYPQLYVSGELI G
Sbjct: 153 TPQEPRCGFSKQMVEILHKHNIQFSSFDIFSDEEVRQGLKAYSSWPTYPQLYVSGELIGG 212

Query: 655 LDIIKELEASKELDTICPTAPKLEERLKVLTNKASVMLYMKGNKQEAKCGFSRQILQILN 834
           LDIIKELEAS+ELDTICP APKLEERLKVLTNKASVML+MKGNKQEAKCGFS+QIL+ILN
Sbjct: 213 LDIIKELEASEELDTICPKAPKLEERLKVLTNKASVMLFMKGNKQEAKCGFSKQILEILN 272

Query: 835 STGVDYETFDILEDEVVRQGVETYSNWPTYPQLYVKGELGRGLNIVKD*KK 987
           STGV+YETFDILEDE VRQG++ YSNWPTYPQLYVKGEL  GL+IVK+ K+
Sbjct: 273 STGVEYETFDILEDEEVRQGLKAYSNWPTYPQLYVKGELVGGLDIVKELKE 323



 Score =  129 bits (323), Expect = 6e-30
 Identities = 60/93 (64%), Positives = 73/93 (78%)
 Frame = +1

Query: 415 LSLRLKKLTHAAPCMLFMKGTPQEPRCGFSKQMVEVLNKHNIQFSSFDIFSDEEVRQGLK 594
           L  RLK LT+ A  MLFMKG  QE +CGFSKQ++E+LN   +++ +FDI  DEEVRQGLK
Sbjct: 235 LEERLKVLTNKASVMLFMKGNKQEAKCGFSKQILEILNSTGVEYETFDILEDEEVRQGLK 294

Query: 595 TYSNWPTYPQLYVSGELIRGLDIIKELEASKEL 693
            YSNWPTYPQLYV GEL+ GLDI+KEL+ + EL
Sbjct: 295 AYSNWPTYPQLYVKGELVGGLDIVKELKENGEL 327


>ref|NP_057501.2| glutaredoxin 5 [Homo sapiens]
          Length = 157

 Score = 90.5 bits (223), Expect = 2e-18
 Identities = 36/91 (39%), Positives = 65/91 (71%), Gaps = 1/91 (1%)
 Frame = +1

Query: 424 RLKKLTHAAPCMLFMKGTPQEPRCGFSKQMVEVLNKHNIQ-FSSFDIFSDEEVRQGLKTY 600
           +L  L      ++F+KGTP++P+CGFS  +V++L  H ++ ++++++  D E+RQG+K Y
Sbjct: 44  QLDALVKKDKVVVFLKGTPEQPQCGFSNAVVQILRLHGVRDYAAYNVLDDPELRQGIKDY 103

Query: 601 SNWPTYPQLYVSGELIRGLDIIKELEASKEL 693
           SNWPT PQ+Y++GE + G DI+ ++  + +L
Sbjct: 104 SNWPTIPQVYLNGEFVGGCDILLQMHQNGDL 134



 Score = 82.0 bits (201), Expect = 9e-16
 Identities = 36/83 (43%), Positives = 57/83 (68%), Gaps = 1/83 (1%)
 Frame = +1

Query: 727 ERLKVLTNKASVMLYMKGNKQEAKCGFSRQILQILNSTGV-DYETFDILEDEVVRQGVET 903
           E+L  L  K  V++++KG  ++ +CGFS  ++QIL   GV DY  +++L+D  +RQG++ 
Sbjct: 43  EQLDALVKKDKVVVFLKGTPEQPQCGFSNAVVQILRLHGVRDYAAYNVLDDPELRQGIKD 102

Query: 904 YSNWPTYPQLYVKGELGRGLNIV 972
           YSNWPT PQ+Y+ GE   G +I+
Sbjct: 103 YSNWPTIPQVYLNGEFVGGCDIL 125


  Database: RefSeqHP
    Posted date:  Aug 2, 2006 12:57 AM
  Number of letters in database: 17,774,539
  Number of sequences in database:  39,411
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 45,570,005
Number of Sequences: 39411
Number of extensions: 1162069
Number of successful extensions: 3384
Number of sequences better than 1.0e-05: 2
Number of HSP's better than  0.0 without gapping: 2947
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3378
length of database: 17,774,539
effective HSP length: 104
effective length of database: 13,675,795
effective search space used: 3911277370
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqMP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611S-046491
         (1173 letters)

Database: RefSeqMP 
           45,328 sequences; 21,768,885 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_075629.2| thioredoxin-like 2 [Mus musculus]                    396   e-110
Alignment   gi|XP_995522.1| PREDICTED: similar to thioredoxin-like 2 [Mus m...   170   3e-42
Alignment   gi|XP_978406.1| PREDICTED: similar to thioredoxin-like 2 [Mus m...   170   3e-42
Alignment   gi|XP_978323.1| PREDICTED: similar to thioredoxin-like 2 [Mus m...   170   3e-42
Alignment   gi|NP_082695.1| glutaredoxin 5 [Mus musculus]                         91   3e-18

>ref|NP_075629.2| thioredoxin-like 2 [Mus musculus]
          Length = 337

 Score =  396 bits (1017), Expect = e-110
 Identities = 194/230 (84%), Positives = 210/230 (91%)
 Frame = +1

Query: 295 SSQDIHRLHGAHAPELTKKVQRHAXXXXXXXXXXEHLKEDLSLRLKKLTHAAPCMLFMKG 474
           +SQ + RL GAHAPELTKKVQRH           EHLKEDLSLRLKKLTHAAPCMLFMKG
Sbjct: 95  NSQKVDRLDGAHAPELTKKVQRHVSSGAFPPSTNEHLKEDLSLRLKKLTHAAPCMLFMKG 154

Query: 475 TPQEPRCGFSKQMVEVLNKHNIQFSSFDIFSDEEVRQGLKTYSNWPTYPQLYVSGELIRG 654
           TPQEPRCGFSKQMVE+L+KHNIQFSSFDIFSDEEVRQGLKTYSNWPTYPQLYVSGELI G
Sbjct: 155 TPQEPRCGFSKQMVEILHKHNIQFSSFDIFSDEEVRQGLKTYSNWPTYPQLYVSGELIGG 214

Query: 655 LDIIKELEASKELDTICPTAPKLEERLKVLTNKASVMLYMKGNKQEAKCGFSRQILQILN 834
           LDIIKELEAS+ELDTICP APKLEERLKVLTNKASVML+MKGNKQEAKCGFS+QIL+ILN
Sbjct: 215 LDIIKELEASEELDTICPKAPKLEERLKVLTNKASVMLFMKGNKQEAKCGFSKQILEILN 274

Query: 835 STGVDYETFDILEDEVVRQGVETYSNWPTYPQLYVKGELGRGLNIVKD*K 984
           STGV+YETFDILEDE VRQG++T+SNWPTYPQLYV+G+L  GL+IVK+ K
Sbjct: 275 STGVEYETFDILEDEEVRQGLKTFSNWPTYPQLYVRGDLVGGLDIVKELK 324



 Score =  127 bits (319), Expect = 2e-29
 Identities = 59/93 (63%), Positives = 74/93 (79%)
 Frame = +1

Query: 415 LSLRLKKLTHAAPCMLFMKGTPQEPRCGFSKQMVEVLNKHNIQFSSFDIFSDEEVRQGLK 594
           L  RLK LT+ A  MLFMKG  QE +CGFSKQ++E+LN   +++ +FDI  DEEVRQGLK
Sbjct: 237 LEERLKVLTNKASVMLFMKGNKQEAKCGFSKQILEILNSTGVEYETFDILEDEEVRQGLK 296

Query: 595 TYSNWPTYPQLYVSGELIRGLDIIKELEASKEL 693
           T+SNWPTYPQLYV G+L+ GLDI+KEL+ + EL
Sbjct: 297 TFSNWPTYPQLYVRGDLVGGLDIVKELKDNGEL 329


>ref|XP_995522.1| PREDICTED: similar to thioredoxin-like 2 [Mus musculus]
          Length = 365

 Score =  170 bits (430), Expect = 3e-42
 Identities = 103/193 (53%), Positives = 125/193 (64%)
 Frame = +2

Query: 407 KKTSAFA*RS*PTLPPACCS*REHPRSRAAVSASKWWKFLTNIISSLAVLISSQMKKFAK 586
           KKTSAFA +S  TLPPACCS REH ++RA VSAS+WWK  TN I S A LISSQMKKF +
Sbjct: 160 KKTSAFAXKSXLTLPPACCSXREHLKNRAVVSASRWWKSFTNTIFSSAALISSQMKKFDR 219

Query: 587 ASKPIPIGPPTPSSMFLESSYEDLI*SRS*KHLKN*IQFAPQLPN*RKGSKY*QIKLL*C 766
            SK   IGPP  SSMFLES  EDL   RS KH K+  +  P+ P+ RKGSK   IKL  C
Sbjct: 220 GSKRTLIGPPILSSMFLESXXEDLTXLRSWKHQKSWTRSVPKHPSXRKGSKCXPIKLRXC 279

Query: 767 SI*RETNRKPSVVSADKSCKF*IVLVSTTRRSTYWRMR*SGRGLKPTPTGRRTLSCM*KV 946
           S+ +ETNRK +V SA+K  K+ IVL    +   YW+M+   R  K +  G+ TLSCM + 
Sbjct: 280 SLXKETNRKQNVDSANKFWKYXIVLGLNMKLLIYWKMKKCVRDXKRSQIGQPTLSCMXEG 339

Query: 947 SWVEA*ILLRTKR 985
             +E  IL R  +
Sbjct: 340 ILLEDWILSRNXK 352


>ref|XP_978406.1| PREDICTED: similar to thioredoxin-like 2 [Mus musculus]
          Length = 365

 Score =  170 bits (430), Expect = 3e-42
 Identities = 103/193 (53%), Positives = 125/193 (64%)
 Frame = +2

Query: 407 KKTSAFA*RS*PTLPPACCS*REHPRSRAAVSASKWWKFLTNIISSLAVLISSQMKKFAK 586
           KKTSAFA +S  TLPPACCS REH ++RA VSAS+WWK  TN I S A LISSQMKKF +
Sbjct: 160 KKTSAFAXKSXLTLPPACCSXREHLKNRAVVSASRWWKSFTNTIFSSAALISSQMKKFDR 219

Query: 587 ASKPIPIGPPTPSSMFLESSYEDLI*SRS*KHLKN*IQFAPQLPN*RKGSKY*QIKLL*C 766
            SK   IGPP  SSMFLES  EDL   RS KH K+  +  P+ P+ RKGSK   IKL  C
Sbjct: 220 GSKRTLIGPPILSSMFLESXXEDLTXLRSWKHQKSWTRSVPKHPSXRKGSKCXPIKLRXC 279

Query: 767 SI*RETNRKPSVVSADKSCKF*IVLVSTTRRSTYWRMR*SGRGLKPTPTGRRTLSCM*KV 946
           S+ +ETNRK +V SA+K  K+ IVL    +   YW+M+   R  K +  G+ TLSCM + 
Sbjct: 280 SLXKETNRKQNVDSANKFWKYXIVLGLNMKLLIYWKMKKCVRDXKRSQIGQPTLSCMXEG 339

Query: 947 SWVEA*ILLRTKR 985
             +E  IL R  +
Sbjct: 340 ILLEDWILSRNXK 352


>ref|XP_978323.1| PREDICTED: similar to thioredoxin-like 2 [Mus musculus]
          Length = 365

 Score =  170 bits (430), Expect = 3e-42
 Identities = 103/193 (53%), Positives = 125/193 (64%)
 Frame = +2

Query: 407 KKTSAFA*RS*PTLPPACCS*REHPRSRAAVSASKWWKFLTNIISSLAVLISSQMKKFAK 586
           KKTSAFA +S  TLPPACCS REH ++RA VSAS+WWK  TN I S A LISSQMKKF +
Sbjct: 160 KKTSAFAXKSXLTLPPACCSXREHLKNRAVVSASRWWKSFTNTIFSSAALISSQMKKFDR 219

Query: 587 ASKPIPIGPPTPSSMFLESSYEDLI*SRS*KHLKN*IQFAPQLPN*RKGSKY*QIKLL*C 766
            SK   IGPP  SSMFLES  EDL   RS KH K+  +  P+ P+ RKGSK   IKL  C
Sbjct: 220 GSKRTLIGPPILSSMFLESXXEDLTXLRSWKHQKSWTRSVPKHPSXRKGSKCXPIKLRXC 279

Query: 767 SI*RETNRKPSVVSADKSCKF*IVLVSTTRRSTYWRMR*SGRGLKPTPTGRRTLSCM*KV 946
           S+ +ETNRK +V SA+K  K+ IVL    +   YW+M+   R  K +  G+ TLSCM + 
Sbjct: 280 SLXKETNRKQNVDSANKFWKYXIVLGLNMKLLIYWKMKKCVRDXKRSQIGQPTLSCMXEG 339

Query: 947 SWVEA*ILLRTKR 985
             +E  IL R  +
Sbjct: 340 ILLEDWILSRNXK 352


>ref|NP_082695.1| glutaredoxin 5 [Mus musculus]
          Length = 152

 Score = 90.5 bits (223), Expect = 3e-18
 Identities = 36/91 (39%), Positives = 65/91 (71%), Gaps = 1/91 (1%)
 Frame = +1

Query: 424 RLKKLTHAAPCMLFMKGTPQEPRCGFSKQMVEVLNKHNIQ-FSSFDIFSDEEVRQGLKTY 600
           +L  L      ++F+KGTP++P+CGFS  +V++L  H ++ ++++++  D E+RQG+K Y
Sbjct: 40  QLDALVKKDKVVVFLKGTPEQPQCGFSNAVVQILRLHGVRDYAAYNVLDDPELRQGIKDY 99

Query: 601 SNWPTYPQLYVSGELIRGLDIIKELEASKEL 693
           SNWPT PQ+Y++GE + G DI+ ++  + +L
Sbjct: 100 SNWPTIPQVYLNGEFVGGCDILLQMHQNGDL 130



 Score = 82.0 bits (201), Expect = 1e-15
 Identities = 36/83 (43%), Positives = 57/83 (68%), Gaps = 1/83 (1%)
 Frame = +1

Query: 727 ERLKVLTNKASVMLYMKGNKQEAKCGFSRQILQILNSTGV-DYETFDILEDEVVRQGVET 903
           E+L  L  K  V++++KG  ++ +CGFS  ++QIL   GV DY  +++L+D  +RQG++ 
Sbjct: 39  EQLDALVKKDKVVVFLKGTPEQPQCGFSNAVVQILRLHGVRDYAAYNVLDDPELRQGIKD 98

Query: 904 YSNWPTYPQLYVKGELGRGLNIV 972
           YSNWPT PQ+Y+ GE   G +I+
Sbjct: 99  YSNWPTIPQVYLNGEFVGGCDIL 121


  Database: RefSeqMP
    Posted date:  Aug 2, 2006 12:58 AM
  Number of letters in database: 21,768,885
  Number of sequences in database:  45,328
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 54,116,864
Number of Sequences: 45328
Number of extensions: 1341318
Number of successful extensions: 3975
Number of sequences better than 1.0e-05: 5
Number of HSP's better than  0.0 without gapping: 3455
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3972
length of database: 21,768,885
effective HSP length: 105
effective length of database: 17,009,445
effective search space used: 4847691825
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)