Animal-Genome cDNA 20060611S-056148


Search to RefSeqSP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611S-056148
         (1174 letters)

Database: RefSeqSP 
           1040 sequences; 434,620 total letters

Searching...done

 ***** No hits found ******

  Database: RefSeqSP
    Posted date:  Aug 1, 2006  7:14 PM
  Number of letters in database: 434,620
  Number of sequences in database:  1040
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,124,846
Number of Sequences: 1040
Number of extensions: 30063
Number of successful extensions: 95
Number of sequences better than 1.0e-05: 0
Number of HSP's better than  0.0 without gapping: 89
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 95
length of database: 434,620
effective HSP length: 79
effective length of database: 352,460
effective search space used: 109615060
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqBP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611S-056148
         (1174 letters)

Database: RefSeqBP 
           33,508 sequences; 16,112,626 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_899207.1| double substrate-specificity short chain dehydr...   408   e-114
Alignment   gi|XP_870721.1| PREDICTED: similar to Retinol dehydrogenase 11 ...   261   8e-70
Alignment   gi|XP_582373.2| PREDICTED: similar to Retinol dehydrogenase 11 ...   254   7e-68
Alignment   gi|XP_582319.2| PREDICTED: similar to retinol dehydrogenase 14 ...   201   7e-52
Alignment   gi|XP_592820.2| PREDICTED: similar to retinol dehydrogenase 11 ...   184   2e-46
Alignment   gi|XP_584642.2| PREDICTED: similar to retinol dehydrogenase 11 ...   137   2e-32
Alignment   gi|XP_591168.2| PREDICTED: similar to dehydrogenase/reductase (...   127   2e-29
Alignment   gi|XP_584810.2| PREDICTED: similar to retinol dehydrogenase 13 ...   122   5e-28
Alignment   gi|XP_584629.2| PREDICTED: similar to Retinol dehydrogenase 13,...    93   4e-19
Alignment   gi|XP_876208.1| PREDICTED: similar to WW domain-containing oxid...    93   5e-19

>ref|NP_899207.1| double substrate-specificity short chain dehydrogenase/reductase 2
           [Bos taurus]
          Length = 316

 Score =  408 bits (1049), Expect = e-114
 Identities = 206/258 (79%), Positives = 216/258 (83%)
 Frame = +2

Query: 191 QLHPSGARVYIACRDVLKGESAASEIRADTKNSQVLVRKLDLSDTKSIRAFAEGFLTEEK 370
           +L   GARVYIACRDVLKGESAASEI+ADTKNSQVLVRKLDLSDTKSIRAFAEGFL EEK
Sbjct: 58  ELARRGARVYIACRDVLKGESAASEIQADTKNSQVLVRKLDLSDTKSIRAFAEGFLAEEK 117

Query: 371 QLHILINNAGVMLCPYSKTADGFETHLGVNXXXXXXXXXXXXXXXKASAPARVVNLSSVV 550
           QLHILINNAGVMLCPYSKTADGFETHL VN               K SAPARVVNLSSV 
Sbjct: 118 QLHILINNAGVMLCPYSKTADGFETHLAVNHLGHFLLTHLLLGRLKESAPARVVNLSSVA 177

Query: 551 HHAGKIRFHDLQGEKHYNRGFAYCHSKLANVLFTRELAKRLQGTGVTTYAVHPGIVQSEL 730
           HH GKIRFHDLQG+K+YN GFAYCHSKLANVLFTRELAKRL+GTGVTTYAVHPGIV+S+L
Sbjct: 178 HHLGKIRFHDLQGDKYYNLGFAYCHSKLANVLFTRELAKRLKGTGVTTYAVHPGIVRSKL 237

Query: 731 VRHSFLLCLLWRLFSRFLKTAREGAQTSLHCALAEGLEPLSGKYFSDCKRAWVSPRAPE* 910
           VRHSFLLCLLWRLFS FLKT  EGAQTSLHCALAEGLEPLSGKYFSDCK+ WVSPRA   
Sbjct: 238 VRHSFLLCLLWRLFSPFLKTTWEGAQTSLHCALAEGLEPLSGKYFSDCKKTWVSPRARNN 297

Query: 911 QNGQALWGRQLRAPGIPW 964
           +  + LW       GI W
Sbjct: 298 KTAERLWNVSCELLGIRW 315


>ref|XP_870721.1| PREDICTED: similar to Retinol dehydrogenase 11 (Retinal reductase
           1) (RalR1) (Prostate short-chain dehydrogenase/reductase
           1) (Androgen-regulated short-chain
           dehydrogenase/reductase 1) (HCV core-binding protein
           HCBP12) isoform 2 [Bos taurus]
          Length = 314

 Score =  261 bits (667), Expect = 8e-70
 Identities = 134/257 (52%), Positives = 174/257 (67%)
 Frame = +2

Query: 191 QLHPSGARVYIACRDVLKGESAASEIRADTKNSQVLVRKLDLSDTKSIRAFAEGFLTEEK 370
           +L   GARVY+ACRDV  GE  A EI+  T N QVLVRKLDL+DTKSIRAFA+ FL + K
Sbjct: 34  ELARRGARVYLACRDVQNGELVAREIQMMTGNQQVLVRKLDLADTKSIRAFAKRFLEDHK 93

Query: 371 QLHILINNAGVMLCPYSKTADGFETHLGVNXXXXXXXXXXXXXXXKASAPARVVNLSSVV 550
            +H++ ++   ++C +  ++ G ++                    + SAP+RVVN+SS+ 
Sbjct: 94  YIHLINSSPHFLICGFPGSSAGKDSACNTGYLGHFLLTHLLLEKLEESAPSRVVNVSSLA 153

Query: 551 HHAGKIRFHDLQGEKHYNRGFAYCHSKLANVLFTRELAKRLQGTGVTTYAVHPGIVQSEL 730
           H  G+I FH+LQGEK Y  G AYCHSKLAN+LFT+ELA+RL+G+GVT Y+VHPG V SEL
Sbjct: 154 HLLGRIHFHNLQGEKFYQSGLAYCHSKLANILFTQELARRLKGSGVTVYSVHPGTVNSEL 213

Query: 731 VRHSFLLCLLWRLFSRFLKTAREGAQTSLHCALAEGLEPLSGKYFSDCKRAWVSPRAPE* 910
           VRHS L+  +W +FS F+KT ++GAQTSL+CAL EGLE LSG +FSDC  AWVS +A   
Sbjct: 214 VRHSALMRWIWWIFSFFIKTPQQGAQTSLYCALTEGLEVLSGNHFSDCHVAWVSAQARNE 273

Query: 911 QNGQALWGRQLRAPGIP 961
              + LW       GIP
Sbjct: 274 TVARRLWDVSCDLLGIP 290


>ref|XP_582373.2| PREDICTED: similar to Retinol dehydrogenase 11 (Retinal reductase
           1) (RalR1) (Prostate short-chain dehydrogenase/reductase
           1) (Androgen-regulated short-chain
           dehydrogenase/reductase 1) (HCV core-binding protein
           HCBP12) isoform 1 [Bos taurus]
          Length = 308

 Score =  254 bits (650), Expect = 7e-68
 Identities = 137/257 (53%), Positives = 172/257 (66%)
 Frame = +2

Query: 191 QLHPSGARVYIACRDVLKGESAASEIRADTKNSQVLVRKLDLSDTKSIRAFAEGFLTEEK 370
           +L   GARVY+ACRDV  GE  A EI+  T N QVLVRKLDL+DTKSIRAFA+ FL + K
Sbjct: 34  ELARRGARVYLACRDVQNGELVAREIQMMTGNQQVLVRKLDLADTKSIRAFAKRFLEDHK 93

Query: 371 QLHILINNAGVMLCPYSKTADGFETHLGVNXXXXXXXXXXXXXXXKASAPARVVNLSSVV 550
            +H LIN+ G     +  ++ G ++                    + SAP+RVVN+SS+ 
Sbjct: 94  YIH-LINSVG-----FPGSSAGKDSACNTGYLGHFLLTHLLLEKLEESAPSRVVNVSSLA 147

Query: 551 HHAGKIRFHDLQGEKHYNRGFAYCHSKLANVLFTRELAKRLQGTGVTTYAVHPGIVQSEL 730
           H  G+I FH+LQGEK Y  G AYCHSKLAN+LFT+ELA+RL+G+GVT Y+VHPG V SEL
Sbjct: 148 HLLGRIHFHNLQGEKFYQSGLAYCHSKLANILFTQELARRLKGSGVTVYSVHPGTVNSEL 207

Query: 731 VRHSFLLCLLWRLFSRFLKTAREGAQTSLHCALAEGLEPLSGKYFSDCKRAWVSPRAPE* 910
           VRHS L+  +W +FS F+KT ++GAQTSL+CAL EGLE LSG +FSDC  AWVS +A   
Sbjct: 208 VRHSALMRWIWWIFSFFIKTPQQGAQTSLYCALTEGLEVLSGNHFSDCHVAWVSAQARNE 267

Query: 911 QNGQALWGRQLRAPGIP 961
              + LW       GIP
Sbjct: 268 TVARRLWDVSCDLLGIP 284


>ref|XP_582319.2| PREDICTED: similar to retinol dehydrogenase 14 (all-trans and
           9-cis) [Bos taurus]
          Length = 420

 Score =  201 bits (512), Expect = 7e-52
 Identities = 111/259 (42%), Positives = 155/259 (59%), Gaps = 17/259 (6%)
 Frame = +2

Query: 206 GARVYIACRDVLKGESAASEIRADT---------KNS----QVLVRKLDLSDTKSIRAFA 346
           GARV + CRD  + E AA ++R +           NS    +++V++LDL+   S+R+F 
Sbjct: 151 GARVIMGCRDRERAEEAAGQLRREVCPAGGPDSGPNSGGAGELVVKELDLASLSSVRSFC 210

Query: 347 EGFLTEEKQLHILINNAGVMLCPYSKTADGFETHLGVNXXXXXXXXXXXXXXXKASAPAR 526
           +  L EE +L +LINNAGV  CPY KT DGFE   GVN               K+SAP+R
Sbjct: 211 QEMLQEEPRLDVLINNAGVFQCPYMKTEDGFEMQFGVNHLGHFLLTNLLLGLLKSSAPSR 270

Query: 527 VVNLSSVVHHAGKIRFHDLQGEKHYNRGFAYCHSKLANVLFTRELAKRLQGTGVTTYAVH 706
           +V +SS ++  G I F DL  E+ YN+ F Y  SKLAN+LFTRELA+RL+GT VT   +H
Sbjct: 271 IVVVSSKLYKYGDINFEDLNSEQSYNKSFCYSRSKLANILFTRELARRLEGTSVTVNVLH 330

Query: 707 PGIVQSELVRHSFLLCLLWRLFS----RFLKTAREGAQTSLHCALAEGLEPLSGKYFSDC 874
           PGIV++ L RH  +  L+  LF+     F KT  EGAQT+++ A +  +E +SG+YF DC
Sbjct: 331 PGIVRTNLGRHIHIPLLVRPLFNLVSWAFFKTPEEGAQTAVYLASSPEVEGVSGRYFGDC 390

Query: 875 KRAWVSPRAPE*QNGQALW 931
           K   + P+A +    + LW
Sbjct: 391 KEEELLPKAMDESVARKLW 409


>ref|XP_592820.2| PREDICTED: similar to retinol dehydrogenase 11 (predicted) [Bos
           taurus]
          Length = 377

 Score =  184 bits (466), Expect = 2e-46
 Identities = 115/263 (43%), Positives = 155/263 (58%), Gaps = 7/263 (2%)
 Frame = +2

Query: 191 QLHPSGARVYIACRDVLKGESAASEIRADTKNSQVLVRKLDLSDTKSIRAFAEGFLTEEK 370
           +L   GARV +ACR   +GE+AA ++R ++ N++V+   LDL+   S+RAFA  FL+ E 
Sbjct: 55  ELARRGARVVLACRSRERGEAAAFDLRQESGNNEVIFMALDLASLASVRAFATAFLSSEP 114

Query: 371 QLHILINNAGVMLCPYSKTADGFETHLGVNXXXXXXXXXXXXXXXKASAPARVVNLSSVV 550
           +L ILI+NAG+  C   +T + F   L VN               K SAP+RVV +SS  
Sbjct: 115 RLDILIHNAGISSC--GRTREPFNLLLRVNHIGPFLLTHLLLPRLKTSAPSRVVVVSSAA 172

Query: 551 HHAGKIRF----HDLQGEKHYNRGFAYCHSKLANVLFTRELAKRLQGTGVTTYAVHPGIV 718
           H  G++ F    H + G +   R  AY +SKLANVLF RELA +L+GTGVT YA HPG V
Sbjct: 173 HRRGRLDFTRLDHPVVGWQQELR--AYANSKLANVLFARELATQLEGTGVTCYAAHPGPV 230

Query: 719 QSEL-VRH--SFLLCLLWRLFSRFLKTAREGAQTSLHCALAEGLEPLSGKYFSDCKRAWV 889
            SEL +RH   +L  LL  L    L+  R GAQT L+CAL EG+EPLSG+YF++C    V
Sbjct: 231 NSELFLRHVPGWLRPLLRPLAWLVLRAPRGGAQTPLYCALQEGIEPLSGRYFANCHVEEV 290

Query: 890 SPRAPE*QNGQALWGRQLRAPGI 958
            P A + +    LW    +  G+
Sbjct: 291 PPAARDDRAAHRLWEASRKLAGL 313


>ref|XP_584642.2| PREDICTED: similar to retinol dehydrogenase 11 (predicted) [Bos
           taurus]
          Length = 330

 Score =  137 bits (344), Expect = 2e-32
 Identities = 91/257 (35%), Positives = 144/257 (56%), Gaps = 5/257 (1%)
 Frame = +2

Query: 191 QLHPSGARVYIACRDVLKGESAASEIRADTKNSQVLVRKLDLSDTKSIRAFAEGFLTEEK 370
           +L   GARV +ACR   +G+ A +EI+A +K++++L+ ++DLS   SIR+FA+  L E  
Sbjct: 68  ELAHRGARVILACRSRERGQQALAEIQATSKSNRLLLGEVDLSSMASIRSFAQRLLQECP 127

Query: 371 QLHILINNAGVMLCPYSKTADGFETHLGVNXXXXXXXXXXXXXXXKASAPARVVNLSSVV 550
           ++H+L+NNA V   P + T +G +     N               + +  ARVVN+SS  
Sbjct: 128 EIHLLVNNAAVCGFPTTLTPEGLDLTFATNYTGPFLLTNLLQGALQRAGSARVVNVSSFR 187

Query: 551 HHAGKIRFHDLQGEKH---YNRGFAYCHSKLANVLFTRELAKRLQGTGVTTYAVHPGIVQ 721
              G I    L G      +N+   Y  SKL    FT +LA+RLQGTGVT  +V PG+V 
Sbjct: 188 QSHGYIDEDHLIGAGRPLTFNQN--YDCSKLLLASFTGKLAQRLQGTGVTVNSVDPGVVY 245

Query: 722 SELVRH-SFLLCLLWRLFSRFLKTAREGAQTSLHCALAEGLEPLSGKYFSDCKRAWVSPR 898
           +++++H S+    L+ L S F K +++GA   L+ +LA+ L+ +SGK+FS      + P 
Sbjct: 246 TKIMKHFSWSYRFLFWLLSFFFKDSKQGAVPVLYLSLAKELDGISGKHFSSSCVITLPPE 305

Query: 899 APE*QN-GQALWGRQLR 946
           A +  +  Q+LW   +R
Sbjct: 306 AAQDPHVAQSLWNTSVR 322


>ref|XP_591168.2| PREDICTED: similar to dehydrogenase/reductase (SDR family) X-linked
           [Bos taurus]
          Length = 251

 Score =  127 bits (318), Expect = 2e-29
 Identities = 90/231 (38%), Positives = 119/231 (51%), Gaps = 15/231 (6%)
 Frame = +2

Query: 311 DLSDTKSIRAFAEGFLTEEKQLHILINNAGVMLCPYSKTADGFETHLGVNXXXXXXXXXX 490
           DL+  +SIR F + F  ++  LH+L+NNAGVM+ P   T DGFE H GVN          
Sbjct: 11  DLASMRSIREFVQTFKMKKLPLHVLVNNAGVMMVPQRTTEDGFEEHFGVNYLGHFLLTNL 70

Query: 491 XXXXXKAS-AP---ARVVNLSSVVHHAGKIRFHDLQGEKHYNRGFAYCHSKLANVLFTRE 658
                + S AP   ARVV +SS  H+ G++   DLQ   +Y+   AY  SKLA VLFT  
Sbjct: 71  LLDTLQESGAPGHSARVVTVSSATHYVGELNLDDLQSSTYYSAHAAYAQSKLALVLFTYH 130

Query: 659 LAKRL--QGTGVTTYAVHPGIVQSELVRHSFLLCLLW--RLFSRFL-----KTAREGAQT 811
           L   L  QG  VT     PG+V ++L R+ F     W  RL  + L     KT  EGA T
Sbjct: 131 LQALLTAQGMPVTASVADPGVVDTDLYRYVF-----WGTRLVKKLLGWWVFKTPDEGAWT 185

Query: 812 SLHCALAEGLEPLSGKYFSDCK--RAWVSPRAPE*QNGQALWGRQLRAPGI 958
           S++ A+   LE L G+Y  + K  R+  +   PE Q  + LW R  +  GI
Sbjct: 186 SVYAAVTPALEGLGGRYLYNEKETRSLEATYDPELQ--RQLWARSCQLTGI 234


>ref|XP_584810.2| PREDICTED: similar to retinol dehydrogenase 13 (all-trans and
           9-cis) [Bos taurus]
          Length = 223

 Score =  122 bits (306), Expect = 5e-28
 Identities = 70/158 (44%), Positives = 98/158 (62%), Gaps = 7/158 (4%)
 Frame = +2

Query: 506 KASAPARVVNLSSVVHHAGKIRFHDLQGEKH-YNRGFAYCHSKLANVLFTRELAKRLQGT 682
           KASAP+R++N+SS+ H AG I F DL  EK  Y+   AYC SKLA V+ T+EL++RLQGT
Sbjct: 50  KASAPSRIINVSSLAHVAGHIDFEDLNWEKRKYDTKAAYCQSKLAVVVSTKELSRRLQGT 109

Query: 683 GVTTYAVHPGIVQSELVRH------SFLLCLLWRLFSRFLKTAREGAQTSLHCALAEGLE 844
           GVT  A+HPG+ ++EL RH      +F    L  +F   +K+    AQ S++ A+AE LE
Sbjct: 110 GVTVNALHPGVARTELGRHTGMHSSAFSSFTLGPIFWLLVKSPELAAQPSVYLAVAEELE 169

Query: 845 PLSGKYFSDCKRAWVSPRAPE*QNGQALWGRQLRAPGI 958
            +SGKYF   K    +P A + +  + LW   +R  G+
Sbjct: 170 GVSGKYFDVLKEKPPAPEAEDEEVAKRLWAESVRLVGL 207


>ref|XP_584629.2| PREDICTED: similar to Retinol dehydrogenase 13, partial [Bos
           taurus]
          Length = 148

 Score = 93.2 bits (230), Expect = 4e-19
 Identities = 48/90 (53%), Positives = 59/90 (65%)
 Frame = +2

Query: 191 QLHPSGARVYIACRDVLKGESAASEIRADTKNSQVLVRKLDLSDTKSIRAFAEGFLTEEK 370
           +L   G  + +ACRD+ K E+AA EIR +T N +V  R LDL+  KSIR FA     EE+
Sbjct: 57  ELAKRGGNIILACRDMEKCEAAAKEIRGETLNHRVNARHLDLASLKSIREFAAKVTEEEE 116

Query: 371 QLHILINNAGVMLCPYSKTADGFETHLGVN 460
            +HILINNA VM CP+  T DGFE  LGVN
Sbjct: 117 HVHILINNAAVMRCPHWTTEDGFEMQLGVN 146


>ref|XP_876208.1| PREDICTED: similar to WW domain-containing oxidoreductase isoform 1
           [Bos taurus]
          Length = 745

 Score = 92.8 bits (229), Expect = 5e-19
 Identities = 67/180 (37%), Positives = 93/180 (51%), Gaps = 9/180 (5%)
 Frame = +2

Query: 287 SQVLVRKLDLSDTKSIRAFAEGFLTEEKQLHILINNAGVMLCPYSKTADGFETHLGVNXX 466
           ++V    LDL+  +S++ FA+ F  +   LH+L+ NA V   P++ T DG ET   VN  
Sbjct: 6   AKVEAMTLDLALLRSVQHFAQAFKAKNVSLHVLVCNAAVFGLPWTLTKDGLETTFQVNHL 65

Query: 467 XXXXXXXXXXXXXKASAPARVVNLSSVVHH-------AGKIRFHDLQGEKH-YNRGFAYC 622
                          SAPARVV +SS  H        +GK+ F  L   K+ Y    AY 
Sbjct: 66  GHFYLVQLLQDVLCRSAPARVVVVSSESHRFTDINDSSGKLDFSRLSPSKNDYWAMLAYN 125

Query: 623 HSKLANVLFTRELAKRLQGTGVTTYAVHPG-IVQSELVRHSFLLCLLWRLFSRFLKTARE 799
            SKL N+LF+ EL +RL   GVT+ AVHPG ++ S L R  ++  LL+ L   F K+  E
Sbjct: 126 RSKLCNILFSNELHRRLSPRGVTSNAVHPGNMMYSALHRGWWVYTLLFTLARPFTKSMLE 185


  Database: RefSeqBP
    Posted date:  Aug 1, 2006  7:14 PM
  Number of letters in database: 16,112,626
  Number of sequences in database:  33,508
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 42,237,197
Number of Sequences: 33508
Number of extensions: 1154805
Number of successful extensions: 4456
Number of sequences better than 1.0e-05: 10
Number of HSP's better than  0.0 without gapping: 3828
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4433
length of database: 16,112,626
effective HSP length: 103
effective length of database: 12,661,302
effective search space used: 3633793674
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqCP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611S-056148
         (1174 letters)

Database: RefSeqCP 
           33,732 sequences; 19,266,565 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|XP_547866.2| PREDICTED: similar to retinol dehydrogenase 12 ...   415   e-116
Alignment   gi|XP_854354.1| PREDICTED: similar to Retinol dehydrogenase 11 ...   325   5e-89
Alignment   gi|XP_854127.1| PREDICTED: similar to Retinol dehydrogenase 13 ...   211   1e-54
Alignment   gi|XP_540096.2| PREDICTED: similar to retinol dehydrogenase 14 ...   206   4e-53
Alignment   gi|XP_548293.2| PREDICTED: similar to retinol dehydrogenase 11 ...   179   5e-45
Alignment   gi|XP_857582.1| PREDICTED: similar to retinol dehydrogenase 14 ...   152   5e-37
Alignment   gi|XP_533000.2| PREDICTED: similar to Retinol dehydrogenase 12 ...   143   4e-34
Alignment   gi|XP_852222.1| PREDICTED: similar to dehydrogenase/reductase (...   137   2e-32
Alignment   gi|XP_852623.1| PREDICTED: similar to WW domain-containing oxid...   110   2e-24

>ref|XP_547866.2| PREDICTED: similar to retinol dehydrogenase 12 (all-trans and
           9-cis) [Canis familiaris]
          Length = 303

 Score =  415 bits (1067), Expect = e-116
 Identities = 207/258 (80%), Positives = 218/258 (84%)
 Frame = +2

Query: 191 QLHPSGARVYIACRDVLKGESAASEIRADTKNSQVLVRKLDLSDTKSIRAFAEGFLTEEK 370
           +L   GARVYIACRDVLKGESAASEIRADTKNSQVLVRKLDLSDTKSIRAFAEGFL EEK
Sbjct: 45  ELARRGARVYIACRDVLKGESAASEIRADTKNSQVLVRKLDLSDTKSIRAFAEGFLAEEK 104

Query: 371 QLHILINNAGVMLCPYSKTADGFETHLGVNXXXXXXXXXXXXXXXKASAPARVVNLSSVV 550
           QLHILINNAGVM+CPYSKTADGFETHLGVN               K S PARVVNLSSV 
Sbjct: 105 QLHILINNAGVMMCPYSKTADGFETHLGVNHLGHFLLTHLLLERLKESTPARVVNLSSVA 164

Query: 551 HHAGKIRFHDLQGEKHYNRGFAYCHSKLANVLFTRELAKRLQGTGVTTYAVHPGIVQSEL 730
           HH GKI FHDLQGEK Y+RGFAYCHSKLAN+LFTRELAKRLQGTGVTTYAVHPG+V SEL
Sbjct: 165 HHIGKIHFHDLQGEKRYSRGFAYCHSKLANMLFTRELAKRLQGTGVTTYAVHPGVVSSEL 224

Query: 731 VRHSFLLCLLWRLFSRFLKTAREGAQTSLHCALAEGLEPLSGKYFSDCKRAWVSPRAPE* 910
           VRHSFLLCLLWR+FS F+K+AREGAQTSLHCALAEGLEPLSGKYFSDCKRAWVSPRA + 
Sbjct: 225 VRHSFLLCLLWRIFSPFVKSAREGAQTSLHCALAEGLEPLSGKYFSDCKRAWVSPRARDN 284

Query: 911 QNGQALWGRQLRAPGIPW 964
           +  + LW       GI W
Sbjct: 285 KTAERLWNVSCELLGIQW 302


>ref|XP_854354.1| PREDICTED: similar to Retinol dehydrogenase 11 (Retinal reductase
           1) (RalR1) (Prostate short-chain dehydrogenase/reductase
           1) (Androgen-regulated short-chain
           dehydrogenase/reductase 1) (HCV core-binding protein
           HCBP12) [Canis familiaris]
          Length = 337

 Score =  325 bits (833), Expect = 5e-89
 Identities = 161/257 (62%), Positives = 192/257 (74%)
 Frame = +2

Query: 191 QLHPSGARVYIACRDVLKGESAASEIRADTKNSQVLVRKLDLSDTKSIRAFAEGFLTEEK 370
           +L   GARVY+ACRDVLKGE  A EI+  T N QVLVRKLDL+DTKSIRAFA+GFL EEK
Sbjct: 79  ELAQRGARVYLACRDVLKGELVAREIQTMTGNKQVLVRKLDLADTKSIRAFAKGFLAEEK 138

Query: 371 QLHILINNAGVMLCPYSKTADGFETHLGVNXXXXXXXXXXXXXXXKASAPARVVNLSSVV 550
            LHILINNAGVM+CPY+KT DGFE H+GVN               K SAP+R+VN+SS+ 
Sbjct: 139 HLHILINNAGVMMCPYTKTVDGFEMHMGVNHLGHFLLTHLLLEKLKESAPSRIVNVSSLA 198

Query: 551 HHAGKIRFHDLQGEKHYNRGFAYCHSKLANVLFTRELAKRLQGTGVTTYAVHPGIVQSEL 730
           HH G+I FHDLQGEK YN G AYCHSKLAN+LFT+ELA+RL+G+G+T Y+VHPG V+SEL
Sbjct: 199 HHLGRIHFHDLQGEKFYNSGLAYCHSKLANILFTQELARRLKGSGITAYSVHPGTVKSEL 258

Query: 731 VRHSFLLCLLWRLFSRFLKTAREGAQTSLHCALAEGLEPLSGKYFSDCKRAWVSPRAPE* 910
           VRHS  +  +W LFS F+KT ++GAQTSL+CA+ EGLE LSG +FSDC  AWVS +A   
Sbjct: 259 VRHSPFMKWMWWLFSFFIKTPQQGAQTSLYCAITEGLEVLSGHHFSDCSVAWVSAQARNE 318

Query: 911 QNGQALWGRQLRAPGIP 961
              + LW       GIP
Sbjct: 319 TIARRLWDVSCDLLGIP 335


>ref|XP_854127.1| PREDICTED: similar to Retinol dehydrogenase 13 [Canis familiaris]
          Length = 334

 Score =  211 bits (537), Expect = 1e-54
 Identities = 123/276 (44%), Positives = 162/276 (58%), Gaps = 8/276 (2%)
 Frame = +2

Query: 191 QLHPSGARVYIACRDVLKGESAASEIRADTKNSQVLVRKLDLSDTKSIRAFAEGFLTEEK 370
           +L   G  + +ACRD+ K E+AA EIR +T N +V    LDL+  KSIR FA   + EE+
Sbjct: 57  ELARRGGNIILACRDMEKCEAAAKEIRGETLNHRVSAWHLDLASLKSIREFAAKIIEEEE 116

Query: 371 QLHILINNAGVMLCPYSKTADGFETHLGVNXXXXXXXXXXXXXXXKASAPARVVNLSSVV 550
           Q+HIL+NNA VM CP+  T DGFE   GVN               KASAP+R++NLSS+ 
Sbjct: 117 QVHILVNNAAVMRCPHWTTKDGFEMQFGVNHLGHFLLTNLLLDKLKASAPSRIINLSSLA 176

Query: 551 HHAGKIRFHDLQGEKH-YNRGFAYCHSKLANVLFTRELAKRLQGTGVTTYAVHPGIVQSE 727
           H AG I F DL  EK  Y+   AYC SKLA +LFT+EL++RLQGTGVT  A+HPG+ ++E
Sbjct: 177 HVAGHIDFDDLNWEKRKYDTKAAYCQSKLAVILFTKELSRRLQGTGVTVNALHPGVARTE 236

Query: 728 LVRH------SFLLCLLWRLFSRFLKTAREGAQTSLHCALAEGLEPLSGKYFSDCKRAWV 889
           L RH      +F    L  +F   +K+ +  AQ S + A+AE LE +SGKYF   K    
Sbjct: 237 LGRHTGMHSSAFSSFTLGPIFWLLVKSPQLAAQPSTYLAVAEELEGVSGKYFDGLKEKAP 296

Query: 890 SPRAPE*QNGQALWGRQLRAPGIPW-GVKLLGNAPL 994
           +P A + +  Q LW    R  G+   GV  +   PL
Sbjct: 297 APEAEDEEVAQRLWAESARLVGLEMSGVSSVRGQPL 332


>ref|XP_540096.2| PREDICTED: similar to retinol dehydrogenase 14 (all-trans and
           9-cis) isoform 1 [Canis familiaris]
          Length = 336

 Score =  206 bits (524), Expect = 4e-53
 Identities = 112/259 (43%), Positives = 155/259 (59%), Gaps = 17/259 (6%)
 Frame = +2

Query: 206 GARVYIACRDVLKGESAASEIRADTKNS-------------QVLVRKLDLSDTKSIRAFA 346
           GARV + CRD  + E AA ++R + + +             +++VR+LDL+  +S+RAF 
Sbjct: 67  GARVIMGCRDRARAEEAAGQLRRELRQAGGREPGSDVGAAGELVVRELDLASLRSVRAFC 126

Query: 347 EGFLTEEKQLHILINNAGVMLCPYSKTADGFETHLGVNXXXXXXXXXXXXXXXKASAPAR 526
           +  L EE +L +LINNAG+  CPY KT DGFE   GVN               K SAP+R
Sbjct: 127 QEVLQEEPRLDVLINNAGIFQCPYMKTEDGFEMQFGVNHLGHFLLTNLLLGLLKNSAPSR 186

Query: 527 VVNLSSVVHHAGKIRFHDLQGEKHYNRGFAYCHSKLANVLFTRELAKRLQGTGVTTYAVH 706
           +V +SS ++  G I F DL  E+ YN+ F Y  SKLAN+LFTRELA+RL+GT VT   +H
Sbjct: 187 IVVVSSKLYKYGDINFEDLNSEQSYNKSFCYSRSKLANILFTRELARRLEGTNVTVNVLH 246

Query: 707 PGIVQSELVRHSFLLCLLWRLFS----RFLKTAREGAQTSLHCALAEGLEPLSGKYFSDC 874
           PGIV++ L RH  +  L+  LF+     F KT  EGAQTS++ A +  +E +SGKYF DC
Sbjct: 247 PGIVRTNLGRHIHIPLLVRPLFNLVSWAFFKTPVEGAQTSVYLASSPEVEGVSGKYFGDC 306

Query: 875 KRAWVSPRAPE*QNGQALW 931
           K   + P+A +    + LW
Sbjct: 307 KEEELLPKAMDESVARKLW 325


>ref|XP_548293.2| PREDICTED: similar to retinol dehydrogenase 11 (predicted) [Canis
           familiaris]
          Length = 377

 Score =  179 bits (454), Expect = 5e-45
 Identities = 115/263 (43%), Positives = 151/263 (57%), Gaps = 7/263 (2%)
 Frame = +2

Query: 191 QLHPSGARVYIACRDVLKGESAASEIRADTKNSQVLVRKLDLSDTKSIRAFAEGFLTEEK 370
           +L   GARV +ACR   +GE+AA ++R ++ N++V+   LDL+   S+RAFA  FL+ E 
Sbjct: 55  ELARRGARVVLACRSRERGEAAAFDLRQESGNNEVIFMALDLASLASVRAFATAFLSSEP 114

Query: 371 QLHILINNAGVMLCPYSKTADGFETHLGVNXXXXXXXXXXXXXXXKASAPARVVNLSSVV 550
           +L ILI+NAG+  C   +T   F   L VN               K  AP+RVV +SS  
Sbjct: 115 RLDILIHNAGISSC--GRTHKPFNLLLRVNHIGPFLLTHLLLPRLKTCAPSRVVVVSSAA 172

Query: 551 HHAGKIRFHDLQ----GEKHYNRGFAYCHSKLANVLFTRELAKRLQGTGVTTYAVHPGIV 718
           H  G++ F  L     G +   R  AY  SKLANVLF RELA +L+GTGVT YA HPG V
Sbjct: 173 HRRGRLDFTRLDRPVVGWQQELR--AYADSKLANVLFARELATQLEGTGVTCYAAHPGPV 230

Query: 719 QSEL-VRH--SFLLCLLWRLFSRFLKTAREGAQTSLHCALAEGLEPLSGKYFSDCKRAWV 889
            SEL +RH   +L  LL  L    L+  R GAQT L+CAL EG+EPLSG+YF++C    V
Sbjct: 231 NSELFLRHVPGWLCPLLRPLAWLMLRAPRGGAQTPLYCALQEGIEPLSGRYFANCHVEEV 290

Query: 890 SPRAPE*QNGQALWGRQLRAPGI 958
            P A + +    LW    R  G+
Sbjct: 291 PPAARDDRAAHQLWEASKRLAGL 313


>ref|XP_857582.1| PREDICTED: similar to retinol dehydrogenase 14 (all-trans and
           9-cis) isoform 4 [Canis familiaris]
          Length = 307

 Score =  152 bits (385), Expect = 5e-37
 Identities = 94/259 (36%), Positives = 134/259 (51%), Gaps = 17/259 (6%)
 Frame = +2

Query: 206 GARVYIACRDVLKGESAASEIRADTKNS-------------QVLVRKLDLSDTKSIRAFA 346
           GARV + CRD  + E AA ++R + + +             +++VR+LDL+  +S+RAF 
Sbjct: 67  GARVIMGCRDRARAEEAAGQLRRELRQAGGREPGSDVGAAGELVVRELDLASLRSVRAFC 126

Query: 347 EGFLTEEKQLHILINNAGVMLCPYSKTADGFETHLGVNXXXXXXXXXXXXXXXKASAPAR 526
           +  L                               GVN               K SAP+R
Sbjct: 127 QEVL-----------------------------QFGVNHLGHFLLTNLLLGLLKNSAPSR 157

Query: 527 VVNLSSVVHHAGKIRFHDLQGEKHYNRGFAYCHSKLANVLFTRELAKRLQGTGVTTYAVH 706
           +V +SS ++  G I F DL  E+ YN+ F Y  SKLAN+LFTRELA+RL+GT VT   +H
Sbjct: 158 IVVVSSKLYKYGDINFEDLNSEQSYNKSFCYSRSKLANILFTRELARRLEGTNVTVNVLH 217

Query: 707 PGIVQSELVRHSFLLCLLWRLFS----RFLKTAREGAQTSLHCALAEGLEPLSGKYFSDC 874
           PGIV++ L RH  +  L+  LF+     F KT  EGAQTS++ A +  +E +SGKYF DC
Sbjct: 218 PGIVRTNLGRHIHIPLLVRPLFNLVSWAFFKTPVEGAQTSVYLASSPEVEGVSGKYFGDC 277

Query: 875 KRAWVSPRAPE*QNGQALW 931
           K   + P+A +    + LW
Sbjct: 278 KEEELLPKAMDESVARKLW 296


>ref|XP_533000.2| PREDICTED: similar to Retinol dehydrogenase 12 [Canis familiaris]
          Length = 596

 Score =  143 bits (360), Expect = 4e-34
 Identities = 93/255 (36%), Positives = 142/255 (55%), Gaps = 3/255 (1%)
 Frame = +2

Query: 191  QLHPSGARVYIACRDVLKGESAASEIRADTKNSQVLVRKLDLSDTKSIRAFAEGFLTEEK 370
            +L   GARV +ACR+  +G+ A +EI+  +K + +L+ ++DLS   SIR+FA   L E  
Sbjct: 334  ELARRGARVILACRNWERGQKALAEIQVASKGTCLLLGQVDLSSMASIRSFARWLLQEYP 393

Query: 371  QLHILINNAGVMLCPYSKTADGFETHLGVNXXXXXXXXXXXXXXXKASAPARVVNLSSVV 550
            ++H+L+NNA +   P + T +G +     N               + +  ARVVN+SS  
Sbjct: 394  EIHLLVNNAAISGFPKTLTPEGLDLTFATNYVGPFLLTNLLQGALQRAGSARVVNVSSFR 453

Query: 551  HHAGKIRFHDLQGE-KHYNRGFAYCHSKLANVLFTRELAKRLQGTGVTTYAVHPGIVQSE 727
            H  G +    L G  K  N   +Y  SKL    FT ELA+RLQGTGVT  +V PG+V +E
Sbjct: 454  HAHGYVDEKHLTGAGKPLNLIQSYDCSKLLLTSFTGELARRLQGTGVTVNSVDPGVVYTE 513

Query: 728  LVR-HSFLLCLLWRLFSRFLKTAREGAQTSLHCALAEGLEPLSGKYF-SDCKRAWVSPRA 901
            +++ + +L   L+ LFS F K  ++GA   L+ +LA+ L+ +SGKYF S C     +  A
Sbjct: 514  IMKPYPWLYRFLFWLFSFFCKDVKQGAIPVLYLSLAKELDGVSGKYFSSSCMITLPTEAA 573

Query: 902  PE*QNGQALWGRQLR 946
             + Q  Q+LW   ++
Sbjct: 574  QDPQVAQSLWNASVQ 588


>ref|XP_852222.1| PREDICTED: similar to dehydrogenase/reductase (SDR family) X-linked
           [Canis familiaris]
          Length = 387

 Score =  137 bits (346), Expect = 2e-32
 Identities = 96/259 (37%), Positives = 130/259 (50%), Gaps = 8/259 (3%)
 Frame = +2

Query: 206 GARVYIACRDVLKGESAASEIRADTKNSQVLVRKLDLSDTKSIRAFAEGFLTEEKQLHIL 385
           G  V +A  +         +I+ +T N +V     DL+  +SIR F + F  ++  LH+L
Sbjct: 119 GMHVILAGNNDSSAPDVVRKIQEETLNDKVEFLYCDLASLRSIRQFVQKFKKKKIPLHVL 178

Query: 386 INNAGVMLCPYSKTADGFETHLGVNXXXXXXXXXXXXXXXKAS-AP---ARVVNLSSVVH 553
           +NNAGVM+ P   T DGFE H G+N               K S AP   ARVV +SS  H
Sbjct: 179 VNNAGVMMVPERTTEDGFEEHFGLNYLGHFLLTNLLLDTLKESGAPGRCARVVTVSSATH 238

Query: 554 HAGKIRFHDLQGEKHYNRGFAYCHSKLANVLFTRELAKRL--QGTGVTTYAVHPGIVQSE 727
           + G++   DLQG + Y+   AY  SKLA VLFT  L + L  QG+ VT   V PG+V + 
Sbjct: 239 YIGELDMDDLQGSRCYSPHAAYAQSKLALVLFTYHLQRLLAAQGSPVTANVVDPGVVNTN 298

Query: 728 LVRHSFL-LCLLWRLFS-RFLKTAREGAQTSLHCALAEGLEPLSGKYFSDCKRAWVSPRA 901
           L RH F    L+ +LF   F KT  EGA TS++ A+   LE L G+Y  + K        
Sbjct: 299 LYRHVFWGTRLIKKLFGWWFFKTPDEGAWTSVYAAVTPDLEGLGGRYLYNEKETKSLAVT 358

Query: 902 PE*QNGQALWGRQLRAPGI 958
            +      LW R  +  GI
Sbjct: 359 YDLDLQTELWARSCQMTGI 377


>ref|XP_852623.1| PREDICTED: similar to WW domain-containing oxidoreductase isoform 1
           [Canis familiaris]
          Length = 383

 Score =  110 bits (276), Expect = 2e-24
 Identities = 74/204 (36%), Positives = 106/204 (51%), Gaps = 9/204 (4%)
 Frame = +2

Query: 206 GARVYIACRDVLKGESAASEIRADTKNSQVLVRKLDLSDTKSIRAFAEGFLTEEKQLHIL 385
           GA V +ACR++ +   A S+I  +   ++V    LDL+  +S++ FA+ F  +   LH+L
Sbjct: 148 GAHVILACRNMTRANEAVSQILGEWHKAKVEAMTLDLALLRSVQHFAQAFKAKNVSLHVL 207

Query: 386 INNAGVMLCPYSKTADGFETHLGVNXXXXXXXXXXXXXXXKASAPARVVNLSSVVHH--- 556
           + NA     P+S T DG ET   VN                 SAPARVV +SS  H    
Sbjct: 208 VCNAAAFALPWSLTKDGLETTFQVNHLGHFYLVQLLQDVLCRSAPARVVVVSSESHRFTD 267

Query: 557 ----AGKIRFHDLQGEK-HYNRGFAYCHSKLANVLFTRELAKRLQGTGVTTYAVHPG-IV 718
               +GK+ F  L   K  Y    AY  SKL N+LF+ EL +RL   GVT+ AVHPG ++
Sbjct: 268 INDSSGKLDFSRLSPSKSDYWAMLAYNRSKLCNILFSNELHRRLSPRGVTSNAVHPGNMM 327

Query: 719 QSELVRHSFLLCLLWRLFSRFLKT 790
            S + R+ ++  LL+ L   F K+
Sbjct: 328 YSSIHRNWWVYTLLFTLARPFTKS 351


  Database: RefSeqCP
    Posted date:  Aug 1, 2006  9:25 PM
  Number of letters in database: 19,266,565
  Number of sequences in database:  33,732
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 49,426,462
Number of Sequences: 33732
Number of extensions: 1348691
Number of successful extensions: 5198
Number of sequences better than 1.0e-05: 9
Number of HSP's better than  0.0 without gapping: 4394
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5175
length of database: 19,266,565
effective HSP length: 105
effective length of database: 15,724,705
effective search space used: 4481540925
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqHP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611S-056148
         (1174 letters)

Database: RefSeqHP 
           39,411 sequences; 17,774,539 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_689656.1| retinol dehydrogenase 12 (all-trans and 9-cis) ...   410   e-114
Alignment   gi|NP_057110.2| androgen-regulated short-chain dehydrogenase/re...   331   6e-91
Alignment   gi|NP_065956.1| retinol dehydrogenase 14 (all-trans and 9-cis) ...   207   2e-53
Alignment   gi|NP_612421.1| retinol dehydrogenase 13 (all-trans and 9-cis) ...   191   1e-48
Alignment   gi|NP_653284.1| hypothetical protein LOC147015 [Homo sapiens]        177   1e-44
Alignment   gi|NP_057457.1| WW domain-containing oxidoreductase isoform 1 [...   145   5e-35
Alignment   gi|NP_660160.1| dehydrogenase/reductase (SDR family) X-linked [...   136   4e-32
Alignment   gi|NP_078981.1| hypothetical protein FLJ13639 isoform 2 [Homo s...    67   4e-11
Alignment   gi|NP_001026889.1| hypothetical protein FLJ13639 isoform 1 [Hom...    60   5e-09
Alignment   gi|XP_371503.3| PREDICTED: similar to short-chain dehydrogenase...    59   6e-09

>ref|NP_689656.1| retinol dehydrogenase 12 (all-trans and 9-cis) [Homo sapiens]
          Length = 316

 Score =  410 bits (1053), Expect = e-114
 Identities = 206/258 (79%), Positives = 215/258 (83%)
 Frame = +2

Query: 191 QLHPSGARVYIACRDVLKGESAASEIRADTKNSQVLVRKLDLSDTKSIRAFAEGFLTEEK 370
           +L   GARVYIACRDVLKGESAASEIR DTKNSQVLVRKLDLSDTKSIRAFAEGFL EEK
Sbjct: 58  ELASRGARVYIACRDVLKGESAASEIRVDTKNSQVLVRKLDLSDTKSIRAFAEGFLAEEK 117

Query: 371 QLHILINNAGVMLCPYSKTADGFETHLGVNXXXXXXXXXXXXXXXKASAPARVVNLSSVV 550
           QLHILINNAGVM+CPYSKTADGFETHLGVN               K SAPARVVN+SSV 
Sbjct: 118 QLHILINNAGVMMCPYSKTADGFETHLGVNHLGHFLLTYLLLEQLKVSAPARVVNVSSVA 177

Query: 551 HHAGKIRFHDLQGEKHYNRGFAYCHSKLANVLFTRELAKRLQGTGVTTYAVHPGIVQSEL 730
           HH GKI FHDLQ EK Y+RGFAYCHSKLANVLFTRELAKRLQGTGVTTYAVHPG+V+SEL
Sbjct: 178 HHIGKIPFHDLQSEKRYSRGFAYCHSKLANVLFTRELAKRLQGTGVTTYAVHPGVVRSEL 237

Query: 731 VRHSFLLCLLWRLFSRFLKTAREGAQTSLHCALAEGLEPLSGKYFSDCKRAWVSPRAPE* 910
           VRHS LLCLLWRLFS F+KTAREGAQTSLHCALAEGLEPLSGKYFSDCKR WVSPRA   
Sbjct: 238 VRHSSLLCLLWRLFSPFVKTAREGAQTSLHCALAEGLEPLSGKYFSDCKRTWVSPRARNN 297

Query: 911 QNGQALWGRQLRAPGIPW 964
           +  + LW       GI W
Sbjct: 298 KTAERLWNVSCELLGIRW 315


>ref|NP_057110.2| androgen-regulated short-chain dehydrogenase/reductase 1 [Homo
           sapiens]
          Length = 318

 Score =  331 bits (849), Expect = 6e-91
 Identities = 165/257 (64%), Positives = 193/257 (75%)
 Frame = +2

Query: 191 QLHPSGARVYIACRDVLKGESAASEIRADTKNSQVLVRKLDLSDTKSIRAFAEGFLTEEK 370
           +L   GARVY+ACRDV KGE  A EI+  T N QVLVRKLDLSDTKSIRAFA+GFL EEK
Sbjct: 60  ELAQRGARVYLACRDVEKGELVAKEIQTTTGNQQVLVRKLDLSDTKSIRAFAKGFLAEEK 119

Query: 371 QLHILINNAGVMLCPYSKTADGFETHLGVNXXXXXXXXXXXXXXXKASAPARVVNLSSVV 550
            LH+LINNAGVM+CPYSKTADGFE H+GVN               K SAP+R+VN+SS+ 
Sbjct: 120 HLHVLINNAGVMMCPYSKTADGFEMHIGVNHLGHFLLTHLLLEKLKESAPSRIVNVSSLA 179

Query: 551 HHAGKIRFHDLQGEKHYNRGFAYCHSKLANVLFTRELAKRLQGTGVTTYAVHPGIVQSEL 730
           HH G+I FH+LQGEK YN G AYCHSKLAN+LFT+ELA+RL+G+GVTTY+VHPG VQSEL
Sbjct: 180 HHLGRIHFHNLQGEKFYNAGLAYCHSKLANILFTQELARRLKGSGVTTYSVHPGTVQSEL 239

Query: 731 VRHSFLLCLLWRLFSRFLKTAREGAQTSLHCALAEGLEPLSGKYFSDCKRAWVSPRAPE* 910
           VRHS  +  +W LFS F+KT ++GAQTSLHCAL EGLE LSG +FSDC  AWVS +A   
Sbjct: 240 VRHSSFMRWMWWLFSFFIKTPQQGAQTSLHCALTEGLEILSGNHFSDCHVAWVSVQARNE 299

Query: 911 QNGQALWGRQLRAPGIP 961
              + LW       G+P
Sbjct: 300 TIARRLWDVSCDLLGLP 316


>ref|NP_065956.1| retinol dehydrogenase 14 (all-trans and 9-cis) [Homo sapiens]
          Length = 336

 Score =  207 bits (526), Expect = 2e-53
 Identities = 111/259 (42%), Positives = 156/259 (60%), Gaps = 17/259 (6%)
 Frame = +2

Query: 206 GARVYIACRDVLKGESAASEIRADTKNS-------------QVLVRKLDLSDTKSIRAFA 346
           GARV + CRD  + E AA ++R + + +             +++VR+LDL+  +S+RAF 
Sbjct: 67  GARVIMGCRDRARAEEAAGQLRRELRQAAECGPEPGVSGVGELIVRELDLASLRSVRAFC 126

Query: 347 EGFLTEEKQLHILINNAGVMLCPYSKTADGFETHLGVNXXXXXXXXXXXXXXXKASAPAR 526
           +  L EE +L +LINNAG+  CPY KT DGFE   GVN               K+SAP+R
Sbjct: 127 QEMLQEEPRLDVLINNAGIFQCPYMKTEDGFEMQFGVNHLGHFLLTNLLLGLLKSSAPSR 186

Query: 527 VVNLSSVVHHAGKIRFHDLQGEKHYNRGFAYCHSKLANVLFTRELAKRLQGTGVTTYAVH 706
           +V +SS ++  G I F DL  E+ YN+ F Y  SKLAN+LFTRELA+RL+GT VT   +H
Sbjct: 187 IVVVSSKLYKYGDINFDDLNSEQSYNKSFCYSRSKLANILFTRELARRLEGTNVTVNVLH 246

Query: 707 PGIVQSELVRHSFLLCLLWRLFS----RFLKTAREGAQTSLHCALAEGLEPLSGKYFSDC 874
           PGIV++ L RH  +  L+  LF+     F KT  EGAQTS++ A +  +E +SG+YF DC
Sbjct: 247 PGIVRTNLGRHIHIPLLVKPLFNLVSWAFFKTPVEGAQTSIYLASSPEVEGVSGRYFGDC 306

Query: 875 KRAWVSPRAPE*QNGQALW 931
           K   + P+A +    + LW
Sbjct: 307 KEEELLPKAMDESVARKLW 325


>ref|NP_612421.1| retinol dehydrogenase 13 (all-trans and 9-cis) [Homo sapiens]
          Length = 260

 Score =  191 bits (485), Expect = 1e-48
 Identities = 110/246 (44%), Positives = 146/246 (59%), Gaps = 7/246 (2%)
 Frame = +2

Query: 242 KGESAASEIRADTKNSQVLVRKLDLSDTKSIRAFAEGFLTEEKQLHILINNAGVMLCPYS 421
           K E+AA +IR +T N  V  R LDL+  KSIR FA   + EE+++ ILINNAGVM CP+ 
Sbjct: 3   KCEAAAKDIRGETLNHHVNARHLDLASLKSIREFAAKIIEEEERVDILINNAGVMRCPHW 62

Query: 422 KTADGFETHLGVNXXXXXXXXXXXXXXXKASAPARVVNLSSVVHHAGKIRFHDLQGE-KH 598
            T DGFE   GVN               KASAP+R++NLSS+ H AG I F DL  + + 
Sbjct: 63  TTEDGFEMQFGVNHLGHFLLTNLLLDKLKASAPSRIINLSSLAHVAGHIDFDDLNWQTRK 122

Query: 599 YNRGFAYCHSKLANVLFTRELAKRLQGTGVTTYAVHPGIVQSELVRH------SFLLCLL 760
           YN   AYC SKLA VLFT+EL++RLQG+GVT  A+HPG+ ++EL RH      +F    L
Sbjct: 123 YNTKAAYCQSKLAIVLFTKELSRRLQGSGVTVNALHPGVARTELGRHTGIHGSTFSSTTL 182

Query: 761 WRLFSRFLKTAREGAQTSLHCALAEGLEPLSGKYFSDCKRAWVSPRAPE*QNGQALWGRQ 940
             +F   +K+    AQ S + A+AE L  +SGKYF   K+   +P A + +  + LW   
Sbjct: 183 GPIFWLLVKSPELAAQPSTYLAVAEELADVSGKYFDGLKQKAPAPEAEDEEVARRLWAES 242

Query: 941 LRAPGI 958
            R  G+
Sbjct: 243 ARLVGL 248


>ref|NP_653284.1| hypothetical protein LOC147015 [Homo sapiens]
          Length = 327

 Score =  177 bits (450), Expect = 1e-44
 Identities = 113/263 (42%), Positives = 152/263 (57%), Gaps = 7/263 (2%)
 Frame = +2

Query: 191 QLHPSGARVYIACRDVLKGESAASEIRADTKNSQVLVRKLDLSDTKSIRAFAEGFLTEEK 370
           +L   GARV +ACR   +GE+AA ++R ++ N++V+   LDL+   S+RAFA  FL+ E 
Sbjct: 5   ELARRGARVVLACRSQERGEAAAFDLRQESGNNEVIFMALDLASLASVRAFATAFLSSEP 64

Query: 371 QLHILINNAGVMLCPYSKTADGFETHLGVNXXXXXXXXXXXXXXXKASAPARVVNLSSVV 550
           +L ILI+NAG+  C   +T + F   L VN               KA AP+RVV ++S  
Sbjct: 65  RLDILIHNAGISSC--GRTREAFNLLLRVNHIGPFLLTHLLLPCLKACAPSRVVVVASAA 122

Query: 551 HHAGKIRFHDLQ----GEKHYNRGFAYCHSKLANVLFTRELAKRLQGTGVTTYAVHPGIV 718
           H  G++ F  L     G +   R  AY  +KLANVLF RELA +L+ TGVT YA HPG V
Sbjct: 123 HCRGRLDFKRLDRPVVGWRQELR--AYADTKLANVLFARELANQLEATGVTCYAAHPGPV 180

Query: 719 QSEL-VRH--SFLLCLLWRLFSRFLKTAREGAQTSLHCALAEGLEPLSGKYFSDCKRAWV 889
            SEL +RH   +L  LL  L    L+  R GAQT L+CAL EG+EPLSG+YF++C    V
Sbjct: 181 NSELFLRHVPGWLRPLLRPLAWLVLRAPRGGAQTPLYCALQEGIEPLSGRYFANCHVEEV 240

Query: 890 SPRAPE*QNGQALWGRQLRAPGI 958
            P A + +    LW    R  G+
Sbjct: 241 PPAARDDRAAHRLWEASKRLAGL 263


>ref|NP_057457.1| WW domain-containing oxidoreductase isoform 1 [Homo sapiens]
          Length = 414

 Score =  145 bits (367), Expect = 5e-35
 Identities = 92/251 (36%), Positives = 131/251 (52%), Gaps = 9/251 (3%)
 Frame = +2

Query: 206 GARVYIACRDVLKGESAASEIRADTKNSQVLVRKLDLSDTKSIRAFAEGFLTEEKQLHIL 385
           GA V +ACR++ +   A S I  +   ++V    LDL+  +S++ FAE F  +   LH+L
Sbjct: 148 GAHVILACRNMARASEAVSRILEEWHKAKVEAMTLDLALLRSVQHFAEAFKAKNVPLHVL 207

Query: 386 INNAGVMLCPYSKTADGFETHLGVNXXXXXXXXXXXXXXXKASAPARVVNLSSVVHH--- 556
           + NA     P+S T DG ET   VN                 SAPARV+ +SS  H    
Sbjct: 208 VCNAATFALPWSLTKDGLETTFQVNHLGHFYLVQLLQDVLCRSAPARVIVVSSESHRFTD 267

Query: 557 ----AGKIRFHDLQGEKH-YNRGFAYCHSKLANVLFTRELAKRLQGTGVTTYAVHPG-IV 718
                GK+ F  L   K+ Y    AY  SKL N+LF+ EL +RL   GVT+ AVHPG ++
Sbjct: 268 INDSLGKLDFSRLSPTKNDYWAMLAYNRSKLCNILFSNELHRRLSPRGVTSNAVHPGNMM 327

Query: 719 QSELVRHSFLLCLLWRLFSRFLKTAREGAQTSLHCALAEGLEPLSGKYFSDCKRAWVSPR 898
            S + R  ++  LL+ L   F K+ ++GA T+++CA    LE L G YF++C R   SP 
Sbjct: 328 YSNIHRSWWVYTLLFTLARPFTKSMQQGAATTVYCAAVPELEGLGGMYFNNCCRCMPSPE 387

Query: 899 APE*QNGQALW 931
           A   +  + LW
Sbjct: 388 AQSEETARTLW 398


>ref|NP_660160.1| dehydrogenase/reductase (SDR family) X-linked [Homo sapiens]
          Length = 330

 Score =  136 bits (342), Expect = 4e-32
 Identities = 93/263 (35%), Positives = 127/263 (48%), Gaps = 12/263 (4%)
 Frame = +2

Query: 206 GARVYIACRDVLKGESAASEIRADTKNSQVLVRKLDLSDTKSIRAFAEGFLTEEKQLHIL 385
           G  V IA  +  K +   S+I+ +T N +V     DL+   SIR F + F  ++  LH+L
Sbjct: 67  GMHVIIAGNNDSKAKQVVSKIKEETLNDKVEFLYCDLASMTSIRQFVQKFKMKKIPLHVL 126

Query: 386 INNAGVMLCPYSKTADGFETHLGVNXXXXXXXXXXXXXXXKASA----PARVVNLSSVVH 553
           INNAGVM+ P  KT DGFE H G+N               K S      ARVV +SS  H
Sbjct: 127 INNAGVMMVPQRKTRDGFEEHFGLNYLGHFLLTNLLLDTLKESGSPGHSARVVTVSSATH 186

Query: 554 HAGKIRFHDLQGEKHYNRGFAYCHSKLANVLFTRELAKRL--QGTGVTTYAVHPGIVQSE 727
           +  ++   DLQ    Y+   AY  SKLA VLFT  L + L  +G+ VT   V PG+V ++
Sbjct: 187 YVAELNMDDLQSSACYSPHAAYAQSKLALVLFTYHLQRLLAAEGSHVTANVVDPGVVNTD 246

Query: 728 LVRHSFLLCLL------WRLFSRFLKTAREGAQTSLHCALAEGLEPLSGKYFSDCKRAWV 889
           L +H F    L      W LF    KT  EGA TS++ A+   LE + G+Y  + K    
Sbjct: 247 LYKHVFWATRLAKKLLGWLLF----KTPDEGAWTSIYAAVTPELEGVGGRYLYNEKETKS 302

Query: 890 SPRAPE*QNGQALWGRQLRAPGI 958
                  +  Q LW +     G+
Sbjct: 303 LHVTYNQKLQQQLWSKSCEMTGV 325


>ref|NP_078981.1| hypothetical protein FLJ13639 isoform 2 [Homo sapiens]
          Length = 242

 Score = 66.6 bits (161), Expect = 4e-11
 Identities = 60/207 (28%), Positives = 92/207 (44%), Gaps = 4/207 (1%)
 Frame = +2

Query: 257 ASEIRADTKNSQVLVRKLDLSDTKSIRAFAEGFLTEEKQLHILINNAGVMLCPYSKTADG 436
           A ++   + +  + +  +DLSD K I  F E F  E K LH+LINNAG M+     T DG
Sbjct: 32  AKQLPLKSPSENIFLHIVDLSDPKQIWKFVENFKQEHK-LHVLINNAGCMVNKRELTEDG 90

Query: 437 FETHLGVNXXXXXXXXXXXXXXXKASAPARVVNLSSVVHHAGKIRFHDLQGEK-HYNRGF 613
            E +   N               +     RV+ +SS      K+  +DLQ E+  ++   
Sbjct: 91  LEKNFAANTLGVYILTTGLIPVLEKEHDPRVITVSSGGMLVQKLNTNDLQSERTPFDGTM 150

Query: 614 AYCHSKLANVLFTRELAKRLQG-TGVTTYAVHPGIVQSELVRHSFLLCLLWRLFSRFLKT 790
            Y  +K   V+ T   A   QG   +   ++HPG   +  VR +  +      F   L++
Sbjct: 151 VYAQNKRQQVVLTERWA---QGHPAIHFSSMHPGWADTPGVRQA--MPGFHARFGDRLRS 205

Query: 791 AREGAQTSLHCAL--AEGLEPLSGKYF 865
             +GA T L  AL  A   +P SG++F
Sbjct: 206 EAQGADTMLWLALSSAAAAQP-SGRFF 231


>ref|NP_001026889.1| hypothetical protein FLJ13639 isoform 1 [Homo sapiens]
          Length = 271

 Score = 59.7 bits (143), Expect = 5e-09
 Identities = 45/154 (29%), Positives = 68/154 (44%), Gaps = 2/154 (1%)
 Frame = +2

Query: 257 ASEIRADTKNSQVLVRKLDLSDTKSIRAFAEGFLTEEKQLHILINNAGVMLCPYSKTADG 436
           A ++   + +  + +  +DLSD K I  F E F  E K LH+LINNAG M+     T DG
Sbjct: 32  AKQLPLKSPSENIFLHIVDLSDPKQIWKFVENFKQEHK-LHVLINNAGCMVNKRELTEDG 90

Query: 437 FETHLGVNXXXXXXXXXXXXXXXKASAPARVVNLSSVVHHAGKIRFHDLQGEK-HYNRGF 613
            E +   N               +     RV+ +SS      K+  +DLQ E+  ++   
Sbjct: 91  LEKNFAANTLGVYILTTGLIPVLEKEHDPRVITVSSGGMLVQKLNTNDLQSERTPFDGTM 150

Query: 614 AYCHSKLANVLFTRELAKRLQG-TGVTTYAVHPG 712
            Y  +K   V+ T   A   QG   +   ++HPG
Sbjct: 151 VYAQNKRQQVVLTERWA---QGHPAIHFSSMHPG 181


>ref|XP_371503.3| PREDICTED: similar to short-chain dehydrogenase/reductase 1 [Homo
           sapiens]
          Length = 891

 Score = 59.3 bits (142), Expect = 6e-09
 Identities = 30/80 (37%), Positives = 52/80 (65%), Gaps = 1/80 (1%)
 Frame = +2

Query: 206 GARVYIACRDVLKGESAASEIRADTKNSQVLVRKLDLSDTKSIRAFAEGFLTEEKQLHIL 385
           GA+V + C+    G+ A +EI+A + ++++L+ ++DLS   SIR+FA   L E  ++H+L
Sbjct: 626 GAQVILTCQSRECGQQALAEIQAASNSNRLLLGEVDLSSMTSIRSFARRLLQENPEIHLL 685

Query: 386 INNAGVM-LCPYSKTADGFE 442
           +NNAGV  + P + T  G +
Sbjct: 686 VNNAGVSGMIPKTLTPGGLD 705


  Database: RefSeqHP
    Posted date:  Aug 2, 2006 12:57 AM
  Number of letters in database: 17,774,539
  Number of sequences in database:  39,411
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 48,186,021
Number of Sequences: 39411
Number of extensions: 1368364
Number of successful extensions: 5342
Number of sequences better than 1.0e-05: 10
Number of HSP's better than  0.0 without gapping: 4520
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5318
length of database: 17,774,539
effective HSP length: 104
effective length of database: 13,675,795
effective search space used: 3911277370
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqMP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611S-056148
         (1174 letters)

Database: RefSeqMP 
           45,328 sequences; 21,768,885 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_084293.1| retinol dehydrogenase 12 [Mus musculus]              372   e-103
Alignment   gi|NP_067532.2| short-chain dehydrogenase/reductase 1 [Mus musc...   320   1e-87
Alignment   gi|NP_076186.1| alcohol dehydrogenase PAN2 [Mus musculus]            210   3e-54
Alignment   gi|NP_780581.1| retinol dehydrogenase 13 (all-trans and 9-cis) ...   199   5e-51
Alignment   gi|NP_062519.2| WW-domain oxidoreductase [Mus musculus]              145   1e-34
Alignment   gi|NP_001028498.1| dehydrogenase/reductase (SDR family) X chrom...   134   1e-31
Alignment   gi|NP_899109.1| hypothetical protein LOC70451 [Mus musculus]         131   2e-30
Alignment   gi|NP_079798.1| retinal short-chain dehydrogenase/reductase 4 [...    50   4e-06

>ref|NP_084293.1| retinol dehydrogenase 12 [Mus musculus]
          Length = 316

 Score =  372 bits (956), Expect = e-103
 Identities = 189/258 (73%), Positives = 203/258 (78%)
 Frame = +2

Query: 191 QLHPSGARVYIACRDVLKGESAASEIRADTKNSQVLVRKLDLSDTKSIRAFAEGFLTEEK 370
           +L   GARVYIACRDVLKGESAASEIRADTKNSQVLVRKLDLSDTKSIRAFAE FL EEK
Sbjct: 58  ELARRGARVYIACRDVLKGESAASEIRADTKNSQVLVRKLDLSDTKSIRAFAERFLAEEK 117

Query: 371 QLHILINNAGVMLCPYSKTADGFETHLGVNXXXXXXXXXXXXXXXKASAPARVVNLSSVV 550
           +LHILINNAGVM+CPYSKT DGFETH GVN               K SAPARVVNLSS+ 
Sbjct: 118 KLHILINNAGVMMCPYSKTTDGFETHFGVNHLGHFLLTYLLLERLKESAPARVVNLSSIA 177

Query: 551 HHAGKIRFHDLQGEKHYNRGFAYCHSKLANVLFTRELAKRLQGTGVTTYAVHPGIVQSEL 730
           H  GKIRFHDLQG+K Y   FAY HSKLAN+LFTRELAKRLQGTGVT YAVHPG+V SE+
Sbjct: 178 HLIGKIRFHDLQGQKRYCSAFAYGHSKLANLLFTRELAKRLQGTGVTAYAVHPGVVLSEI 237

Query: 731 VRHSFLLCLLWRLFSRFLKTAREGAQTSLHCALAEGLEPLSGKYFSDCKRAWVSPRAPE* 910
            R+S+LLCLLWRLFS F K+  +GAQTSLHCALAE LEPLSGKYFSDCKR WVS RA   
Sbjct: 238 TRNSYLLCLLWRLFSPFFKSTSQGAQTSLHCALAEDLEPLSGKYFSDCKRMWVSSRARNK 297

Query: 911 QNGQALWGRQLRAPGIPW 964
           +  + LW       GI W
Sbjct: 298 KTAERLWNVSCELLGIQW 315


>ref|NP_067532.2| short-chain dehydrogenase/reductase 1 [Mus musculus]
          Length = 316

 Score =  320 bits (821), Expect = 1e-87
 Identities = 161/252 (63%), Positives = 191/252 (75%)
 Frame = +2

Query: 206 GARVYIACRDVLKGESAASEIRADTKNSQVLVRKLDLSDTKSIRAFAEGFLTEEKQLHIL 385
           GARVY+ACRDV KGE AA EI+A T NSQV VRKLDL+DTKSIRAFA+ FL EEK LH+L
Sbjct: 62  GARVYLACRDVDKGELAAREIQAVTGNSQVFVRKLDLADTKSIRAFAKDFLAEEKHLHLL 121

Query: 386 INNAGVMLCPYSKTADGFETHLGVNXXXXXXXXXXXXXXXKASAPARVVNLSSVVHHAGK 565
           INNAGVM+CPYSKTADGFE H+GVN               K SAP+R+VNLSS+ HH G+
Sbjct: 122 INNAGVMMCPYSKTADGFEMHIGVNHLGHFLLTHLLLEKLKESAPSRIVNLSSLGHHLGR 181

Query: 566 IRFHDLQGEKHYNRGFAYCHSKLANVLFTRELAKRLQGTGVTTYAVHPGIVQSELVRHSF 745
           I FH+LQGEK Y+ G AYCHSKLAN+LFT+ELAKRL+G+GVTTY+VHPG V SEL R+S 
Sbjct: 182 IHFHNLQGEKFYSAGLAYCHSKLANILFTKELAKRLKGSGVTTYSVHPGTVHSELTRYSS 241

Query: 746 LLCLLWRLFSRFLKTAREGAQTSLHCALAEGLEPLSGKYFSDCKRAWVSPRAPE*QNGQA 925
           ++  LW+LF  F+KT +EGAQTSL+CAL EGLE LSG +FSDC+ AWVS +       + 
Sbjct: 242 IMRWLWQLFFVFIKTPQEGAQTSLYCALTEGLESLSGSHFSDCQLAWVSYQGRNEIIARR 301

Query: 926 LWGRQLRAPGIP 961
           LW       G+P
Sbjct: 302 LWDVSCDLLGLP 313


>ref|NP_076186.1| alcohol dehydrogenase PAN2 [Mus musculus]
          Length = 334

 Score =  210 bits (534), Expect = 3e-54
 Identities = 113/256 (44%), Positives = 156/256 (60%), Gaps = 14/256 (5%)
 Frame = +2

Query: 206 GARVYIACRDVLKGESAASEIRA----------DTKNSQVLVRKLDLSDTKSIRAFAEGF 355
           GARV + CRD  + E AA ++R           D  + Q++V++LDL+  +S+RAF +  
Sbjct: 68  GARVIMGCRDRARAEEAAGQLRQELCQAGGAGPDGTDGQLVVKELDLASLRSVRAFCQEL 127

Query: 356 LTEEKQLHILINNAGVMLCPYSKTADGFETHLGVNXXXXXXXXXXXXXXXKASAPARVVN 535
           L EE +L +LINNAGV  CPY+KT DGFE   GVN               K+SAP+R+V 
Sbjct: 128 LQEEPRLDVLINNAGVFHCPYTKTEDGFEMQFGVNHLGHFLLTNLLLGLLKSSAPSRIVV 187

Query: 536 LSSVVHHAGKIRFHDLQGEKHYNRGFAYCHSKLANVLFTRELAKRLQGTGVTTYAVHPGI 715
           +SS ++  G+I F DL  E+ YN+ F Y  SKLAN+LFTRELA+RL+GT VT   +HPGI
Sbjct: 188 VSSKLYKYGEINFEDLNSEQSYNKSFCYSRSKLANILFTRELARRLEGTNVTVNVLHPGI 247

Query: 716 VQSELVRHSFLLCLLWRLFS----RFLKTAREGAQTSLHCALAEGLEPLSGKYFSDCKRA 883
           V++ L RH  +  L   LF+     F KT  EGAQTS++ A +  +E +SG+YF DCK  
Sbjct: 248 VRTNLGRHIHIPLLARPLFNLVSWAFFKTPLEGAQTSIYLACSPDVEGVSGRYFGDCKEE 307

Query: 884 WVSPRAPE*QNGQALW 931
            + P+A +    + LW
Sbjct: 308 ELLPKAMDESVARKLW 323


>ref|NP_780581.1| retinol dehydrogenase 13 (all-trans and 9-cis) [Mus musculus]
          Length = 334

 Score =  199 bits (506), Expect = 5e-51
 Identities = 115/263 (43%), Positives = 154/263 (58%), Gaps = 7/263 (2%)
 Frame = +2

Query: 191 QLHPSGARVYIACRDVLKGESAASEIRADTKNSQVLVRKLDLSDTKSIRAFAEGFLTEEK 370
           +L   G  V +ACRD+ K E AA +IR +T N +V   +LDL+  KSIR FA   + EE+
Sbjct: 57  ELAKRGGNVILACRDMEKCEVAAKDIRGETLNPRVRAERLDLASLKSIREFARKVIKEEE 116

Query: 371 QLHILINNAGVMLCPYSKTADGFETHLGVNXXXXXXXXXXXXXXXKASAPARVVNLSSVV 550
           ++ IL+NNA VM CP+  T DGFE   GVN               KASAP+R++NLSS+ 
Sbjct: 117 RVDILVNNAAVMRCPHWTTEDGFEMQFGVNYLGHFLLTNLLLDKLKASAPSRIINLSSLA 176

Query: 551 HHAGKIRFHDLQGE-KHYNRGFAYCHSKLANVLFTRELAKRLQGTGVTTYAVHPGIVQSE 727
           H AG I F DL  + K Y+   AYC SKLA VLFT+EL+ RLQG+GVT  A+HPG+ ++E
Sbjct: 177 HVAGHIDFEDLNWQMKKYDTKAAYCQSKLAVVLFTKELSHRLQGSGVTVNALHPGVARTE 236

Query: 728 LVRH------SFLLCLLWRLFSRFLKTAREGAQTSLHCALAEGLEPLSGKYFSDCKRAWV 889
           L RH      +F   +L   F    K+ +  AQ S + A+AE LE +SGKYF   +    
Sbjct: 237 LGRHTGMHNSAFSGFMLGPFFWLLFKSPQLAAQPSTYLAVAEELENVSGKYFDGLREKAP 296

Query: 890 SPRAPE*QNGQALWGRQLRAPGI 958
           SP A + +  + LW    R  G+
Sbjct: 297 SPEAEDEEVARRLWTESARLVGL 319


>ref|NP_062519.2| WW-domain oxidoreductase [Mus musculus]
          Length = 414

 Score =  145 bits (365), Expect = 1e-34
 Identities = 91/251 (36%), Positives = 134/251 (53%), Gaps = 9/251 (3%)
 Frame = +2

Query: 206 GARVYIACRDVLKGESAASEIRADTKNSQVLVRKLDLSDTKSIRAFAEGFLTEEKQLHIL 385
           GA V +ACR++ +   A S I  +   ++V    LDL+  +S++ FAE F  +   LH+L
Sbjct: 148 GAHVILACRNLSRASEAVSRILEEWHKAKVEAMTLDLAVLRSVQHFAEAFKAKNVSLHVL 207

Query: 386 INNAGVMLCPYSKTADGFETHLGVNXXXXXXXXXXXXXXXKASAPARVVNLSSVVHH--- 556
           + NAG    P+  T DG ET   VN                 S+PARV+ +SS  H    
Sbjct: 208 VCNAGTFALPWGLTKDGLETTFQVNHLGHFYLVQLLQDVLCRSSPARVIVVSSESHRFTD 267

Query: 557 ----AGKIRFHDLQGEK-HYNRGFAYCHSKLANVLFTRELAKRLQGTGVTTYAVHPG-IV 718
               +GK+    L   +  Y    AY  SKL N+LF+ EL +RL   GVT+ AVHPG ++
Sbjct: 268 INDSSGKLDLSRLSPPRSDYWAMLAYNRSKLCNILFSNELHRRLSPRGVTSNAVHPGNMM 327

Query: 719 QSELVRHSFLLCLLWRLFSRFLKTAREGAQTSLHCALAEGLEPLSGKYFSDCKRAWVSPR 898
            S + R+S++  LL+ L   F K+ ++GA T+++CA+A  LE L G YF++C R   S  
Sbjct: 328 YSAIHRNSWVYKLLFTLARPFTKSMQQGAATTVYCAVAPELEGLGGMYFNNCCRCLPSEE 387

Query: 899 APE*QNGQALW 931
           A   +  +ALW
Sbjct: 388 AQSEETARALW 398


>ref|NP_001028498.1| dehydrogenase/reductase (SDR family) X chromosome [Mus musculus]
          Length = 335

 Score =  134 bits (338), Expect = 1e-31
 Identities = 94/267 (35%), Positives = 129/267 (48%), Gaps = 8/267 (2%)
 Frame = +2

Query: 191 QLHPSGARVYIACRDVLKGESAASEIRADTKNSQVLVRKLDLSDTKSIRAFAEGFLTEEK 370
           QL   G  V +A  D  +G+   S IRA+  + +     LDL+   S+R FA  F     
Sbjct: 62  QLARLGMCVVVAGNDEHRGQEVVSSIRAEMGSDRAHFLPLDLASLASVRGFARDFQALGL 121

Query: 371 QLHILINNAGVMLCPYSKTADGFETHLGVNXXXXXXXXXXXXXXXKASAP----ARVVNL 538
            LH+L+NNAGVML P ++T DGFE HLGVN               +AS      +RVV +
Sbjct: 122 PLHLLVNNAGVMLEPRAETEDGFERHLGVNFLGHFLLTLLLLPALRASGAEGRGSRVVTV 181

Query: 539 SSVVHHAGKIRFHDLQGEKHYNRGFAYCHSKLANVLFTRELAKRLQGTG--VTTYAVHPG 712
            S  H+ G +   DL G   Y+   AY  SKLA  LF  +L + L   G  VT+    PG
Sbjct: 182 GSATHYVGTVDMADLHGRHAYSPYAAYAQSKLALALFALQLQRILDARGDPVTSNMADPG 241

Query: 713 IVQSELVRHSFLLCLLWRLFSRFL--KTAREGAQTSLHCALAEGLEPLSGKYFSDCKRAW 886
           +V +EL RH+  +    + F  +L  K+  EGA T ++ A A  LE + G+Y  D   A 
Sbjct: 242 VVDTELYRHAGWVLRTAKRFLGWLVFKSPEEGAWTLVYAAAAPELEGVGGRYLRDEAEAE 301

Query: 887 VSPRAPE*QNGQALWGRQLRAPGIPWG 967
               A + +  + LW   LR  G   G
Sbjct: 302 PLGTARDQELQRRLWAEGLRLTGAGGG 328


>ref|NP_899109.1| hypothetical protein LOC70451 [Mus musculus]
          Length = 260

 Score =  131 bits (329), Expect = 2e-30
 Identities = 81/188 (43%), Positives = 112/188 (59%), Gaps = 5/188 (2%)
 Frame = +2

Query: 191 QLHPSGARVYIACRDVLKGESAASEIRADTKNSQVLVRKLDLSDTKSIRAFAEGFLTEEK 370
           +L   GARV +ACR   +GE+AA ++R ++ N++V+   LDL+   S++AFA  FL+ E 
Sbjct: 55  ELARRGARVVLACRSRERGEAAAFDLRQESGNNEVIFMALDLASLASVQAFATAFLSSEP 114

Query: 371 QLHILINNAGVMLCPYSKTADGFETHLGVNXXXXXXXXXXXXXXXKASAPARVVNLSSVV 550
           +L +LI+NAG+  C   +T + F   L VN               ++ AP+RVV +SS  
Sbjct: 115 RLDVLIHNAGISSC--GRTRETFNLLLRVNHVGPFLLTHLLLPRLRSCAPSRVVIVSSAA 172

Query: 551 HHAGKIRFHDLQ----GEKHYNRGFAYCHSKLANVLFTRELAKRLQGTGVTTYAVHPGIV 718
           H  G++ F  L     G +   R  AY  SKLANVLF RELA +L+GTGVT YA HPG V
Sbjct: 173 HRRGRLDFTRLDCPVVGWQQELR--AYADSKLANVLFARELATQLEGTGVTCYAAHPGPV 230

Query: 719 QSEL-VRH 739
            SEL +RH
Sbjct: 231 NSELFLRH 238


>ref|NP_079798.1| retinal short-chain dehydrogenase/reductase 4 [Mus musculus]
          Length = 288

 Score = 50.4 bits (119), Expect = 4e-06
 Identities = 51/205 (24%), Positives = 79/205 (38%), Gaps = 1/205 (0%)
 Frame = +2

Query: 281 KNSQVLVRKLDLSDTKSIRAFAEGFLTEEKQLHILINNAGVMLCPYSKTADGFETHLGVN 460
           K   +LV  LDL+DT S  A  +  L E  ++ IL+NN G      S+ +   ET+L V 
Sbjct: 51  KEKDILVLPLDLTDTSSHEAATKAVLQEFGKIDILVNNGG-----RSQRSLVLETNLDVF 105

Query: 461 XXXXXXXXXXXXXXXKASAPARVVNLSSVVHHAGKIRFHDLQGEKHYNRGFAYCHSKLAN 640
                          K   P  +      +     +  + + G    +    YC SK A 
Sbjct: 106 KELINLNYIGTVSLTKCVLPHMIERKQGKI-----VTVNSIAGIASVSLSSGYCASKHAL 160

Query: 641 VLFTRELAKRL-QGTGVTTYAVHPGIVQSELVRHSFLLCLLWRLFSRFLKTAREGAQTSL 817
             F   L   L Q  G+T   V+PG VQS++V+++F             K+ R     S 
Sbjct: 161 RGFFNALHSELGQYPGITFCNVYPGPVQSDIVKNAFT--------EEVTKSMRNNIDQSY 212

Query: 818 HCALAEGLEPLSGKYFSDCKRAWVS 892
               +  +  +     +D K  W+S
Sbjct: 213 KMPTSRCVRLMLISMANDLKEVWIS 237


  Database: RefSeqMP
    Posted date:  Aug 2, 2006 12:58 AM
  Number of letters in database: 21,768,885
  Number of sequences in database:  45,328
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 56,457,441
Number of Sequences: 45328
Number of extensions: 1531409
Number of successful extensions: 5674
Number of sequences better than 1.0e-05: 8
Number of HSP's better than  0.0 without gapping: 4817
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5657
length of database: 21,768,885
effective HSP length: 105
effective length of database: 17,009,445
effective search space used: 4847691825
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)