Animal-Genome cDNA 20060611S-054547


Search to RefSeqSP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611S-054547
         (1182 letters)

Database: RefSeqSP 
           1040 sequences; 434,620 total letters

Searching...done

 ***** No hits found ******

  Database: RefSeqSP
    Posted date:  Aug 1, 2006  7:14 PM
  Number of letters in database: 434,620
  Number of sequences in database:  1040
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 713,722
Number of Sequences: 1040
Number of extensions: 14239
Number of successful extensions: 45
Number of sequences better than 1.0e-05: 0
Number of HSP's better than  0.0 without gapping: 44
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 45
length of database: 434,620
effective HSP length: 79
effective length of database: 352,460
effective search space used: 110672440
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqBP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611S-054547
         (1182 letters)

Database: RefSeqBP 
           33,508 sequences; 16,112,626 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_776447.1| clathrin, light polypeptide (Lca) [Bos taurus]       236   2e-62
Alignment   gi|NP_776702.1| clathrin, light polypeptide B (light chain B) [...   148   9e-36

>ref|NP_776447.1| clathrin, light polypeptide (Lca) [Bos taurus]
          Length = 243

 Score =  236 bits (603), Expect = 2e-62
 Identities = 122/163 (74%), Positives = 132/163 (80%), Gaps = 1/163 (0%)
 Frame = +3

Query: 111 MADLDPFGAPAG-PSLGNGVAGEEDPAAAFLAQQESEIAGIENDEAFAILDXXXXXXXXX 287
           MA+LDPFG PAG P+LGNGVAGEEDPAAAFLAQQESEIAGIENDEAFAILD         
Sbjct: 1   MAELDPFGVPAGGPALGNGVAGEEDPAAAFLAQQESEIAGIENDEAFAILDGGAPGSQPH 60

Query: 288 XXXXXXXDAVDGVMNGEYYQDSNGPTDSYASISQMDRLQSEPESIRKWRE*QTERLKALD 467
                  DAVDGV NG+YYQ+SNGPTDSYA+ISQ+DRLQSEPESIRKWRE QTERL+ALD
Sbjct: 61  GEPPGIPDAVDGVTNGDYYQESNGPTDSYAAISQVDRLQSEPESIRKWREEQTERLEALD 120

Query: 468 TNSRKQESEWKEKAIKELEYWYARQDYQLQNTNA*KKAPKEPF 596
            NSRKQE+EWKEKAIKEL+ WYARQD QLQ T A  +   E F
Sbjct: 121 ANSRKQEAEWKEKAIKELDEWYARQDEQLQKTKANNRVADEAF 163


>ref|NP_776702.1| clathrin, light polypeptide B (light chain B) [Bos taurus]
          Length = 210

 Score =  148 bits (373), Expect = 9e-36
 Identities = 80/174 (45%), Positives = 101/174 (58%)
 Frame = +3

Query: 123 DPFGAPAGPSLGNGVAGEEDPAAAFLAQQESEIAGIENDEAFAILDXXXXXXXXXXXXXX 302
           D FG  +    G   A EEDPAAAFLAQQESEIAGIENDE F                  
Sbjct: 3   DDFGFFSSSESGAPEAAEEDPAAAFLAQQESEIAGIENDEGFGAPAGSQGGLAQPGPASG 62

Query: 303 XXDAVDGVMNGEYYQDSNGPTDSYASISQMDRLQSEPESIRKWRE*QTERLKALDTNSRK 482
             + +   +NG+ +Q++NGP D YA+I+Q DRL  EPESIRKWRE Q +RL+ LD  S+ 
Sbjct: 63  ASEDMGATVNGDVFQEANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAASKV 122

Query: 483 QESEWKEKAIKELEYWYARQDYQLQNTNA*KKAPKEPFEN*IK*SSPIKEW*QV 644
            E EW+EKA K+LE W  RQ  Q++      +A +E F    K  +P  EW +V
Sbjct: 123 MEQEWREKAKKDLEEWNQRQSEQVEKNKINNRASEEAFVKESKEETPGTEWEKV 176


  Database: RefSeqBP
    Posted date:  Aug 1, 2006  7:14 PM
  Number of letters in database: 16,112,626
  Number of sequences in database:  33,508
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 25,577,200
Number of Sequences: 33508
Number of extensions: 509902
Number of successful extensions: 1657
Number of sequences better than 1.0e-05: 2
Number of HSP's better than  0.0 without gapping: 1548
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1652
length of database: 16,112,626
effective HSP length: 103
effective length of database: 12,661,302
effective search space used: 3671777580
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqCP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611S-054547
         (1182 letters)

Database: RefSeqCP 
           33,732 sequences; 19,266,565 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|XP_866787.1| PREDICTED: similar to clathrin, light polypepti...   248   6e-66
Alignment   gi|XP_866825.1| PREDICTED: similar to Clathrin light chain A (L...   239   3e-63
Alignment   gi|XP_866761.1| PREDICTED: similar to Clathrin light chain A (L...   237   1e-62
Alignment   gi|XP_531996.2| PREDICTED: similar to Clathrin light chain A (L...   236   4e-62
Alignment   gi|XP_866835.1| PREDICTED: similar to clathrin, light polypepti...   145   6e-35
Alignment   gi|XP_866115.1| PREDICTED: similar to clathrin, light polypepti...   144   1e-34
Alignment   gi|XP_866066.1| PREDICTED: similar to clathrin, light polypepti...   144   1e-34
Alignment   gi|XP_866083.1| PREDICTED: similar to clathrin, light polypepti...   144   2e-34
Alignment   gi|XP_866050.1| PREDICTED: similar to clathrin, light polypepti...   140   2e-33
Alignment   gi|XP_546220.2| PREDICTED: similar to Clathrin light chain B (L...   135   8e-32

>ref|XP_866787.1| PREDICTED: similar to clathrin, light polypeptide A isoform a
           isoform 3 [Canis familiaris]
          Length = 218

 Score =  248 bits (634), Expect = 6e-66
 Identities = 136/186 (73%), Positives = 146/186 (78%), Gaps = 6/186 (3%)
 Frame = +3

Query: 111 MADLDPFGAPA----GPSLGNGVAG--EEDPAAAFLAQQESEIAGIENDEAFAILDXXXX 272
           MA+LDPFGAPA    GP+LGNGVAG  EEDPAAAFLAQQESEIAGIENDEAFAILD    
Sbjct: 1   MAELDPFGAPASAPGGPALGNGVAGAGEEDPAAAFLAQQESEIAGIENDEAFAILDGGAP 60

Query: 273 XXXXXXXXXXXXDAVDGVMNGEYYQDSNGPTDSYASISQMDRLQSEPESIRKWRE*QTER 452
                       DAVDGVMNGEYYQ+SNGPTDSYA+ISQ+DRLQSEPESIRKWRE QTER
Sbjct: 61  GPQPHGEPPGVPDAVDGVMNGEYYQESNGPTDSYAAISQVDRLQSEPESIRKWREEQTER 120

Query: 453 LKALDTNSRKQESEWKEKAIKELEYWYARQDYQLQNTNA*KKAPKEPFEN*IK*SSPIKE 632
           L+ALD NSRKQE+EWKEKAIKELE WYARQD QLQ T A  +A +E F N I  SSP  E
Sbjct: 121 LEALDANSRKQEAEWKEKAIKELEEWYARQDEQLQKTKANNRAAEEAFVNDIDESSPGTE 180

Query: 633 W*QV*R 650
           W +V R
Sbjct: 181 WERVAR 186


>ref|XP_866825.1| PREDICTED: similar to Clathrin light chain A (Lca) isoform 6 [Canis
           familiaris]
          Length = 230

 Score =  239 bits (611), Expect = 3e-63
 Identities = 136/198 (68%), Positives = 147/198 (74%), Gaps = 18/198 (9%)
 Frame = +3

Query: 111 MADLDPFGAPA----GPSLGNGVAG--EEDPAAAFLAQQESEIAGIENDEAFAILDXXXX 272
           MA+LDPFGAPA    GP+LGNGVAG  EEDPAAAFLAQQESEIAGIENDEAFAILD    
Sbjct: 1   MAELDPFGAPASAPGGPALGNGVAGAGEEDPAAAFLAQQESEIAGIENDEAFAILDGGAP 60

Query: 273 XXXXXXXXXXXXDAVDGVMNGEYYQDSNGPTDSYASISQMDRLQSEPESIRKWRE*QTER 452
                       DAVDGVMNGEYYQ+SNGPTDSYA+ISQ+DRLQSEPESIRKWRE QTER
Sbjct: 61  GPQPHGEPPGVPDAVDGVMNGEYYQESNGPTDSYAAISQVDRLQSEPESIRKWREEQTER 120

Query: 453 LKALDTNSRKQESEWKEKAIKELEYWYARQDYQLQNTNA------------*KKAPKEPF 596
           L+ALD NSRKQE+EWKEKAIKELE WYARQD QLQ T A             ++A +E F
Sbjct: 121 LEALDANSRKQEAEWKEKAIKELEEWYARQDEQLQKTKANNSTNINHPCYSLEQAAEEAF 180

Query: 597 EN*IK*SSPIKEW*QV*R 650
            N I  SSP  EW +V R
Sbjct: 181 VNDIDESSPGTEWERVAR 198


>ref|XP_866761.1| PREDICTED: similar to Clathrin light chain A (Lca) isoform 2 [Canis
           familiaris]
          Length = 236

 Score =  237 bits (605), Expect = 1e-62
 Identities = 136/204 (66%), Positives = 146/204 (71%), Gaps = 24/204 (11%)
 Frame = +3

Query: 111 MADLDPFGAPA----GPSLGNGVAG--EEDPAAAFLAQQESEIAGIENDEAFAILDXXXX 272
           MA+LDPFGAPA    GP+LGNGVAG  EEDPAAAFLAQQESEIAGIENDEAFAILD    
Sbjct: 1   MAELDPFGAPASAPGGPALGNGVAGAGEEDPAAAFLAQQESEIAGIENDEAFAILDGGAP 60

Query: 273 XXXXXXXXXXXXDAVDGVMNGEYYQDSNGPTDSYASISQMDRLQSEPESIRKWRE*QTER 452
                       DAVDGVMNGEYYQ+SNGPTDSYA+ISQ+DRLQSEPESIRKWRE QTER
Sbjct: 61  GPQPHGEPPGVPDAVDGVMNGEYYQESNGPTDSYAAISQVDRLQSEPESIRKWREEQTER 120

Query: 453 LKALDTNSRKQESEWKEKAIKELEYWYARQDYQLQNTNA*KK------------------ 578
           L+ALD NSRKQE+EWKEKAIKELE WYARQD QLQ T A  +                  
Sbjct: 121 LEALDANSRKQEAEWKEKAIKELEEWYARQDEQLQKTKANNRVADEAFYKQPFADVIGYV 180

Query: 579 APKEPFEN*IK*SSPIKEW*QV*R 650
           A +E F N I  SSP  EW +V R
Sbjct: 181 AAEEAFVNDIDESSPGTEWERVAR 204


>ref|XP_531996.2| PREDICTED: similar to Clathrin light chain A (Lca) isoform 1 [Canis
           familiaris]
          Length = 248

 Score =  236 bits (601), Expect = 4e-62
 Identities = 126/168 (75%), Positives = 134/168 (79%), Gaps = 6/168 (3%)
 Frame = +3

Query: 111 MADLDPFGAPA----GPSLGNGVAG--EEDPAAAFLAQQESEIAGIENDEAFAILDXXXX 272
           MA+LDPFGAPA    GP+LGNGVAG  EEDPAAAFLAQQESEIAGIENDEAFAILD    
Sbjct: 1   MAELDPFGAPASAPGGPALGNGVAGAGEEDPAAAFLAQQESEIAGIENDEAFAILDGGAP 60

Query: 273 XXXXXXXXXXXXDAVDGVMNGEYYQDSNGPTDSYASISQMDRLQSEPESIRKWRE*QTER 452
                       DAVDGVMNGEYYQ+SNGPTDSYA+ISQ+DRLQSEPESIRKWRE QTER
Sbjct: 61  GPQPHGEPPGVPDAVDGVMNGEYYQESNGPTDSYAAISQVDRLQSEPESIRKWREEQTER 120

Query: 453 LKALDTNSRKQESEWKEKAIKELEYWYARQDYQLQNTNA*KKAPKEPF 596
           L+ALD NSRKQE+EWKEKAIKELE WYARQD QLQ T A  +   E F
Sbjct: 121 LEALDANSRKQEAEWKEKAIKELEEWYARQDEQLQKTKANNRVADEAF 168


>ref|XP_866835.1| PREDICTED: similar to clathrin, light polypeptide A isoform a
           isoform 7 [Canis familiaris]
          Length = 139

 Score =  145 bits (367), Expect = 6e-35
 Identities = 75/102 (73%), Positives = 84/102 (82%)
 Frame = +3

Query: 345 QDSNGPTDSYASISQMDRLQSEPESIRKWRE*QTERLKALDTNSRKQESEWKEKAIKELE 524
           ++SNGPTDSYA+ISQ+DRLQSEPESIRKWRE QTERL+ALD NSRKQE+EWKEKAIKELE
Sbjct: 6   RESNGPTDSYAAISQVDRLQSEPESIRKWREEQTERLEALDANSRKQEAEWKEKAIKELE 65

Query: 525 YWYARQDYQLQNTNA*KKAPKEPFEN*IK*SSPIKEW*QV*R 650
            WYARQD QLQ T A  +A +E F N I  SSP  EW +V R
Sbjct: 66  EWYARQDEQLQKTKANNRAAEEAFVNDIDESSPGTEWERVAR 107


>ref|XP_866115.1| PREDICTED: similar to clathrin, light polypeptide isoform a isoform
           5 [Canis familiaris]
          Length = 211

 Score =  144 bits (364), Expect = 1e-34
 Identities = 81/175 (46%), Positives = 102/175 (58%), Gaps = 1/175 (0%)
 Frame = +3

Query: 123 DPFGAPAGPSLGNGVAGEEDPAAAFLAQQESEIAGIENDEAF-AILDXXXXXXXXXXXXX 299
           D FG  +    G   A EEDPAAAFLAQQESEIAGIENDE F A                
Sbjct: 3   DDFGFFSSSESGAPEAAEEDPAAAFLAQQESEIAGIENDEGFGAPAGSHAALAQPGPAGG 62

Query: 300 XXXDAVDGVMNGEYYQDSNGPTDSYASISQMDRLQSEPESIRKWRE*QTERLKALDTNSR 479
              + +   +NG+ +Q++NGP D YA+I+Q DRL  EPESIRKWRE Q +RL+ LD  S+
Sbjct: 63  AGSEDMGTTINGDVFQEANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAASK 122

Query: 480 KQESEWKEKAIKELEYWYARQDYQLQNTNA*KKAPKEPFEN*IK*SSPIKEW*QV 644
             E EW+EKA K+LE W  RQ  Q++      +A +E F    K  +P  EW +V
Sbjct: 123 VTEQEWREKAKKDLEEWNQRQSEQVEKNKINNRASEEAFVKESKEETPGTEWEKV 177


>ref|XP_866066.1| PREDICTED: similar to clathrin, light polypeptide isoform a isoform
           3 [Canis familiaris]
          Length = 207

 Score =  144 bits (364), Expect = 1e-34
 Identities = 80/174 (45%), Positives = 103/174 (59%)
 Frame = +3

Query: 123 DPFGAPAGPSLGNGVAGEEDPAAAFLAQQESEIAGIENDEAFAILDXXXXXXXXXXXXXX 302
           D FG  +    G   A EEDPAAAFLAQQESEIAGIENDE F + +              
Sbjct: 3   DDFGFFSSSESGAPEAAEEDPAAAFLAQQESEIAGIENDEGFGLSNGYCHVFVLSLAGS- 61

Query: 303 XXDAVDGVMNGEYYQDSNGPTDSYASISQMDRLQSEPESIRKWRE*QTERLKALDTNSRK 482
             + +   +NG+ +Q++NGP D YA+I+Q DRL  EPESIRKWRE Q +RL+ LD  S+ 
Sbjct: 62  --EDMGTTINGDVFQEANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAASKV 119

Query: 483 QESEWKEKAIKELEYWYARQDYQLQNTNA*KKAPKEPFEN*IK*SSPIKEW*QV 644
            E EW+EKA K+LE W  RQ  Q++      +A +E F    K  +P  EW +V
Sbjct: 120 TEQEWREKAKKDLEEWNQRQSEQVEKNKINNRASEEAFVKESKEETPGTEWEKV 173


>ref|XP_866083.1| PREDICTED: similar to clathrin, light polypeptide isoform a isoform
           4 [Canis familiaris]
          Length = 213

 Score =  144 bits (363), Expect = 2e-34
 Identities = 80/177 (45%), Positives = 101/177 (57%), Gaps = 3/177 (1%)
 Frame = +3

Query: 123 DPFGAPAGPSLGNGVAGEEDPAAAFLAQQESEIAGIENDEAFAILDXXXXXXXXXXX--- 293
           D FG  +    G   A EEDPAAAFLAQQESEIAGIENDE F                  
Sbjct: 3   DDFGFFSSSESGAPEAAEEDPAAAFLAQQESEIAGIENDEGFGAPAGSHAALAHASACPP 62

Query: 294 XXXXXDAVDGVMNGEYYQDSNGPTDSYASISQMDRLQSEPESIRKWRE*QTERLKALDTN 473
                + +   +NG+ +Q++NGP D YA+I+Q DRL  EPESIRKWRE Q +RL+ LD  
Sbjct: 63  STAGSEDMGTTINGDVFQEANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAA 122

Query: 474 SRKQESEWKEKAIKELEYWYARQDYQLQNTNA*KKAPKEPFEN*IK*SSPIKEW*QV 644
           S+  E EW+EKA K+LE W  RQ  Q++      +A +E F    K  +P  EW +V
Sbjct: 123 SKVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNRASEEAFVKESKEETPGTEWEKV 179


>ref|XP_866050.1| PREDICTED: similar to clathrin, light polypeptide isoform a isoform
           2 [Canis familiaris]
          Length = 208

 Score =  140 bits (354), Expect = 2e-33
 Identities = 80/174 (45%), Positives = 100/174 (57%)
 Frame = +3

Query: 123 DPFGAPAGPSLGNGVAGEEDPAAAFLAQQESEIAGIENDEAFAILDXXXXXXXXXXXXXX 302
           D FG  +    G   A EEDPAAAFLAQQESEIAGIENDE F                  
Sbjct: 3   DDFGFFSSSESGAPEAAEEDPAAAFLAQQESEIAGIENDEGFGA--PAGNSGEEEGPRYG 60

Query: 303 XXDAVDGVMNGEYYQDSNGPTDSYASISQMDRLQSEPESIRKWRE*QTERLKALDTNSRK 482
               +   +NG+ +Q++NGP D YA+I+Q DRL  EPESIRKWRE Q +RL+ LD  S+ 
Sbjct: 61  PLGDMGTTINGDVFQEANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAASKV 120

Query: 483 QESEWKEKAIKELEYWYARQDYQLQNTNA*KKAPKEPFEN*IK*SSPIKEW*QV 644
            E EW+EKA K+LE W  RQ  Q++      +A +E F    K  +P  EW +V
Sbjct: 121 TEQEWREKAKKDLEEWNQRQSEQVEKNKINNRASEEAFVKESKEETPGTEWEKV 174


>ref|XP_546220.2| PREDICTED: similar to Clathrin light chain B (Lcb) isoform 1 [Canis
           familiaris]
          Length = 229

 Score =  135 bits (340), Expect = 8e-32
 Identities = 73/146 (50%), Positives = 90/146 (61%), Gaps = 1/146 (0%)
 Frame = +3

Query: 123 DPFGAPAGPSLGNGVAGEEDPAAAFLAQQESEIAGIENDEAF-AILDXXXXXXXXXXXXX 299
           D FG  +    G   A EEDPAAAFLAQQESEIAGIENDE F A                
Sbjct: 3   DDFGFFSSSESGAPEAAEEDPAAAFLAQQESEIAGIENDEGFGAPAGSHAALAQPGPAGG 62

Query: 300 XXXDAVDGVMNGEYYQDSNGPTDSYASISQMDRLQSEPESIRKWRE*QTERLKALDTNSR 479
              + +   +NG+ +Q++NGP D YA+I+Q DRL  EPESIRKWRE Q +RL+ LD  S+
Sbjct: 63  AGSEDMGTTINGDVFQEANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAASK 122

Query: 480 KQESEWKEKAIKELEYWYARQDYQLQ 557
             E EW+EKA K+LE W  RQ  Q++
Sbjct: 123 VTEQEWREKAKKDLEEWNQRQSEQVE 148


  Database: RefSeqCP
    Posted date:  Aug 1, 2006  9:25 PM
  Number of letters in database: 19,266,565
  Number of sequences in database:  33,732
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 30,181,877
Number of Sequences: 33732
Number of extensions: 600526
Number of successful extensions: 2103
Number of sequences better than 1.0e-05: 10
Number of HSP's better than  0.0 without gapping: 1889
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2068
length of database: 19,266,565
effective HSP length: 105
effective length of database: 15,724,705
effective search space used: 4528715040
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqHP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611S-054547
         (1182 letters)

Database: RefSeqHP 
           39,411 sequences; 17,774,539 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_001824.1| clathrin, light polypeptide A isoform a [Homo s...   246   3e-65
Alignment   gi|NP_009027.1| clathrin, light polypeptide A isoform b [Homo s...   233   2e-61
Alignment   gi|NP_001825.1| clathrin, light polypeptide isoform a [Homo sap...   144   1e-34
Alignment   gi|NP_009028.1| clathrin, light polypeptide isoform b [Homo sap...   135   7e-32

>ref|NP_001824.1| clathrin, light polypeptide A isoform a [Homo sapiens]
          Length = 218

 Score =  246 bits (628), Expect = 3e-65
 Identities = 135/186 (72%), Positives = 145/186 (77%), Gaps = 6/186 (3%)
 Frame = +3

Query: 111 MADLDPFGAPAG----PSLGNGVAG--EEDPAAAFLAQQESEIAGIENDEAFAILDXXXX 272
           MA+LDPFGAPAG    P+LGNGVAG  EEDPAAAFLAQQESEIAGIENDEAFAILD    
Sbjct: 1   MAELDPFGAPAGAPGGPALGNGVAGAGEEDPAAAFLAQQESEIAGIENDEAFAILDGGAP 60

Query: 273 XXXXXXXXXXXXDAVDGVMNGEYYQDSNGPTDSYASISQMDRLQSEPESIRKWRE*QTER 452
                       DAVDGVMNGEYYQ+SNGPTDSYA+ISQ+DRLQSEPESIRKWRE Q ER
Sbjct: 61  GPQPHGEPPGGPDAVDGVMNGEYYQESNGPTDSYAAISQVDRLQSEPESIRKWREEQMER 120

Query: 453 LKALDTNSRKQESEWKEKAIKELEYWYARQDYQLQNTNA*KKAPKEPFEN*IK*SSPIKE 632
           L+ALD NSRKQE+EWKEKAIKELE WYARQD QLQ T A  +A +E F N I  SSP  E
Sbjct: 121 LEALDANSRKQEAEWKEKAIKELEEWYARQDEQLQKTKANNRAAEEAFVNDIDESSPGTE 180

Query: 633 W*QV*R 650
           W +V R
Sbjct: 181 WERVAR 186


>ref|NP_009027.1| clathrin, light polypeptide A isoform b [Homo sapiens]
          Length = 248

 Score =  233 bits (595), Expect = 2e-61
 Identities = 125/168 (74%), Positives = 133/168 (79%), Gaps = 6/168 (3%)
 Frame = +3

Query: 111 MADLDPFGAPAG----PSLGNGVAG--EEDPAAAFLAQQESEIAGIENDEAFAILDXXXX 272
           MA+LDPFGAPAG    P+LGNGVAG  EEDPAAAFLAQQESEIAGIENDEAFAILD    
Sbjct: 1   MAELDPFGAPAGAPGGPALGNGVAGAGEEDPAAAFLAQQESEIAGIENDEAFAILDGGAP 60

Query: 273 XXXXXXXXXXXXDAVDGVMNGEYYQDSNGPTDSYASISQMDRLQSEPESIRKWRE*QTER 452
                       DAVDGVMNGEYYQ+SNGPTDSYA+ISQ+DRLQSEPESIRKWRE Q ER
Sbjct: 61  GPQPHGEPPGGPDAVDGVMNGEYYQESNGPTDSYAAISQVDRLQSEPESIRKWREEQMER 120

Query: 453 LKALDTNSRKQESEWKEKAIKELEYWYARQDYQLQNTNA*KKAPKEPF 596
           L+ALD NSRKQE+EWKEKAIKELE WYARQD QLQ T A  +   E F
Sbjct: 121 LEALDANSRKQEAEWKEKAIKELEEWYARQDEQLQKTKANNRVADEAF 168


>ref|NP_001825.1| clathrin, light polypeptide isoform a [Homo sapiens]
          Length = 211

 Score =  144 bits (364), Expect = 1e-34
 Identities = 81/175 (46%), Positives = 102/175 (58%), Gaps = 1/175 (0%)
 Frame = +3

Query: 123 DPFGAPAGPSLGNGVAGEEDPAAAFLAQQESEIAGIENDEAF-AILDXXXXXXXXXXXXX 299
           D FG  +    G   A EEDPAAAFLAQQESEIAGIENDE F A                
Sbjct: 3   DDFGFFSSSESGAPEAAEEDPAAAFLAQQESEIAGIENDEGFGAPAGSHAAPAQPGPTSG 62

Query: 300 XXXDAVDGVMNGEYYQDSNGPTDSYASISQMDRLQSEPESIRKWRE*QTERLKALDTNSR 479
              + +   +NG+ +Q++NGP D YA+I+Q DRL  EPESIRKWRE Q +RL+ LD  S+
Sbjct: 63  AGSEDMGTTVNGDVFQEANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAASK 122

Query: 480 KQESEWKEKAIKELEYWYARQDYQLQNTNA*KKAPKEPFEN*IK*SSPIKEW*QV 644
             E EW+EKA K+LE W  RQ  Q++      +A +E F    K  +P  EW +V
Sbjct: 123 VTEQEWREKAKKDLEEWNQRQSEQVEKNKINNRASEEAFVKESKEETPGTEWEKV 177


>ref|NP_009028.1| clathrin, light polypeptide isoform b [Homo sapiens]
          Length = 229

 Score =  135 bits (340), Expect = 7e-32
 Identities = 73/146 (50%), Positives = 90/146 (61%), Gaps = 1/146 (0%)
 Frame = +3

Query: 123 DPFGAPAGPSLGNGVAGEEDPAAAFLAQQESEIAGIENDEAF-AILDXXXXXXXXXXXXX 299
           D FG  +    G   A EEDPAAAFLAQQESEIAGIENDE F A                
Sbjct: 3   DDFGFFSSSESGAPEAAEEDPAAAFLAQQESEIAGIENDEGFGAPAGSHAAPAQPGPTSG 62

Query: 300 XXXDAVDGVMNGEYYQDSNGPTDSYASISQMDRLQSEPESIRKWRE*QTERLKALDTNSR 479
              + +   +NG+ +Q++NGP D YA+I+Q DRL  EPESIRKWRE Q +RL+ LD  S+
Sbjct: 63  AGSEDMGTTVNGDVFQEANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAASK 122

Query: 480 KQESEWKEKAIKELEYWYARQDYQLQ 557
             E EW+EKA K+LE W  RQ  Q++
Sbjct: 123 VTEQEWREKAKKDLEEWNQRQSEQVE 148


  Database: RefSeqHP
    Posted date:  Aug 2, 2006 12:57 AM
  Number of letters in database: 17,774,539
  Number of sequences in database:  39,411
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 28,398,611
Number of Sequences: 39411
Number of extensions: 570706
Number of successful extensions: 2023
Number of sequences better than 1.0e-05: 4
Number of HSP's better than  0.0 without gapping: 1839
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2014
length of database: 17,774,539
effective HSP length: 104
effective length of database: 13,675,795
effective search space used: 3952304755
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqMP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611S-054547
         (1182 letters)

Database: RefSeqMP 
           45,328 sequences; 21,768,885 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_058040.1| clathrin, light polypeptide (Lca) [Mus musculus]     231   1e-60
Alignment   gi|NP_083146.1| clathrin, light polypeptide (Lcb) [Mus musculus]     141   1e-33

>ref|NP_058040.1| clathrin, light polypeptide (Lca) [Mus musculus]
          Length = 235

 Score =  231 bits (588), Expect = 1e-60
 Identities = 123/168 (73%), Positives = 134/168 (79%), Gaps = 6/168 (3%)
 Frame = +3

Query: 111 MADLDPFG----APAGPSLGNGVAG--EEDPAAAFLAQQESEIAGIENDEAFAILDXXXX 272
           MA+LDPFG    AP GP+LGNGVAG  EEDPAAAFLA +ESEIAGIENDEAFAILD    
Sbjct: 1   MAELDPFGDPAGAPGGPALGNGVAGAGEEDPAAAFLAHEESEIAGIENDEAFAILDGGAP 60

Query: 273 XXXXXXXXXXXXDAVDGVMNGEYYQDSNGPTDSYASISQMDRLQSEPESIRKWRE*QTER 452
                       DAVDGVMNGEYYQ+SNGPTDSYA+IS++DRLQSEPESIRKWRE QTER
Sbjct: 61  GRATRRAGGGP-DAVDGVMNGEYYQESNGPTDSYAAISEVDRLQSEPESIRKWREEQTER 119

Query: 453 LKALDTNSRKQESEWKEKAIKELEYWYARQDYQLQNTNA*KKAPKEPF 596
           L+ALD NSRKQE+EWKEKAIKELE WYARQD QLQ T A  +A +E F
Sbjct: 120 LEALDANSRKQEAEWKEKAIKELEEWYARQDEQLQKTKANNRAAEEAF 167


>ref|NP_083146.1| clathrin, light polypeptide (Lcb) [Mus musculus]
          Length = 211

 Score =  141 bits (356), Expect = 1e-33
 Identities = 79/175 (45%), Positives = 101/175 (57%), Gaps = 1/175 (0%)
 Frame = +3

Query: 123 DPFGAPAGPSLGNGVAGEEDPAAAFLAQQESEIAGIENDEAF-AILDXXXXXXXXXXXXX 299
           + FG  +    G   A EEDPAAAFLAQQESEIAGIEND  F A                
Sbjct: 3   EDFGFFSSSESGAPEAAEEDPAAAFLAQQESEIAGIENDPGFGAPAASQVASAQPGLASG 62

Query: 300 XXXDAVDGVMNGEYYQDSNGPTDSYASISQMDRLQSEPESIRKWRE*QTERLKALDTNSR 479
              + +   +NG+ +Q++NGP D YA+I+Q DRL  EPESIRKWRE Q +RL+ LD  S+
Sbjct: 63  AGSEDMSTTVNGDVFQEANGPADGYAAIAQADRLTQEPESIRKWREEQKKRLQELDAASK 122

Query: 480 KQESEWKEKAIKELEYWYARQDYQLQNTNA*KKAPKEPFEN*IK*SSPIKEW*QV 644
             E EW+EKA K+LE W  RQ  Q++      +A +E F    K  +P  EW +V
Sbjct: 123 VTEQEWREKAKKDLEEWNQRQSEQVEKNKINNRASEEAFVKESKEETPGTEWEKV 177


  Database: RefSeqMP
    Posted date:  Aug 2, 2006 12:58 AM
  Number of letters in database: 21,768,885
  Number of sequences in database:  45,328
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 34,600,144
Number of Sequences: 45328
Number of extensions: 692815
Number of successful extensions: 2492
Number of sequences better than 1.0e-05: 2
Number of HSP's better than  0.0 without gapping: 2137
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2432
length of database: 21,768,885
effective HSP length: 106
effective length of database: 16,964,117
effective search space used: 4868701579
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)