Animal-Genome cDNA 20060611S-048550


Search to RefSeqSP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611S-048550
         (1120 letters)

Database: RefSeqSP 
           1040 sequences; 434,620 total letters

Searching...done

 ***** No hits found ******

  Database: RefSeqSP
    Posted date:  Aug 1, 2006  7:14 PM
  Number of letters in database: 434,620
  Number of sequences in database:  1040
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 948,137
Number of Sequences: 1040
Number of extensions: 22264
Number of successful extensions: 45
Number of sequences better than 1.0e-05: 0
Number of HSP's better than  0.0 without gapping: 43
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 45
length of database: 434,620
effective HSP length: 78
effective length of database: 353,500
effective search space used: 103929000
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqBP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611S-048550
         (1120 letters)

Database: RefSeqBP 
           33,508 sequences; 16,112,626 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|XP_613987.2| PREDICTED: similar to NADP-dependent malic enzy...   444   e-125
Alignment   gi|XP_604169.2| PREDICTED: similar to malic enzyme 3, NADP(+)-d...   239   4e-63
Alignment   gi|XP_875137.1| PREDICTED: similar to NAD-dependent malic enzym...   165   5e-41
Alignment   gi|XP_584500.2| PREDICTED: similar to NAD-dependent malic enzym...    96   5e-20

>ref|XP_613987.2| PREDICTED: similar to NADP-dependent malic enzyme (NADP-ME) (Malic
           enzyme 1) [Bos taurus]
          Length = 472

 Score =  444 bits (1142), Expect = e-125
 Identities = 224/253 (88%), Positives = 233/253 (92%)
 Frame = +3

Query: 6   KRRCPKEKAIKKIWLVDSKGLIVKGRAALTNXXXXXXXXXXXMKNLEAIVQDIKPTALIG 185
           K    KE+AI+KIWLVDSKGLIVKGRAALT            MKNLEAIVQDIKPTALIG
Sbjct: 220 KEGLSKEQAIEKIWLVDSKGLIVKGRAALTQEKEEFAHEHKEMKNLEAIVQDIKPTALIG 279

Query: 186 VAAIGGAFSEQILKDMAAFNERPIIFALSNPTSKAECTAEQCYTLTQGRAIFASGSPFDP 365
           VAAIGGAFSEQI+KDMAAFNERPIIFALSNPTSKAECTAEQCY LT+GRAIFASGSPFDP
Sbjct: 280 VAAIGGAFSEQIIKDMAAFNERPIIFALSNPTSKAECTAEQCYKLTKGRAIFASGSPFDP 339

Query: 366 VTLPSGQTLYPGQGNNSYVFPGVALGVVACGLRHITDKIFLTTAEVIAQQVSDKHLEEGR 545
           VTLPSG+TLYPGQGNNSYVFPGVALGVVACGLRHITDKIFLTTAEVIAQQVSDKHLEEGR
Sbjct: 340 VTLPSGKTLYPGQGNNSYVFPGVALGVVACGLRHITDKIFLTTAEVIAQQVSDKHLEEGR 399

Query: 546 LYPPLNTIRDVSLKIAEKIVRDAYQEKTATIYPEPSNKEAFVRSQMYSTDYDQILPDGYS 725
           LYPPL+TIRDVSLKIAEKIV+DAYQEKTAT+YPEP NKEAFVRSQMYSTDYDQILPD Y 
Sbjct: 400 LYPPLDTIRDVSLKIAEKIVKDAYQEKTATVYPEPPNKEAFVRSQMYSTDYDQILPDCYP 459

Query: 726 WPEEAQKIQTKLD 764
           WP+EAQKIQTKLD
Sbjct: 460 WPKEAQKIQTKLD 472


>ref|XP_604169.2| PREDICTED: similar to malic enzyme 3, NADP(+)-dependent,
           mitochondrial [Bos taurus]
          Length = 564

 Score =  239 bits (609), Expect = 4e-63
 Identities = 121/187 (64%), Positives = 150/187 (80%)
 Frame = +3

Query: 66  LIVKGRAALTNXXXXXXXXXXXMKNLEAIVQDIKPTALIGVAAIGGAFSEQILKDMAAFN 245
           L ++GR+ L +           + +LE +V+ +KPTA+IGVAAI GAF+EQIL+DMA+F+
Sbjct: 305 LSLQGRSHLNHEKEMFAQDHPEVNSLEEVVRLVKPTAIIGVAAIAGAFTEQILRDMASFH 364

Query: 246 ERPIIFALSNPTSKAECTAEQCYTLTQGRAIFASGSPFDPVTLPSGQTLYPGQGNNSYVF 425
           E PIIFALSNPTSKAECTAE+CY +T+GR IFASGSPF  VTL  G+T +PGQGNN+YVF
Sbjct: 365 EHPIIFALSNPTSKAECTAEKCYRVTEGRGIFASGSPFPSVTLEDGRTFFPGQGNNAYVF 424

Query: 426 PGVALGVVACGLRHITDKIFLTTAEVIAQQVSDKHLEEGRLYPPLNTIRDVSLKIAEKIV 605
           PGVALGV+A G+RHI D+IFL TAE IAQ+VS+ HL +GRLYPPL+TIRDVSL+IA K V
Sbjct: 425 PGVALGVIAGGIRHIPDEIFLLTAEQIAQEVSEHHLSQGRLYPPLSTIRDVSLRIAIK-V 483

Query: 606 RDAYQEK 626
           RD+   K
Sbjct: 484 RDSSPPK 490


>ref|XP_875137.1| PREDICTED: similar to NAD-dependent malic enzyme, mitochondrial
           precursor (NAD-ME) (Malic enzyme 2), partial [Bos
           taurus]
          Length = 152

 Score =  165 bits (418), Expect = 5e-41
 Identities = 73/139 (52%), Positives = 98/139 (70%)
 Frame = +3

Query: 324 QGRAIFASGSPFDPVTLPSGQTLYPGQGNNSYVFPGVALGVVACGLRHITDKIFLTTAEV 503
           QGR +FASGSPF+PV L  GQ   PGQGNN Y+FPGVAL V+ C  RHI+D +FL  A+ 
Sbjct: 6   QGRCLFASGSPFEPVKLSDGQVFTPGQGNNVYIFPGVALAVILCNTRHISDHVFLEAAKA 65

Query: 504 IAQQVSDKHLEEGRLYPPLNTIRDVSLKIAEKIVRDAYQEKTATIYPEPSNKEAFVRSQM 683
           +  Q++DK L +GRLYPPL+ I++VS+ IA K+    Y  K A  YPEP +K  ++R ++
Sbjct: 66  LTSQLTDKELAQGRLYPPLSNIQEVSINIAIKVTEYLYANKMAFRYPEPEDKAKYIRERI 125

Query: 684 YSTDYDQILPDGYSWPEEA 740
           + ++YD +LPD Y WPE A
Sbjct: 126 WRSEYDSLLPDVYEWPEAA 144


>ref|XP_584500.2| PREDICTED: similar to NAD-dependent malic enzyme, mitochondrial
           precursor (NAD-ME) (Malic enzyme 2), partial [Bos
           taurus]
          Length = 513

 Score = 95.9 bits (237), Expect = 5e-20
 Identities = 51/105 (48%), Positives = 65/105 (61%), Gaps = 3/105 (2%)
 Frame = +3

Query: 21  KEKAIKKIWLVDSKGLIVKGRAALTNXXXXXXXXXXXMK---NLEAIVQDIKPTALIGVA 191
           +E+A KKIW+VD  GL+ KGR A                     E  V  +KP+A+IGVA
Sbjct: 409 EEEARKKIWMVDKFGLLFKGRKAKIESHQEAFAHSAPESLPDTFEEAVNILKPSAIIGVA 468

Query: 192 AIGGAFSEQILKDMAAFNERPIIFALSNPTSKAECTAEQCYTLTQ 326
             G  F+  ++K MA  NERPIIFALSNPT++AECTAE+ YTLT+
Sbjct: 469 GAGRLFTPGVIKAMAEINERPIIFALSNPTAQAECTAEEAYTLTE 513


  Database: RefSeqBP
    Posted date:  Aug 1, 2006  7:14 PM
  Number of letters in database: 16,112,626
  Number of sequences in database:  33,508
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 33,978,158
Number of Sequences: 33508
Number of extensions: 785362
Number of successful extensions: 1881
Number of sequences better than 1.0e-05: 4
Number of HSP's better than  0.0 without gapping: 1783
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1880
length of database: 16,112,626
effective HSP length: 103
effective length of database: 12,661,302
effective search space used: 3405890238
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqCP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611S-048550
         (1120 letters)

Database: RefSeqCP 
           33,732 sequences; 19,266,565 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|XP_532217.2| PREDICTED: similar to NADP-dependent malic enzy...   442   e-124
Alignment   gi|XP_542269.2| PREDICTED: similar to malic enzyme 3, NADP(+)-d...   328   6e-90
Alignment   gi|XP_848770.1| PREDICTED: similar to malic enzyme 3, NADP(+)-d...   328   6e-90
Alignment   gi|XP_857227.1| PREDICTED: similar to malic enzyme 3, NADP(+)-d...   311   7e-85
Alignment   gi|XP_857135.1| PREDICTED: similar to malic enzyme 3, NADP(+)-d...   308   8e-84
Alignment   gi|XP_857091.1| PREDICTED: similar to NADP-dependent malic enzy...   298   6e-81
Alignment   gi|XP_857177.1| PREDICTED: similar to malic enzyme 3, NADP(+)-d...   256   4e-68
Alignment   gi|XP_849530.1| PREDICTED: similar to NAD-dependent malic enzym...   251   1e-66
Alignment   gi|XP_533402.2| PREDICTED: similar to NAD-dependent malic enzym...   251   1e-66
Alignment   gi|XP_857051.1| PREDICTED: similar to malic enzyme 3, NADP(+)-d...    59   7e-09

>ref|XP_532217.2| PREDICTED: similar to NADP-dependent malic enzyme (NADP-ME) (Malic
            enzyme 1) [Canis familiaris]
          Length = 634

 Score =  442 bits (1138), Expect = e-124
 Identities = 222/253 (87%), Positives = 231/253 (91%)
 Frame = +3

Query: 6    KRRCPKEKAIKKIWLVDSKGLIVKGRAALTNXXXXXXXXXXXMKNLEAIVQDIKPTALIG 185
            K   PKEKA+K IWLVDSKGLIVKGRAALT            MKNLEAIVQ+IKPTALIG
Sbjct: 381  KEGLPKEKAMKNIWLVDSKGLIVKGRAALTQEKEQFAHEHEEMKNLEAIVQEIKPTALIG 440

Query: 186  VAAIGGAFSEQILKDMAAFNERPIIFALSNPTSKAECTAEQCYTLTQGRAIFASGSPFDP 365
            VAAIGGAFSEQILKDMAAFNERPIIFALSNPTSKAECTAEQCY LT+GRAIFASGSPFDP
Sbjct: 441  VAAIGGAFSEQILKDMAAFNERPIIFALSNPTSKAECTAEQCYKLTKGRAIFASGSPFDP 500

Query: 366  VTLPSGQTLYPGQGNNSYVFPGVALGVVACGLRHITDKIFLTTAEVIAQQVSDKHLEEGR 545
            VTLP+G+TLYPGQGNNSYVFPGVALGVVACGLRHITD IFLTTAE+IAQQVSDKHLEEGR
Sbjct: 501  VTLPNGRTLYPGQGNNSYVFPGVALGVVACGLRHITDNIFLTTAEIIAQQVSDKHLEEGR 560

Query: 546  LYPPLNTIRDVSLKIAEKIVRDAYQEKTATIYPEPSNKEAFVRSQMYSTDYDQILPDGYS 725
            LYPPL+TIRDVSLKIA KIV+DAYQEKTAT+YPEP NKEAFVRSQMY TDYDQILPD YS
Sbjct: 561  LYPPLDTIRDVSLKIAAKIVKDAYQEKTATVYPEPPNKEAFVRSQMYDTDYDQILPDCYS 620

Query: 726  WPEEAQKIQTKLD 764
            WPEEAQKIQTKLD
Sbjct: 621  WPEEAQKIQTKLD 633


>ref|XP_542269.2| PREDICTED: similar to malic enzyme 3, NADP(+)-dependent,
            mitochondrial isoform 1 [Canis familiaris]
          Length = 569

 Score =  328 bits (841), Expect = 6e-90
 Identities = 160/250 (64%), Positives = 199/250 (79%)
 Frame = +3

Query: 6    KRRCPKEKAIKKIWLVDSKGLIVKGRAALTNXXXXXXXXXXXMKNLEAIVQDIKPTALIG 185
            K   PK +A +KIW+VDSKGLIVKGR+ L +           +K+LE +V+ +KPTA+IG
Sbjct: 319  KEGVPKAEATRKIWMVDSKGLIVKGRSHLNHEKEMFAQDHPEVKSLEEVVRLVKPTAIIG 378

Query: 186  VAAIGGAFSEQILKDMAAFNERPIIFALSNPTSKAECTAEQCYTLTQGRAIFASGSPFDP 365
            VAAI GAF+EQIL+DMA+F+ERPIIFALSNPTSKAECTAE+CY +T+GR IFASGSPF  
Sbjct: 379  VAAIAGAFTEQILRDMASFHERPIIFALSNPTSKAECTAEKCYRVTEGRGIFASGSPFKS 438

Query: 366  VTLPSGQTLYPGQGNNSYVFPGVALGVVACGLRHITDKIFLTTAEVIAQQVSDKHLEEGR 545
            VTL  G+T  PGQGNN+YVFPGVALGV+A G+RHI D+IFL TAE IAQ+VS++HL +GR
Sbjct: 439  VTLEDGRTFIPGQGNNAYVFPGVALGVIAGGIRHIPDEIFLLTAEQIAQEVSEQHLSQGR 498

Query: 546  LYPPLNTIRDVSLKIAEKIVRDAYQEKTATIYPEPSNKEAFVRSQMYSTDYDQILPDGYS 725
            LYPPL+TIRDVSL+IA K++  AY+   A+ YPEP +KEAFVRS +Y+ DYD    D Y+
Sbjct: 499  LYPPLSTIRDVSLRIAIKVLDFAYKHNLASYYPEPKDKEAFVRSLVYTPDYDSFTLDSYT 558

Query: 726  WPEEAQKIQT 755
            WP+EA  +QT
Sbjct: 559  WPKEAMNVQT 568


>ref|XP_848770.1| PREDICTED: similar to malic enzyme 3, NADP(+)-dependent,
            mitochondrial isoform 2 [Canis familiaris]
          Length = 604

 Score =  328 bits (841), Expect = 6e-90
 Identities = 160/250 (64%), Positives = 199/250 (79%)
 Frame = +3

Query: 6    KRRCPKEKAIKKIWLVDSKGLIVKGRAALTNXXXXXXXXXXXMKNLEAIVQDIKPTALIG 185
            K   PK +A +KIW+VDSKGLIVKGR+ L +           +K+LE +V+ +KPTA+IG
Sbjct: 354  KEGVPKAEATRKIWMVDSKGLIVKGRSHLNHEKEMFAQDHPEVKSLEEVVRLVKPTAIIG 413

Query: 186  VAAIGGAFSEQILKDMAAFNERPIIFALSNPTSKAECTAEQCYTLTQGRAIFASGSPFDP 365
            VAAI GAF+EQIL+DMA+F+ERPIIFALSNPTSKAECTAE+CY +T+GR IFASGSPF  
Sbjct: 414  VAAIAGAFTEQILRDMASFHERPIIFALSNPTSKAECTAEKCYRVTEGRGIFASGSPFKS 473

Query: 366  VTLPSGQTLYPGQGNNSYVFPGVALGVVACGLRHITDKIFLTTAEVIAQQVSDKHLEEGR 545
            VTL  G+T  PGQGNN+YVFPGVALGV+A G+RHI D+IFL TAE IAQ+VS++HL +GR
Sbjct: 474  VTLEDGRTFIPGQGNNAYVFPGVALGVIAGGIRHIPDEIFLLTAEQIAQEVSEQHLSQGR 533

Query: 546  LYPPLNTIRDVSLKIAEKIVRDAYQEKTATIYPEPSNKEAFVRSQMYSTDYDQILPDGYS 725
            LYPPL+TIRDVSL+IA K++  AY+   A+ YPEP +KEAFVRS +Y+ DYD    D Y+
Sbjct: 534  LYPPLSTIRDVSLRIAIKVLDFAYKHNLASYYPEPKDKEAFVRSLVYTPDYDSFTLDSYT 593

Query: 726  WPEEAQKIQT 755
            WP+EA  +QT
Sbjct: 594  WPKEAMNVQT 603


>ref|XP_857227.1| PREDICTED: similar to malic enzyme 3, NADP(+)-dependent,
            mitochondrial isoform 7 [Canis familiaris]
          Length = 562

 Score =  311 bits (797), Expect = 7e-85
 Identities = 158/270 (58%), Positives = 198/270 (73%), Gaps = 20/270 (7%)
 Frame = +3

Query: 6    KRRCPKEKAIKKIWLVDSKGLIVKGRAA--------------------LTNXXXXXXXXX 125
            K   PK +A +KIW+VDSKGLIVK  ++                    L +         
Sbjct: 292  KEGVPKAEATRKIWMVDSKGLIVKVLSSSYQCLACNECVIMPADPKDHLNHEKEMFAQDH 351

Query: 126  XXMKNLEAIVQDIKPTALIGVAAIGGAFSEQILKDMAAFNERPIIFALSNPTSKAECTAE 305
              +K+LE +V+ +KPTA+IGVAAI GAF+EQIL+DMA+F+ERPIIFALSNPTSKAECTAE
Sbjct: 352  PEVKSLEEVVRLVKPTAIIGVAAIAGAFTEQILRDMASFHERPIIFALSNPTSKAECTAE 411

Query: 306  QCYTLTQGRAIFASGSPFDPVTLPSGQTLYPGQGNNSYVFPGVALGVVACGLRHITDKIF 485
            +CY +T+GR IFASGSPF  VTL  G+T  PGQGNN+YVFPGVALGV+A G+RHI D+IF
Sbjct: 412  KCYRVTEGRGIFASGSPFKSVTLEDGRTFIPGQGNNAYVFPGVALGVIAGGIRHIPDEIF 471

Query: 486  LTTAEVIAQQVSDKHLEEGRLYPPLNTIRDVSLKIAEKIVRDAYQEKTATIYPEPSNKEA 665
            L TAE IAQ+VS++HL +GRLYPPL+TIRDVSL+IA K++  AY+   A+ YPEP +KEA
Sbjct: 472  LLTAEQIAQEVSEQHLSQGRLYPPLSTIRDVSLRIAIKVLDFAYKHNLASYYPEPKDKEA 531

Query: 666  FVRSQMYSTDYDQILPDGYSWPEEAQKIQT 755
            FVRS +Y+ DYD    D Y+WP+EA  +QT
Sbjct: 532  FVRSLVYTPDYDSFTLDSYTWPKEAMNVQT 561


>ref|XP_857135.1| PREDICTED: similar to malic enzyme 3, NADP(+)-dependent,
            mitochondrial isoform 5 [Canis familiaris]
          Length = 573

 Score =  308 bits (788), Expect = 8e-84
 Identities = 160/281 (56%), Positives = 199/281 (70%), Gaps = 31/281 (11%)
 Frame = +3

Query: 6    KRRCPKEKAIKKIWLVDSKGLIVK---GRAALTNXXXXXXXXXXXMKNLEAIVQDIKPTA 176
            K   PK +A +KIW+VDSKGLIVK   GR+ L +           +K+LE +V+ +KPTA
Sbjct: 292  KEGVPKAEATRKIWMVDSKGLIVKVLSGRSHLNHEKEMFAQDHPEVKSLEEVVRLVKPTA 351

Query: 177  LIGVAAIGGAFSEQILKDMAAFNERPIIFALSNPTSKAECTAEQCYTLTQ---------- 326
            +IGVAAI GAF+EQIL+DMA+F+ERPIIFALSNPTSKAECTAE+CY +T+          
Sbjct: 352  IIGVAAIAGAFTEQILRDMASFHERPIIFALSNPTSKAECTAEKCYRVTEVSGESFLPQA 411

Query: 327  ------------------GRAIFASGSPFDPVTLPSGQTLYPGQGNNSYVFPGVALGVVA 452
                              GR IFASGSPF  VTL  G+T  PGQGNN+YVFPGVALGV+A
Sbjct: 412  ERTYPSSYHHVILFRVPLGRGIFASGSPFKSVTLEDGRTFIPGQGNNAYVFPGVALGVIA 471

Query: 453  CGLRHITDKIFLTTAEVIAQQVSDKHLEEGRLYPPLNTIRDVSLKIAEKIVRDAYQEKTA 632
             G+RHI D+IFL TAE IAQ+VS++HL +GRLYPPL+TIRDVSL+IA K++  AY+   A
Sbjct: 472  GGIRHIPDEIFLLTAEQIAQEVSEQHLSQGRLYPPLSTIRDVSLRIAIKVLDFAYKHNLA 531

Query: 633  TIYPEPSNKEAFVRSQMYSTDYDQILPDGYSWPEEAQKIQT 755
            + YPEP +KEAFVRS +Y+ DYD    D Y+WP+EA  +QT
Sbjct: 532  SYYPEPKDKEAFVRSLVYTPDYDSFTLDSYTWPKEAMNVQT 572


>ref|XP_857091.1| PREDICTED: similar to NADP-dependent malic enzyme, mitochondrial
           precursor (NADP-ME) (Malic enzyme 3) isoform 4 [Canis
           familiaris]
          Length = 231

 Score =  298 bits (763), Expect = 6e-81
 Identities = 145/227 (63%), Positives = 181/227 (79%)
 Frame = +3

Query: 75  KGRAALTNXXXXXXXXXXXMKNLEAIVQDIKPTALIGVAAIGGAFSEQILKDMAAFNERP 254
           KGR+ L +           +K+LE +V+ +KPTA+IGVAAI GAF+EQIL+DMA+F+ERP
Sbjct: 4   KGRSHLNHEKEMFAQDHPEVKSLEEVVRLVKPTAIIGVAAIAGAFTEQILRDMASFHERP 63

Query: 255 IIFALSNPTSKAECTAEQCYTLTQGRAIFASGSPFDPVTLPSGQTLYPGQGNNSYVFPGV 434
           IIFALSNPTSKAECTAE+CY +T+GR IFASGSPF  VTL  G+T  PGQGNN+YVFPGV
Sbjct: 64  IIFALSNPTSKAECTAEKCYRVTEGRGIFASGSPFKSVTLEDGRTFIPGQGNNAYVFPGV 123

Query: 435 ALGVVACGLRHITDKIFLTTAEVIAQQVSDKHLEEGRLYPPLNTIRDVSLKIAEKIVRDA 614
           ALGV+A G+RHI D+IFL TAE IAQ+VS++HL +GRLYPPL+TIRDVSL+IA K++  A
Sbjct: 124 ALGVIAGGIRHIPDEIFLLTAEQIAQEVSEQHLSQGRLYPPLSTIRDVSLRIAIKVLDFA 183

Query: 615 YQEKTATIYPEPSNKEAFVRSQMYSTDYDQILPDGYSWPEEAQKIQT 755
           Y+   A+ YPEP +KEAFVRS +Y+ DYD    D Y+WP+EA  +QT
Sbjct: 184 YKHNLASYYPEPKDKEAFVRSLVYTPDYDSFTLDSYTWPKEAMNVQT 230


>ref|XP_857177.1| PREDICTED: similar to malic enzyme 3, NADP(+)-dependent,
           mitochondrial isoform 6 [Canis familiaris]
          Length = 513

 Score =  256 bits (653), Expect = 4e-68
 Identities = 131/250 (52%), Positives = 167/250 (66%)
 Frame = +3

Query: 6   KRRCPKEKAIKKIWLVDSKGLIVKGRAALTNXXXXXXXXXXXMKNLEAIVQDIKPTALIG 185
           K   PK +A +KIW+VDSKGLIVKGR+ L +           +K+LE +V+ +KPTA+IG
Sbjct: 292 KEGVPKAEATRKIWMVDSKGLIVKGRSHLNHEKEMFAQDHPEVKSLEEVVRLVKPTAIIG 351

Query: 186 VAAIGGAFSEQILKDMAAFNERPIIFALSNPTSKAECTAEQCYTLTQGRAIFASGSPFDP 365
                                            +AECTAE+CY +T+GR IFASGSPF  
Sbjct: 352 -----------------------------RRRQEAECTAEKCYRVTEGRGIFASGSPFKS 382

Query: 366 VTLPSGQTLYPGQGNNSYVFPGVALGVVACGLRHITDKIFLTTAEVIAQQVSDKHLEEGR 545
           VTL  G+T  PGQGNN+YVFPGVALGV+A G+RHI D+IFL TAE IAQ+VS++HL +GR
Sbjct: 383 VTLEDGRTFIPGQGNNAYVFPGVALGVIAGGIRHIPDEIFLLTAEQIAQEVSEQHLSQGR 442

Query: 546 LYPPLNTIRDVSLKIAEKIVRDAYQEKTATIYPEPSNKEAFVRSQMYSTDYDQILPDGYS 725
           LYPPL+TIRDVSL+IA K++  AY+   A+ YPEP +KEAFVRS +Y+ DYD    D Y+
Sbjct: 443 LYPPLSTIRDVSLRIAIKVLDFAYKHNLASYYPEPKDKEAFVRSLVYTPDYDSFTLDSYT 502

Query: 726 WPEEAQKIQT 755
           WP+EA  +QT
Sbjct: 503 WPKEAMNVQT 512


>ref|XP_849530.1| PREDICTED: similar to NAD-dependent malic enzyme, mitochondrial
            precursor (NAD-ME) (Malic enzyme 2) isoform 2 [Canis
            familiaris]
          Length = 584

 Score =  251 bits (640), Expect = 1e-66
 Identities = 123/243 (50%), Positives = 164/243 (67%), Gaps = 3/243 (1%)
 Frame = +3

Query: 21   KEKAIKKIWLVDSKGLIVKGRAA-LTNXXXXXXXXXXXM--KNLEAIVQDIKPTALIGVA 191
            +E+A KKIW+VD  GL+ KGR A + N           +     E  V  ++P+A+IGVA
Sbjct: 334  EEEAQKKIWMVDKFGLLFKGRKAKIENHQEPFAHSAPGIIPDTFEDAVNILRPSAIIGVA 393

Query: 192  AIGGAFSEQILKDMAAFNERPIIFALSNPTSKAECTAEQCYTLTQGRAIFASGSPFDPVT 371
              G  F+  ++K MA  NERP+IFALSNPT+ AECTAE+ YTLT+GR +FASGSPF+PV 
Sbjct: 394  GAGRLFTPGVIKAMADINERPVIFALSNPTAMAECTAEEAYTLTEGRCLFASGSPFEPVK 453

Query: 372  LPSGQTLYPGQGNNSYVFPGVALGVVACGLRHITDKIFLTTAEVIAQQVSDKHLEEGRLY 551
            L  GQ   PGQGNN Y+FPGVAL V+ C  RHI+D +FL  A+ +A Q++DK L +GRLY
Sbjct: 454  LSDGQLFTPGQGNNVYIFPGVALAVILCNTRHISDHVFLEAAKALANQLTDKELAQGRLY 513

Query: 552  PPLNTIRDVSLKIAEKIVRDAYQEKTATIYPEPSNKEAFVRSQMYSTDYDQILPDGYSWP 731
            PPL  I++VS+ IA K+    Y  K A  YPEP +K  ++R +++ ++YD +LPD Y WP
Sbjct: 514  PPLADIQEVSINIAIKVTEYLYANKMAFRYPEPEDKAKYIRERIWRSEYDSLLPDVYDWP 573

Query: 732  EEA 740
            E A
Sbjct: 574  ESA 576


>ref|XP_533402.2| PREDICTED: similar to NAD-dependent malic enzyme, mitochondrial
           precursor (NAD-ME) (Malic enzyme 2) isoform 1 [Canis
           familiaris]
          Length = 499

 Score =  251 bits (640), Expect = 1e-66
 Identities = 123/243 (50%), Positives = 164/243 (67%), Gaps = 3/243 (1%)
 Frame = +3

Query: 21  KEKAIKKIWLVDSKGLIVKGRAA-LTNXXXXXXXXXXXM--KNLEAIVQDIKPTALIGVA 191
           +E+A KKIW+VD  GL+ KGR A + N           +     E  V  ++P+A+IGVA
Sbjct: 249 EEEAQKKIWMVDKFGLLFKGRKAKIENHQEPFAHSAPGIIPDTFEDAVNILRPSAIIGVA 308

Query: 192 AIGGAFSEQILKDMAAFNERPIIFALSNPTSKAECTAEQCYTLTQGRAIFASGSPFDPVT 371
             G  F+  ++K MA  NERP+IFALSNPT+ AECTAE+ YTLT+GR +FASGSPF+PV 
Sbjct: 309 GAGRLFTPGVIKAMADINERPVIFALSNPTAMAECTAEEAYTLTEGRCLFASGSPFEPVK 368

Query: 372 LPSGQTLYPGQGNNSYVFPGVALGVVACGLRHITDKIFLTTAEVIAQQVSDKHLEEGRLY 551
           L  GQ   PGQGNN Y+FPGVAL V+ C  RHI+D +FL  A+ +A Q++DK L +GRLY
Sbjct: 369 LSDGQLFTPGQGNNVYIFPGVALAVILCNTRHISDHVFLEAAKALANQLTDKELAQGRLY 428

Query: 552 PPLNTIRDVSLKIAEKIVRDAYQEKTATIYPEPSNKEAFVRSQMYSTDYDQILPDGYSWP 731
           PPL  I++VS+ IA K+    Y  K A  YPEP +K  ++R +++ ++YD +LPD Y WP
Sbjct: 429 PPLADIQEVSINIAIKVTEYLYANKMAFRYPEPEDKAKYIRERIWRSEYDSLLPDVYDWP 488

Query: 732 EEA 740
           E A
Sbjct: 489 ESA 491


>ref|XP_857051.1| PREDICTED: similar to malic enzyme 3, NADP(+)-dependent,
           mitochondrial isoform 3 [Canis familiaris]
          Length = 361

 Score = 59.3 bits (142), Expect = 7e-09
 Identities = 29/60 (48%), Positives = 40/60 (66%)
 Frame = +3

Query: 6   KRRCPKEKAIKKIWLVDSKGLIVKGRAALTNXXXXXXXXXXXMKNLEAIVQDIKPTALIG 185
           K   PK +A +KIW+VDSKGLIVKGR+ L +           +K+LE +V+ +KPTA+IG
Sbjct: 292 KEGVPKAEATRKIWMVDSKGLIVKGRSHLNHEKEMFAQDHPEVKSLEEVVRLVKPTAIIG 351


  Database: RefSeqCP
    Posted date:  Aug 1, 2006  9:25 PM
  Number of letters in database: 19,266,565
  Number of sequences in database:  33,732
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 39,929,979
Number of Sequences: 33732
Number of extensions: 921441
Number of successful extensions: 2219
Number of sequences better than 1.0e-05: 10
Number of HSP's better than  0.0 without gapping: 2060
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2214
length of database: 19,266,565
effective HSP length: 104
effective length of database: 15,758,437
effective search space used: 4223261116
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqHP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611S-048550
         (1120 letters)

Database: RefSeqHP 
           39,411 sequences; 17,774,539 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_002386.1| cytosolic malic enzyme 1 [Homo sapiens]              444   e-125
Alignment   gi|NP_001014811.1| malic enzyme 3, NADP(+)-dependent, mitochond...   326   2e-89
Alignment   gi|NP_006671.2| malic enzyme 3, NADP(+)-dependent, mitochondria...   326   2e-89
Alignment   gi|NP_002387.1| malic enzyme 2, NAD(+)-dependent, mitochondrial...   246   3e-65

>ref|NP_002386.1| cytosolic malic enzyme 1 [Homo sapiens]
          Length = 572

 Score =  444 bits (1143), Expect = e-125
 Identities = 223/253 (88%), Positives = 232/253 (91%)
 Frame = +3

Query: 6    KRRCPKEKAIKKIWLVDSKGLIVKGRAALTNXXXXXXXXXXXMKNLEAIVQDIKPTALIG 185
            K   PKEKAIKKIWLVDSKGLIVKGRA+LT            MKNLEAIVQ+IKPTALIG
Sbjct: 319  KEGLPKEKAIKKIWLVDSKGLIVKGRASLTQEKEKFAHEHEEMKNLEAIVQEIKPTALIG 378

Query: 186  VAAIGGAFSEQILKDMAAFNERPIIFALSNPTSKAECTAEQCYTLTQGRAIFASGSPFDP 365
            VAAIGGAFSEQILKDMAAFNERPIIFALSNPTSKAEC+AEQCY +T+GRAIFASGSPFDP
Sbjct: 379  VAAIGGAFSEQILKDMAAFNERPIIFALSNPTSKAECSAEQCYKITKGRAIFASGSPFDP 438

Query: 366  VTLPSGQTLYPGQGNNSYVFPGVALGVVACGLRHITDKIFLTTAEVIAQQVSDKHLEEGR 545
            VTLP+GQTLYPGQGNNSYVFPGVALGVVACGLR ITD IFLTTAEVIAQQVSDKHLEEGR
Sbjct: 439  VTLPNGQTLYPGQGNNSYVFPGVALGVVACGLRQITDNIFLTTAEVIAQQVSDKHLEEGR 498

Query: 546  LYPPLNTIRDVSLKIAEKIVRDAYQEKTATIYPEPSNKEAFVRSQMYSTDYDQILPDGYS 725
            LYPPLNTIRDVSLKIAEKIV+DAYQEKTAT+YPEP NKEAFVRSQMYSTDYDQILPD YS
Sbjct: 499  LYPPLNTIRDVSLKIAEKIVKDAYQEKTATVYPEPQNKEAFVRSQMYSTDYDQILPDCYS 558

Query: 726  WPEEAQKIQTKLD 764
            WPEE QKIQTK+D
Sbjct: 559  WPEEVQKIQTKVD 571


>ref|NP_001014811.1| malic enzyme 3, NADP(+)-dependent, mitochondrial [Homo sapiens]
          Length = 604

 Score =  326 bits (836), Expect = 2e-89
 Identities = 159/250 (63%), Positives = 198/250 (79%)
 Frame = +3

Query: 6    KRRCPKEKAIKKIWLVDSKGLIVKGRAALTNXXXXXXXXXXXMKNLEAIVQDIKPTALIG 185
            K   PK +A +KIW+VDSKGLIVKGR+ L +           + +LE +V+ +KPTA+IG
Sbjct: 354  KEGVPKAEATRKIWMVDSKGLIVKGRSHLNHEKEMFAQDHPEVNSLEEVVRLVKPTAIIG 413

Query: 186  VAAIGGAFSEQILKDMAAFNERPIIFALSNPTSKAECTAEQCYTLTQGRAIFASGSPFDP 365
            VAAI GAF+EQIL+DMA+F+ERPIIFALSNPTSKAECTAE+CY +T+GR IFASGSPF  
Sbjct: 414  VAAIAGAFTEQILRDMASFHERPIIFALSNPTSKAECTAEKCYRVTEGRGIFASGSPFKS 473

Query: 366  VTLPSGQTLYPGQGNNSYVFPGVALGVVACGLRHITDKIFLTTAEVIAQQVSDKHLEEGR 545
            VTL  G+T  PGQGNN+YVFPGVALGV+A G+RHI D+IFL TAE IAQ+VS++HL +GR
Sbjct: 474  VTLEDGKTFIPGQGNNAYVFPGVALGVIAGGIRHIPDEIFLLTAEQIAQEVSEQHLSQGR 533

Query: 546  LYPPLNTIRDVSLKIAEKIVRDAYQEKTATIYPEPSNKEAFVRSQMYSTDYDQILPDGYS 725
            LYPPL+TIRDVSL+IA K++  AY+   A+ YPEP +KEAFVRS +Y+ DYD    D Y+
Sbjct: 534  LYPPLSTIRDVSLRIAIKVLDYAYKHNLASYYPEPKDKEAFVRSLVYTPDYDSFTLDSYT 593

Query: 726  WPEEAQKIQT 755
            WP+EA  +QT
Sbjct: 594  WPKEAMNVQT 603


>ref|NP_006671.2| malic enzyme 3, NADP(+)-dependent, mitochondrial [Homo sapiens]
          Length = 604

 Score =  326 bits (836), Expect = 2e-89
 Identities = 159/250 (63%), Positives = 198/250 (79%)
 Frame = +3

Query: 6    KRRCPKEKAIKKIWLVDSKGLIVKGRAALTNXXXXXXXXXXXMKNLEAIVQDIKPTALIG 185
            K   PK +A +KIW+VDSKGLIVKGR+ L +           + +LE +V+ +KPTA+IG
Sbjct: 354  KEGVPKAEATRKIWMVDSKGLIVKGRSHLNHEKEMFAQDHPEVNSLEEVVRLVKPTAIIG 413

Query: 186  VAAIGGAFSEQILKDMAAFNERPIIFALSNPTSKAECTAEQCYTLTQGRAIFASGSPFDP 365
            VAAI GAF+EQIL+DMA+F+ERPIIFALSNPTSKAECTAE+CY +T+GR IFASGSPF  
Sbjct: 414  VAAIAGAFTEQILRDMASFHERPIIFALSNPTSKAECTAEKCYRVTEGRGIFASGSPFKS 473

Query: 366  VTLPSGQTLYPGQGNNSYVFPGVALGVVACGLRHITDKIFLTTAEVIAQQVSDKHLEEGR 545
            VTL  G+T  PGQGNN+YVFPGVALGV+A G+RHI D+IFL TAE IAQ+VS++HL +GR
Sbjct: 474  VTLEDGKTFIPGQGNNAYVFPGVALGVIAGGIRHIPDEIFLLTAEQIAQEVSEQHLSQGR 533

Query: 546  LYPPLNTIRDVSLKIAEKIVRDAYQEKTATIYPEPSNKEAFVRSQMYSTDYDQILPDGYS 725
            LYPPL+TIRDVSL+IA K++  AY+   A+ YPEP +KEAFVRS +Y+ DYD    D Y+
Sbjct: 534  LYPPLSTIRDVSLRIAIKVLDYAYKHNLASYYPEPKDKEAFVRSLVYTPDYDSFTLDSYT 593

Query: 726  WPEEAQKIQT 755
            WP+EA  +QT
Sbjct: 594  WPKEAMNVQT 603


>ref|NP_002387.1| malic enzyme 2, NAD(+)-dependent, mitochondrial [Homo sapiens]
          Length = 584

 Score =  246 bits (627), Expect = 3e-65
 Identities = 117/243 (48%), Positives = 160/243 (65%), Gaps = 3/243 (1%)
 Frame = +3

Query: 21   KEKAIKKIWLVDSKGLIVKGRAALTNXXX---XXXXXXXXMKNLEAIVQDIKPTALIGVA 191
            +++A KKIW+ D  GL+VKGR A  +                  E  V  +KP+ +IGVA
Sbjct: 334  EQEAQKKIWMFDKYGLLVKGRKAKIDSYQEPFTHSAPESIPDTFEDAVNILKPSTIIGVA 393

Query: 192  AIGGAFSEQILKDMAAFNERPIIFALSNPTSKAECTAEQCYTLTQGRAIFASGSPFDPVT 371
              G  F+  +++ MA+ NERP+IFALSNPT++AECTAE+ YTLT+GR +FASGSPF PV 
Sbjct: 394  GAGRLFTPDVIRAMASINERPVIFALSNPTAQAECTAEEAYTLTEGRCLFASGSPFGPVK 453

Query: 372  LPSGQTLYPGQGNNSYVFPGVALGVVACGLRHITDKIFLTTAEVIAQQVSDKHLEEGRLY 551
            L  G+   PGQGNN Y+FPGVAL V+ C  RHI+D +FL  A+ +  Q++D+ L +GRLY
Sbjct: 454  LTDGRVFTPGQGNNVYIFPGVALAVILCNTRHISDSVFLEAAKALTSQLTDEELAQGRLY 513

Query: 552  PPLNTIRDVSLKIAEKIVRDAYQEKTATIYPEPSNKEAFVRSQMYSTDYDQILPDGYSWP 731
            PPL  I++VS+ IA K+    Y  K A  YPEP +K  +V+ + + ++YD +LPD Y WP
Sbjct: 514  PPLANIQEVSINIAIKVTEYLYANKMAFRYPEPEDKAKYVKERTWRSEYDSLLPDVYEWP 573

Query: 732  EEA 740
            E A
Sbjct: 574  ESA 576


  Database: RefSeqHP
    Posted date:  Aug 2, 2006 12:57 AM
  Number of letters in database: 17,774,539
  Number of sequences in database:  39,411
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 37,990,044
Number of Sequences: 39411
Number of extensions: 893197
Number of successful extensions: 2217
Number of sequences better than 1.0e-05: 4
Number of HSP's better than  0.0 without gapping: 2026
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2216
length of database: 17,774,539
effective HSP length: 103
effective length of database: 13,715,206
effective search space used: 3689390414
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqMP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611S-048550
         (1120 letters)

Database: RefSeqMP 
           45,328 sequences; 21,768,885 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|XP_001004682.1| PREDICTED: similar to NADP-dependent malic e...   411   e-115
Alignment   gi|XP_001004683.1| PREDICTED: similar to NADP-dependent malic e...   411   e-115
Alignment   gi|XP_001004685.1| PREDICTED: similar to NADP-dependent malic e...   411   e-115
Alignment   gi|NP_032641.1| malic enzyme, supernatant [Mus musculus]             402   e-112
Alignment   gi|XP_001004679.1| PREDICTED: similar to NADP-dependent malic e...   389   e-108
Alignment   gi|NP_852072.1| malic enzyme 3, NADP(+)-dependent, mitochondria...   326   3e-89
Alignment   gi|NP_663469.1| malic enzyme 2, NAD(+)-dependent, mitochondrial...   240   2e-63
Alignment   gi|XP_001004303.1| PREDICTED: similar to NADP-dependent malic e...   117   3e-26

>ref|XP_001004682.1| PREDICTED: similar to NADP-dependent malic enzyme (NADP-ME) (Malic
           enzyme 1) isoform 2 [Mus musculus]
          Length = 258

 Score =  411 bits (1057), Expect = e-115
 Identities = 206/253 (81%), Positives = 222/253 (87%)
 Frame = +3

Query: 6   KRRCPKEKAIKKIWLVDSKGLIVKGRAALTNXXXXXXXXXXXMKNLEAIVQDIKPTALIG 185
           K    KE A KKIWLVDSKGLIVKGRA+LT            MKNLEAIVQ IKPTALIG
Sbjct: 5   KEGLSKENARKKIWLVDSKGLIVKGRASLTEEKEVFAHEHEEMKNLEAIVQKIKPTALIG 64

Query: 186 VAAIGGAFSEQILKDMAAFNERPIIFALSNPTSKAECTAEQCYTLTQGRAIFASGSPFDP 365
           VAAIGGAF+EQILKDMAAFNERPIIFALSNPTSKAEC+AEQCY +T+GRAIFASGSPFDP
Sbjct: 65  VAAIGGAFTEQILKDMAAFNERPIIFALSNPTSKAECSAEQCYKVTKGRAIFASGSPFDP 124

Query: 366 VTLPSGQTLYPGQGNNSYVFPGVALGVVACGLRHITDKIFLTTAEVIAQQVSDKHLEEGR 545
           VTLP G+TL+PGQGNNSYVFPGVALGVVACGLRHI DK+FLTTAEVI+QQVSDKHL+EGR
Sbjct: 125 VTLPDGRTLFPGQGNNSYVFPGVALGVVACGLRHIDDKVFLTTAEVISQQVSDKHLQEGR 184

Query: 546 LYPPLNTIRDVSLKIAEKIVRDAYQEKTATIYPEPSNKEAFVRSQMYSTDYDQILPDGYS 725
           LYPPLNTIRDVSLKIA KIV+DAY+EK AT+YPEP NKE FV SQMYST+YDQILPD Y 
Sbjct: 185 LYPPLNTIRDVSLKIAVKIVQDAYKEKMATVYPEPQNKEEFVSSQMYSTNYDQILPDCYP 244

Query: 726 WPEEAQKIQTKLD 764
           WP E QKIQTK++
Sbjct: 245 WPAEVQKIQTKVN 257


>ref|XP_001004683.1| PREDICTED: similar to NADP-dependent malic enzyme (NADP-ME) (Malic
           enzyme 1) isoform 3 [Mus musculus]
          Length = 406

 Score =  411 bits (1057), Expect = e-115
 Identities = 206/253 (81%), Positives = 222/253 (87%)
 Frame = +3

Query: 6   KRRCPKEKAIKKIWLVDSKGLIVKGRAALTNXXXXXXXXXXXMKNLEAIVQDIKPTALIG 185
           K    KE A KKIWLVDSKGLIVKGRA+LT            MKNLEAIVQ IKPTALIG
Sbjct: 153 KEGLSKENARKKIWLVDSKGLIVKGRASLTEEKEVFAHEHEEMKNLEAIVQKIKPTALIG 212

Query: 186 VAAIGGAFSEQILKDMAAFNERPIIFALSNPTSKAECTAEQCYTLTQGRAIFASGSPFDP 365
           VAAIGGAF+EQILKDMAAFNERPIIFALSNPTSKAEC+AEQCY +T+GRAIFASGSPFDP
Sbjct: 213 VAAIGGAFTEQILKDMAAFNERPIIFALSNPTSKAECSAEQCYKVTKGRAIFASGSPFDP 272

Query: 366 VTLPSGQTLYPGQGNNSYVFPGVALGVVACGLRHITDKIFLTTAEVIAQQVSDKHLEEGR 545
           VTLP G+TL+PGQGNNSYVFPGVALGVVACGLRHI DK+FLTTAEVI+QQVSDKHL+EGR
Sbjct: 273 VTLPDGRTLFPGQGNNSYVFPGVALGVVACGLRHIDDKVFLTTAEVISQQVSDKHLQEGR 332

Query: 546 LYPPLNTIRDVSLKIAEKIVRDAYQEKTATIYPEPSNKEAFVRSQMYSTDYDQILPDGYS 725
           LYPPLNTIRDVSLKIA KIV+DAY+EK AT+YPEP NKE FV SQMYST+YDQILPD Y 
Sbjct: 333 LYPPLNTIRDVSLKIAVKIVQDAYKEKMATVYPEPQNKEEFVSSQMYSTNYDQILPDCYP 392

Query: 726 WPEEAQKIQTKLD 764
           WP E QKIQTK++
Sbjct: 393 WPAEVQKIQTKVN 405


>ref|XP_001004685.1| PREDICTED: similar to NADP-dependent malic enzyme (NADP-ME) (Malic
            enzyme 1) isoform 4 [Mus musculus]
          Length = 552

 Score =  411 bits (1057), Expect = e-115
 Identities = 206/253 (81%), Positives = 222/253 (87%)
 Frame = +3

Query: 6    KRRCPKEKAIKKIWLVDSKGLIVKGRAALTNXXXXXXXXXXXMKNLEAIVQDIKPTALIG 185
            K    KE A KKIWLVDSKGLIVKGRA+LT            MKNLEAIVQ IKPTALIG
Sbjct: 299  KEGLSKENARKKIWLVDSKGLIVKGRASLTEEKEVFAHEHEEMKNLEAIVQKIKPTALIG 358

Query: 186  VAAIGGAFSEQILKDMAAFNERPIIFALSNPTSKAECTAEQCYTLTQGRAIFASGSPFDP 365
            VAAIGGAF+EQILKDMAAFNERPIIFALSNPTSKAEC+AEQCY +T+GRAIFASGSPFDP
Sbjct: 359  VAAIGGAFTEQILKDMAAFNERPIIFALSNPTSKAECSAEQCYKVTKGRAIFASGSPFDP 418

Query: 366  VTLPSGQTLYPGQGNNSYVFPGVALGVVACGLRHITDKIFLTTAEVIAQQVSDKHLEEGR 545
            VTLP G+TL+PGQGNNSYVFPGVALGVVACGLRHI DK+FLTTAEVI+QQVSDKHL+EGR
Sbjct: 419  VTLPDGRTLFPGQGNNSYVFPGVALGVVACGLRHIDDKVFLTTAEVISQQVSDKHLQEGR 478

Query: 546  LYPPLNTIRDVSLKIAEKIVRDAYQEKTATIYPEPSNKEAFVRSQMYSTDYDQILPDGYS 725
            LYPPLNTIRDVSLKIA KIV+DAY+EK AT+YPEP NKE FV SQMYST+YDQILPD Y 
Sbjct: 479  LYPPLNTIRDVSLKIAVKIVQDAYKEKMATVYPEPQNKEEFVSSQMYSTNYDQILPDCYP 538

Query: 726  WPEEAQKIQTKLD 764
            WP E QKIQTK++
Sbjct: 539  WPAEVQKIQTKVN 551


>ref|NP_032641.1| malic enzyme, supernatant [Mus musculus]
          Length = 572

 Score =  402 bits (1034), Expect = e-112
 Identities = 201/253 (79%), Positives = 220/253 (86%)
 Frame = +3

Query: 6    KRRCPKEKAIKKIWLVDSKGLIVKGRAALTNXXXXXXXXXXXMKNLEAIVQDIKPTALIG 185
            K    KE A KKIWLVDSKGLIVKGRA+LT            MKNLEAIVQ IKPTALIG
Sbjct: 319  KEGLSKENARKKIWLVDSKGLIVKGRASLTEEKEVFAHEHEEMKNLEAIVQKIKPTALIG 378

Query: 186  VAAIGGAFSEQILKDMAAFNERPIIFALSNPTSKAECTAEQCYTLTQGRAIFASGSPFDP 365
            VAAIGGAF+EQILKDMAAFNERPIIFALS+PTSKAEC+A++CY +T+GRAIFASGSPFDP
Sbjct: 379  VAAIGGAFTEQILKDMAAFNERPIIFALSSPTSKAECSADECYKVTKGRAIFASGSPFDP 438

Query: 366  VTLPSGQTLYPGQGNNSYVFPGVALGVVACGLRHITDKIFLTTAEVIAQQVSDKHLEEGR 545
            VTLP G+TL+PGQGNNSYVFPGVALGVVACGLRHI DK+FLTT EVI+QQVSDKHL+EGR
Sbjct: 439  VTLPDGRTLFPGQGNNSYVFPGVALGVVACGLRHIDDKVFLTTREVISQQVSDKHLQEGR 498

Query: 546  LYPPLNTIRDVSLKIAEKIVRDAYQEKTATIYPEPSNKEAFVRSQMYSTDYDQILPDGYS 725
            LYPPLNTIR VSLKIA KIV+DAY+EK AT+YPEP NKE FV SQMYST+YDQILPD Y 
Sbjct: 499  LYPPLNTIRGVSLKIAVKIVQDAYKEKMATVYPEPQNKEEFVSSQMYSTNYDQILPDCYP 558

Query: 726  WPEEAQKIQTKLD 764
            WP E QKIQTK++
Sbjct: 559  WPAEVQKIQTKVN 571


>ref|XP_001004679.1| PREDICTED: similar to NADP-dependent malic enzyme (NADP-ME) (Malic
            enzyme 1) isoform 1 [Mus musculus]
          Length = 554

 Score =  389 bits (998), Expect = e-108
 Identities = 198/255 (77%), Positives = 215/255 (84%), Gaps = 2/255 (0%)
 Frame = +3

Query: 6    KRRCPKEKAIKKIWLVDSKGLIVKGRAALTNXXXXXXXXX--XXMKNLEAIVQDIKPTAL 179
            K    KE A KKIWLVDSKGLIVK R  +T                NLEAIVQ IKPTAL
Sbjct: 299  KEGLSKENARKKIWLVDSKGLIVKVRKKVTTYLKPYTGAAPDSLHSNLEAIVQKIKPTAL 358

Query: 180  IGVAAIGGAFSEQILKDMAAFNERPIIFALSNPTSKAECTAEQCYTLTQGRAIFASGSPF 359
            IGVAAIGGAF+EQILKDMAAFNERPIIFALSNPTSKAEC+AEQCY +T+GRAIFASGSPF
Sbjct: 359  IGVAAIGGAFTEQILKDMAAFNERPIIFALSNPTSKAECSAEQCYKVTKGRAIFASGSPF 418

Query: 360  DPVTLPSGQTLYPGQGNNSYVFPGVALGVVACGLRHITDKIFLTTAEVIAQQVSDKHLEE 539
            DPVTLP G+TL+PGQGNNSYVFPGVALGVVACGLRHI DK+FLTTAEVI+QQVSDKHL+E
Sbjct: 419  DPVTLPDGRTLFPGQGNNSYVFPGVALGVVACGLRHIDDKVFLTTAEVISQQVSDKHLQE 478

Query: 540  GRLYPPLNTIRDVSLKIAEKIVRDAYQEKTATIYPEPSNKEAFVRSQMYSTDYDQILPDG 719
            GRLYPPLNTIRDVSLKIA K+ + AY+EK AT+YPEP NKE FV SQMYST+YDQILPD 
Sbjct: 479  GRLYPPLNTIRDVSLKIAVKVRQYAYKEKMATVYPEPQNKEEFVSSQMYSTNYDQILPDC 538

Query: 720  YSWPEEAQKIQTKLD 764
            Y WP E QKIQTK++
Sbjct: 539  YPWPAEVQKIQTKVN 553


>ref|NP_852072.1| malic enzyme 3, NADP(+)-dependent, mitochondrial [Mus musculus]
          Length = 604

 Score =  326 bits (835), Expect = 3e-89
 Identities = 159/249 (63%), Positives = 198/249 (79%)
 Frame = +3

Query: 6    KRRCPKEKAIKKIWLVDSKGLIVKGRAALTNXXXXXXXXXXXMKNLEAIVQDIKPTALIG 185
            K   PK +AIKKIW+VDSKGLIVKGR+ L +           + +LE +V+ +KPTA+IG
Sbjct: 354  KEGIPKTEAIKKIWMVDSKGLIVKGRSHLNHEKEMFAQDHPEVNSLEEVVRLVKPTAIIG 413

Query: 186  VAAIGGAFSEQILKDMAAFNERPIIFALSNPTSKAECTAEQCYTLTQGRAIFASGSPFDP 365
            VAAI GAF+EQIL+DMA+F+ERPI+FALSNPTSKAECTAE+CY +T+GR IFASGSPF  
Sbjct: 414  VAAIAGAFTEQILRDMASFHERPIVFALSNPTSKAECTAEKCYRVTEGRGIFASGSPFKS 473

Query: 366  VTLPSGQTLYPGQGNNSYVFPGVALGVVACGLRHITDKIFLTTAEVIAQQVSDKHLEEGR 545
            VTL  G+T  PGQGNN+YVFPGVALGV+A G+RHI D+IFL TAE IAQ+VS++HL +GR
Sbjct: 474  VTLEDGRTFTPGQGNNAYVFPGVALGVIAGGIRHIPDEIFLLTAEQIAQEVSEQHLSQGR 533

Query: 546  LYPPLNTIRDVSLKIAEKIVRDAYQEKTATIYPEPSNKEAFVRSQMYSTDYDQILPDGYS 725
            LYPPL+TIRDVSL+IA K++  AY+   A+ YPEP +KEAFV+S +Y+ DYD    D YS
Sbjct: 534  LYPPLSTIRDVSLRIAVKVLDYAYKHNLASYYPEPKDKEAFVKSLIYTPDYDSFSLDTYS 593

Query: 726  WPEEAQKIQ 752
            WP+EA  +Q
Sbjct: 594  WPKEAMSVQ 602


>ref|NP_663469.1| malic enzyme 2, NAD(+)-dependent, mitochondrial [Mus musculus]
          Length = 589

 Score =  240 bits (613), Expect = 2e-63
 Identities = 117/243 (48%), Positives = 158/243 (65%), Gaps = 3/243 (1%)
 Frame = +3

Query: 21   KEKAIKKIWLVDSKGLIVKGRAALTNXXX---XXXXXXXXMKNLEAIVQDIKPTALIGVA 191
            +E+A +KIW+ D  GL+VKGR A  +                  E  V  +KP+ +IGVA
Sbjct: 334  EEEAQRKIWMFDKSGLLVKGRTASIDSNQEPYAHAAPESIPATFEDAVNKLKPSVIIGVA 393

Query: 192  AIGGAFSEQILKDMAAFNERPIIFALSNPTSKAECTAEQCYTLTQGRAIFASGSPFDPVT 371
              G  F+  ++K MA+ NERPIIFALSNPT++AECTAE  YTLT+GR +FASGSPF+PV 
Sbjct: 394  GAGPLFTHGVIKAMASINERPIIFALSNPTAQAECTAEDAYTLTEGRCLFASGSPFEPVK 453

Query: 372  LPSGQTLYPGQGNNSYVFPGVALGVVACGLRHITDKIFLTTAEVIAQQVSDKHLEEGRLY 551
            L  G+   PGQGNN+Y+FPGVAL V+ C  RHI+D +FL  A+ +  Q++D  L +GRLY
Sbjct: 454  LQDGRVFTPGQGNNAYIFPGVALAVILCEARHISDTVFLEAAKALTTQLTDAELAQGRLY 513

Query: 552  PPLNTIRDVSLKIAEKIVRDAYQEKTATIYPEPSNKEAFVRSQMYSTDYDQILPDGYSWP 731
            P L  I++VS  IA K+    Y  K A  YPEP +K  +VR +++ ++Y  +LPD Y WP
Sbjct: 514  PSLANIQEVSANIAIKLAEYLYANKMAFRYPEPEDKARYVRERIWRSNYVSLLPDVYDWP 573

Query: 732  EEA 740
            E +
Sbjct: 574  ESS 576


>ref|XP_001004303.1| PREDICTED: similar to NADP-dependent malic enzyme (NADP-ME) (Malic
           enzyme 1) [Mus musculus]
          Length = 66

 Score =  117 bits (292), Expect = 3e-26
 Identities = 54/60 (90%), Positives = 58/60 (96%)
 Frame = +3

Query: 327 GRAIFASGSPFDPVTLPSGQTLYPGQGNNSYVFPGVALGVVACGLRHITDKIFLTTAEVI 506
           GRAIFASGSPFDPVTLP G+TL+PGQGNNSYVFPGVALGVVACGLRHI DK+FLTTAEV+
Sbjct: 7   GRAIFASGSPFDPVTLPDGRTLFPGQGNNSYVFPGVALGVVACGLRHIDDKVFLTTAEVL 66


  Database: RefSeqMP
    Posted date:  Aug 2, 2006 12:58 AM
  Number of letters in database: 21,768,885
  Number of sequences in database:  45,328
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 46,081,206
Number of Sequences: 45328
Number of extensions: 1076009
Number of successful extensions: 2508
Number of sequences better than 1.0e-05: 8
Number of HSP's better than  0.0 without gapping: 2325
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2506
length of database: 21,768,885
effective HSP length: 105
effective length of database: 17,009,445
effective search space used: 4541521815
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)