Animal-Genome cDNA 20060611S-057125


Search to RefSeqSP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611S-057125
         (1212 letters)

Database: RefSeqSP 
           1040 sequences; 434,620 total letters

Searching...done

 ***** No hits found ******

  Database: RefSeqSP
    Posted date:  Aug 1, 2006  7:14 PM
  Number of letters in database: 434,620
  Number of sequences in database:  1040
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,113,288
Number of Sequences: 1040
Number of extensions: 28845
Number of successful extensions: 125
Number of sequences better than 1.0e-05: 0
Number of HSP's better than  0.0 without gapping: 96
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 125
length of database: 434,620
effective HSP length: 79
effective length of database: 352,460
effective search space used: 114197040
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqBP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611S-057125
         (1212 letters)

Database: RefSeqBP 
           33,508 sequences; 16,112,626 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_776711.1| cAMP responsive element binding protein 3 (luma...   253   3e-67
Alignment   gi|XP_885877.1| PREDICTED: similar to cAMP responsive element b...   109   4e-24
Alignment   gi|XP_608017.2| PREDICTED: similar to cAMP responsive element b...   109   4e-24
Alignment   gi|NP_001029604.1| cAMP responsive element binding protein 3-li...   101   1e-21
Alignment   gi|XP_590741.2| PREDICTED: similar to cAMP responsive element b...    78   1e-14

>ref|NP_776711.1| cAMP responsive element binding protein 3 (luman) [Bos taurus]
          Length = 365

 Score =  253 bits (645), Expect = 3e-67
 Identities = 153/270 (56%), Positives = 166/270 (61%), Gaps = 42/270 (15%)
 Frame = +3

Query: 159 AARDETLEAPLDWELPLSE----------------------------------------- 215
           AA DE L +P DWELPLSE                                         
Sbjct: 25  AAPDEALTSPPDWELPLSESLSDWDVEDFLSCLPSPPAVLNVFSNSDPCLVQHDHTYSLS 84

Query: 216 -EYVSIDLDNEDYEKEGAQMTSLRVEAPA*QEIGELILTEDEKRLLENEXXXXXXXXXXX 392
            E+VSIDLDNE YEKE AQMT LRVE PA QEI  LILTE+EKRLLE E           
Sbjct: 85  QEHVSIDLDNESYEKERAQMTPLRVEEPADQEIARLILTEEEKRLLEKEGLTLPGMLPLT 144

Query: 393 KMEEQVLRRVRRKIRNIKSALESRKNNKVYVGSLDSTVLKYSAQNLELLNKVQLLEEQNL 572
           KMEEQVL+RVRRKIRN KSA ESR+  KVYVG L+S VLKY+AQNLEL NKVQLLEEQNL
Sbjct: 145 KMEEQVLKRVRRKIRNKKSAQESRRKKKVYVGGLESRVLKYTAQNLELQNKVQLLEEQNL 204

Query: 573 SLLDHFEQLQSMVIQTANKASCSSTCNXXXXXXXXXXFVPAMYSSDTRGSPPAQHGVLSR 752
           SLLD   +LQ+MVIQTANKAS SSTC            VPAMYSSDTRGS PA+H VLSR
Sbjct: 205 SLLDQLRRLQAMVIQTANKASSSSTCVLVLLFSFCLLLVPAMYSSDTRGSLPAEHRVLSR 264

Query: 753 HFLALPSQEVPPRELPALLSEGSP*MLQPK 842
              ALPS++ P  E PAL SE     L P+
Sbjct: 265 QLRALPSEDPPQLEPPALQSEVPKDSLNPE 294


>ref|XP_885877.1| PREDICTED: similar to cAMP responsive element binding protein
           3-like 4 isoform 2 [Bos taurus]
          Length = 257

 Score =  109 bits (273), Expect = 4e-24
 Identities = 66/154 (42%), Positives = 89/154 (57%), Gaps = 6/154 (3%)
 Frame = +3

Query: 318 LILTEDEKRLLENEXXXXXXXXXXXKMEEQVLRRVRRKIRNIKSALESRKNNKVYVGSLD 497
           L LTE+EKRLL  E           K EE+VL++VRRKIRN +SA +SR+  K Y+  L+
Sbjct: 49  LFLTEEEKRLLGQEGVSLPSHLPLTKAEERVLKKVRRKIRNKQSAQDSRRRKKEYIDGLE 108

Query: 498 STVLKYSAQNLELLNKVQLLEEQNLSLLDHFEQLQSMVIQTANKASCSSTCNXXXXXXXX 677
           S V   +AQN EL  KVQ LE  N+SL+    QLQ +++QT+NKA+ +STC         
Sbjct: 109 SRVAACAAQNQELQRKVQELERHNISLVTQLRQLQMLIVQTSNKAAQTSTCVLILLFSLA 168

Query: 678 XXFVPAMYSSDTRGSPPA------QHGVLSRHFL 761
              +P+   S  +G P A       HGV+SR+ L
Sbjct: 169 LIILPSF--SPFQGLPEAGPEDYQPHGVISRNIL 200


>ref|XP_608017.2| PREDICTED: similar to cAMP responsive element binding protein
           3-like 4 isoform 1 [Bos taurus]
          Length = 257

 Score =  109 bits (273), Expect = 4e-24
 Identities = 66/154 (42%), Positives = 89/154 (57%), Gaps = 6/154 (3%)
 Frame = +3

Query: 318 LILTEDEKRLLENEXXXXXXXXXXXKMEEQVLRRVRRKIRNIKSALESRKNNKVYVGSLD 497
           L LTE+EKRLL  E           K EE+VL++VRRKIRN +SA +SR+  K Y+  L+
Sbjct: 49  LFLTEEEKRLLGQEGVSLPSHLPLTKAEERVLKKVRRKIRNKQSAQDSRRRKKEYIDGLE 108

Query: 498 STVLKYSAQNLELLNKVQLLEEQNLSLLDHFEQLQSMVIQTANKASCSSTCNXXXXXXXX 677
           S V   +AQN EL  KVQ LE  N+SL+    QLQ +++QT+NKA+ +STC         
Sbjct: 109 SRVAACAAQNQELQRKVQELERHNISLVTQLRQLQMLIVQTSNKAAQTSTCVLILLFSLA 168

Query: 678 XXFVPAMYSSDTRGSPPA------QHGVLSRHFL 761
              +P+   S  +G P A       HGV+SR+ L
Sbjct: 169 LIILPSF--SPFQGLPEAGPEDYQPHGVISRNIL 200


>ref|NP_001029604.1| cAMP responsive element binding protein 3-like 3 [Bos taurus]
          Length = 456

 Score =  101 bits (252), Expect = 1e-21
 Identities = 56/139 (40%), Positives = 87/139 (62%), Gaps = 2/139 (1%)
 Frame = +3

Query: 315 ELILTEDEKRLLENEXXXXXXXXXXXKMEEQVLRRVRRKIRNIKSALESRKNNKVYVGSL 494
           EL+LTEDEK+LL  E           K EE++L+++RRKIRN +SA ESRK  K Y+  L
Sbjct: 207 ELVLTEDEKKLLAKEGITLPTQLPLTKYEERMLKKIRRKIRNKQSAQESRKKKKEYIDGL 266

Query: 495 DSTVLKYSAQNLELLNKVQLLEEQNLSLLDHFEQLQSMVIQTANKASCSSTCNXXXXXXX 674
           ++ +   +AQN EL  KV  LE+QNLSLL+  ++LQ++V+Q+ +K++ + TC        
Sbjct: 267 ETRMSACTAQNQELQRKVLHLEKQNLSLLEQLKKLQAIVVQSTSKSAQTGTCIAVLLFSF 326

Query: 675 XXXFVPAM--YSSDTRGSP 725
               +P++  ++S+   SP
Sbjct: 327 ALIVLPSISPFASNRAESP 345


>ref|XP_590741.2| PREDICTED: similar to cAMP responsive element binding protein
           3-like 1 [Bos taurus]
          Length = 520

 Score = 78.2 bits (191), Expect = 1e-14
 Identities = 47/118 (39%), Positives = 68/118 (57%), Gaps = 5/118 (4%)
 Frame = +3

Query: 312 GELILTEDEKRLLENEXXXXXXXXXXXKMEEQVLRRVRRKIRNIKSALESRKNNKVYVGS 491
           G L+LTE+EKR L  E           K EE+ L+RVRRKI+N  SA ESR+  K YV  
Sbjct: 258 GPLLLTEEEKRTLVAEGYPIPTKLPLTKAEEKALKRVRRKIKNKISAQESRRKKKEYVEC 317

Query: 492 LDSTVLKYSAQNLELLNKVQLLEEQNLSLLDHFEQLQSMVIQTANK-----ASCSSTC 650
           L+  V  ++++N EL  KV+ LE  N +LL   ++LQ++V    ++     A+ + TC
Sbjct: 318 LEKKVETFTSENNELWKKVETLENANRTLLQQLQKLQTLVTSKISRPYKMAATQTGTC 375


  Database: RefSeqBP
    Posted date:  Aug 1, 2006  7:14 PM
  Number of letters in database: 16,112,626
  Number of sequences in database:  33,508
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 42,848,980
Number of Sequences: 33508
Number of extensions: 1182551
Number of successful extensions: 5601
Number of sequences better than 1.0e-05: 5
Number of HSP's better than  0.0 without gapping: 4301
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5573
length of database: 16,112,626
effective HSP length: 104
effective length of database: 12,627,794
effective search space used: 3775710406
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqCP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611S-057125
         (1212 letters)

Database: RefSeqCP 
           33,732 sequences; 19,266,565 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|XP_854750.1| PREDICTED: similar to cAMP responsive element b...   229   7e-62
Alignment   gi|XP_855139.1| PREDICTED: similar to cAMP responsive element b...   106   5e-23
Alignment   gi|XP_542164.2| PREDICTED: similar to cAMP responsive element b...   103   3e-22
Alignment   gi|XP_548490.2| PREDICTED: similar to cAMP responsive element b...    83   5e-16
Alignment   gi|XP_540756.2| PREDICTED: similar to cAMP responsive element b...    78   2e-14

>ref|XP_854750.1| PREDICTED: similar to cAMP responsive element binding protein 3
           [Canis familiaris]
          Length = 411

 Score =  229 bits (583), Expect(2) = 7e-62
 Identities = 128/208 (61%), Positives = 146/208 (70%)
 Frame = +3

Query: 192 DWELPLSEEYVSIDLDNEDYEKEGAQMTSLRVEAPA*QEIGELILTEDEKRLLENEXXXX 371
           D    LS+++VSIDLD   Y KE AQ T L+VE PA QEI  LILT++EKRLLE E    
Sbjct: 124 DHTYSLSQQHVSIDLDGGSYGKEEAQTTPLQVEEPAEQEIARLILTDEEKRLLEKEGLTL 183

Query: 372 XXXXXXXKMEEQVLRRVRRKIRNIKSALESRKNNKVYVGSLDSTVLKYSAQNLELLNKVQ 551
                  KMEEQVL RVRRKIRN KSA ESR+  KVY+G L++ VLKY+AQNLEL NKVQ
Sbjct: 184 HGTLPLTKMEEQVLTRVRRKIRNKKSAQESRRKKKVYLGGLENRVLKYTAQNLELQNKVQ 243

Query: 552 LLEEQNLSLLDHFEQLQSMVIQTANKASCSSTCNXXXXXXXXXXFVPAMYSSDTRGSPPA 731
           LLEEQNLSLLD   +LQ+M+IQ +NK S SSTC            VPAMYSSDTRGS PA
Sbjct: 244 LLEEQNLSLLDQLRRLQAMLIQISNKTSSSSTCVLVLLFSFCLLIVPAMYSSDTRGSLPA 303

Query: 732 QHGVLSRHFLALPSQEVPPRELPALLSE 815
           +HGVLSR   ALPS++    ELPAL SE
Sbjct: 304 EHGVLSRQLRALPSEDPHQLELPALQSE 331



 Score = 28.1 bits (61), Expect(2) = 7e-62
 Identities = 19/49 (38%), Positives = 26/49 (53%), Gaps = 10/49 (20%)
 Frame = +2

Query: 818 VPMNAPTQNLQAPGNSCWLVTPLWVV--SPGGKISLE--------NSPC 934
           VP ++  Q LQAPGNSC    PL+ +  +PG +  L+         SPC
Sbjct: 332 VPKDSSDQELQAPGNSC---CPLYHLPQAPGAESPLKLPLPVPSSKSPC 377


>ref|XP_855139.1| PREDICTED: similar to cAMP responsive element binding protein
           3-like 4 [Canis familiaris]
          Length = 384

 Score =  106 bits (264), Expect = 5e-23
 Identities = 64/152 (42%), Positives = 88/152 (57%), Gaps = 4/152 (2%)
 Frame = +3

Query: 318 LILTEDEKRLLENEXXXXXXXXXXXKMEEQVLRRVRRKIRNIKSALESRKNNKVYVGSLD 497
           + LTE+EKRLL  E           K EE+VL+++RRKIRN +SA +SR+  K Y+  L+
Sbjct: 176 VFLTEEEKRLLGQEGVSLPTHLPLTKAEERVLKKIRRKIRNKQSAQDSRRRKKEYIDGLE 235

Query: 498 STVLKYSAQNLELLNKVQLLEEQNLSLLDHFEQLQSMVIQTANKASCSSTCNXXXXXXXX 677
           S V   SAQN EL  KVQ LE  N+SL+    QLQ+++ QT+NKA+ +STC         
Sbjct: 236 SRVAACSAQNQELQKKVQELERHNISLVTQLRQLQTLIAQTSNKAAQTSTCVLILLFSLA 295

Query: 678 XXFVPA---MYSSDTRGSPPAQ-HGVLSRHFL 761
              +P+   +      GS   Q HGV+SR+ L
Sbjct: 296 LIVLPSVSPLQGLREAGSEDYQPHGVISRNIL 327


>ref|XP_542164.2| PREDICTED: similar to cAMP responsive element binding protein
           3-like 3 [Canis familiaris]
          Length = 609

 Score =  103 bits (258), Expect = 3e-22
 Identities = 64/179 (35%), Positives = 97/179 (54%), Gaps = 4/179 (2%)
 Frame = +3

Query: 294 PA*QEIGELILTEDEKRLLENEXXXXXXXXXXXKMEEQVLRRVRRKIRNIKSALESRKNN 473
           P  ++  EL+LTEDEK+LL  E           K EE+VL+++RRKIRN +SA ESRK  
Sbjct: 325 PGPEQCQELVLTEDEKKLLAKEGITLPTQLPLTKYEERVLKKIRRKIRNKQSAQESRKKK 384

Query: 474 KVYVGSLDSTVLKYSAQNLELLNKVQLLEEQNLSLLDHFEQLQSMVIQTANKASCSSTCN 653
           K Y+  L++ +   +AQN EL  KV  LE+QNLSLL+  ++LQ++V+Q+ +K++ + TC 
Sbjct: 385 KEYIDGLETRMSACTAQNQELQRKVLHLEKQNLSLLEQLKKLQAIVVQSTSKSAQTGTCL 444

Query: 654 XXXXXXXXXXFVPA----MYSSDTRGSPPAQHGVLSRHFLALPSQEVPPRELPALLSEG 818
                      +P+    + +        A   V SR     P+  V P  +P   + G
Sbjct: 445 AVLLFSFALIVLPSISPFVANKAKHAGDYAPVRVFSRTLHNDPASRVAPDAIPGSEAPG 503


>ref|XP_548490.2| PREDICTED: similar to cAMP responsive element binding protein
           3-like 2 [Canis familiaris]
          Length = 393

 Score = 83.2 bits (204), Expect = 5e-16
 Identities = 56/162 (34%), Positives = 79/162 (48%), Gaps = 15/162 (9%)
 Frame = +3

Query: 303 QEIGELILTEDEKRLLENEXXXXXXXXXXXKMEEQVLRRVRRKIRNIKSALESRKNNKVY 482
           Q  G L+LTE+EKR L  E           K EE+ L+++RRKI+N  SA ESR+  K Y
Sbjct: 156 QGSGPLVLTEEEKRTLIAEGYPIPTKLPLTKSEEKALKKIRRKIKNKISAQESRRKKKEY 215

Query: 483 VGSLDSTVLKYSAQNLELLNKVQLLEEQNLSLLDHFEQLQSMVIQTANKASCSSTCNXXX 662
           + SL+  V   S +NLEL  KV++LE  N +LL   ++LQ++V+        S TC    
Sbjct: 216 MDSLEKKVESCSTENLELRKKVEVLENTNRTLLQQLQKLQTLVM-----GKVSRTCKLAG 270

Query: 663 XXXXXXXFVPAM---------------YSSDTRGSPPAQHGV 743
                   V  +               Y S T+ + P+QH V
Sbjct: 271 TQTGTCLMVVVLCFAVAFGSFFQGYGPYPSATKMALPSQHSV 312


>ref|XP_540756.2| PREDICTED: similar to cAMP responsive element binding protein
           3-like 1 [Canis familiaris]
          Length = 725

 Score = 77.8 bits (190), Expect = 2e-14
 Identities = 47/118 (39%), Positives = 68/118 (57%), Gaps = 5/118 (4%)
 Frame = +3

Query: 312 GELILTEDEKRLLENEXXXXXXXXXXXKMEEQVLRRVRRKIRNIKSALESRKNNKVYVGS 491
           G L+LTE+EKR L  E           K EE+ L+RVRRKI+N  SA ESR+  K YV  
Sbjct: 463 GPLLLTEEEKRTLIAEGYPIPTKLPLTKAEEKALKRVRRKIKNKISAQESRRKKKEYVEC 522

Query: 492 LDSTVLKYSAQNLELLNKVQLLEEQNLSLLDHFEQLQSMVIQTANK-----ASCSSTC 650
           L+  V  ++++N EL  KV+ LE  N +LL   ++LQ++V    ++     A+ + TC
Sbjct: 523 LEKKVETFTSENNELWKKVETLENANRTLLQQLQKLQTLVTNKISRPYKMAATQTGTC 580


  Database: RefSeqCP
    Posted date:  Aug 1, 2006  9:25 PM
  Number of letters in database: 19,266,565
  Number of sequences in database:  33,732
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 50,432,296
Number of Sequences: 33732
Number of extensions: 1402796
Number of successful extensions: 6739
Number of sequences better than 1.0e-05: 5
Number of HSP's better than  0.0 without gapping: 5000
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6672
length of database: 19,266,565
effective HSP length: 105
effective length of database: 15,724,705
effective search space used: 4685962090
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqHP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611S-057125
         (1212 letters)

Database: RefSeqHP 
           39,411 sequences; 17,774,539 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_006359.3| cAMP responsive element binding protein 3 [Homo...   219   4e-57
Alignment   gi|NP_570968.1| cAMP responsive element binding protein 3-like ...   107   2e-23
Alignment   gi|NP_115996.1| cAMP responsive element binding protein 3-like ...   102   9e-22
Alignment   gi|NP_919047.2| cAMP responsive element binding protein 3-like ...    82   7e-16
Alignment   gi|NP_443086.1| cAMP responsive element binding protein 3-like ...    78   2e-14

>ref|NP_006359.3| cAMP responsive element binding protein 3 [Homo sapiens]
          Length = 371

 Score =  219 bits (558), Expect = 4e-57
 Identities = 131/260 (50%), Positives = 153/260 (58%), Gaps = 42/260 (16%)
 Frame = +3

Query: 162 ARDETLEAPLDWELPLSE------------------------------------------ 215
           A DE + APLDW LPLSE                                          
Sbjct: 26  APDEAVRAPLDWALPLSEVPSDWEVDDLLCSLLSPPASLNILSSSNPCLVHHDHTYSLPR 85

Query: 216 EYVSIDLDNEDYEKEGAQMTSLRVEAPA*QEIGELILTEDEKRLLENEXXXXXXXXXXXK 395
           E VS+DL++E   KEG QMT   +E  A QEI  L+LT++EK LLE E           K
Sbjct: 86  ETVSMDLESESCRKEGTQMTPQHMEELAEQEIARLVLTDEEKSLLEKEGLILPETLPLTK 145

Query: 396 MEEQVLRRVRRKIRNIKSALESRKNNKVYVGSLDSTVLKYSAQNLELLNKVQLLEEQNLS 575
            EEQ+L+RVRRKIRN +SA ESR+  KVYVG L+S VLKY+AQN+EL NKVQLLEEQNLS
Sbjct: 146 TEEQILKRVRRKIRNKRSAQESRRKKKVYVGGLESRVLKYTAQNMELQNKVQLLEEQNLS 205

Query: 576 LLDHFEQLQSMVIQTANKASCSSTCNXXXXXXXXXXFVPAMYSSDTRGSPPAQHGVLSRH 755
           LLD   +LQ+MVI+ +NK S SSTC            VPAMYSSDTRGS PA+HGVLSR 
Sbjct: 206 LLDQLRKLQAMVIEISNKTSSSSTCILVLLVSFCLLLVPAMYSSDTRGSLPAEHGVLSRQ 265

Query: 756 FLALPSQEVPPRELPALLSE 815
             ALPS++    ELPAL SE
Sbjct: 266 LRALPSEDPYQLELPALQSE 285


>ref|NP_570968.1| cAMP responsive element binding protein 3-like 4 [Homo sapiens]
          Length = 395

 Score =  107 bits (268), Expect = 2e-23
 Identities = 66/152 (43%), Positives = 88/152 (57%), Gaps = 4/152 (2%)
 Frame = +3

Query: 318 LILTEDEKRLLENEXXXXXXXXXXXKMEEQVLRRVRRKIRNIKSALESRKNNKVYVGSLD 497
           L LT++EKRLL  E           K EE+VL++VRRKIRN +SA +SR+  K Y+  L+
Sbjct: 187 LFLTDEEKRLLGQEGVSLPSHLPLTKAEERVLKKVRRKIRNKQSAQDSRRRKKEYIDGLE 246

Query: 498 STVLKYSAQNLELLNKVQLLEEQNLSLLDHFEQLQSMVIQTANKASCSSTCNXXXXXXXX 677
           S V   SAQN EL  KVQ LE  N+SL+    QLQ+++ QT+NKA+ +STC         
Sbjct: 247 SRVAACSAQNQELQKKVQELERHNISLVAQLRQLQTLIAQTSNKAAQTSTCVLILLFSLA 306

Query: 678 XXFVPAMYSSDTR---GSPPAQ-HGVLSRHFL 761
              +P+     +R   GS   Q HGV SR+ L
Sbjct: 307 LIILPSFSPFQSRPEAGSEDYQPHGVTSRNIL 338


>ref|NP_115996.1| cAMP responsive element binding protein 3-like 3 [Homo sapiens]
          Length = 461

 Score =  102 bits (253), Expect = 9e-22
 Identities = 53/112 (47%), Positives = 77/112 (68%)
 Frame = +3

Query: 315 ELILTEDEKRLLENEXXXXXXXXXXXKMEEQVLRRVRRKIRNIKSALESRKNNKVYVGSL 494
           EL+LTEDEK+LL  E           K EE+VL+++RRKIRN +SA ESRK  K Y+  L
Sbjct: 212 ELVLTEDEKKLLAKEGITLPTQLPLTKYEERVLKKIRRKIRNKQSAQESRKKKKEYIDGL 271

Query: 495 DSTVLKYSAQNLELLNKVQLLEEQNLSLLDHFEQLQSMVIQTANKASCSSTC 650
           ++ +   +AQN EL  KV  LE+QNLSLL+  ++LQ++V+Q+ +K++ + TC
Sbjct: 272 ETRMSACTAQNQELQRKVLHLEKQNLSLLEQLKKLQAIVVQSTSKSAQTGTC 323


>ref|NP_919047.2| cAMP responsive element binding protein 3-like 2 [Homo sapiens]
          Length = 520

 Score = 82.4 bits (202), Expect = 7e-16
 Identities = 58/159 (36%), Positives = 81/159 (50%), Gaps = 1/159 (0%)
 Frame = +3

Query: 303 QEIGELILTEDEKRLLENEXXXXXXXXXXXKMEEQVLRRVRRKIRNIKSALESRKNNKVY 482
           Q  G L+LTE+EKR L  E           K EE+ L+++RRKI+N  SA ESR+  K Y
Sbjct: 259 QGSGPLVLTEEEKRTLIAEGYPIPTKLPLSKSEEKALKKIRRKIKNKISAQESRRKKKEY 318

Query: 483 VGSLDSTVLKYSAQNLELLNKVQLLEEQNLSLLDHFEQLQSMVIQTANKASCSSTCNXXX 662
           + SL+  V   S +NLEL  KV++LE  N +LL   ++LQ++V+        S TC    
Sbjct: 319 MDSLEKKVESCSTENLELRKKVEVLENTNRTLLQQLQKLQTLVM-----GKVSRTCKLAG 373

Query: 663 XXXXXXXFVPAMYSSDTRGSPPAQHGVL-SRHFLALPSQ 776
                   V  +  +   GS    +G   S   +ALPSQ
Sbjct: 374 TQTGTCLMVVVLCFAVAFGSFFQGYGPYPSATKMALPSQ 412


>ref|NP_443086.1| cAMP responsive element binding protein 3-like 1 [Homo sapiens]
          Length = 519

 Score = 77.8 bits (190), Expect = 2e-14
 Identities = 47/118 (39%), Positives = 68/118 (57%), Gaps = 5/118 (4%)
 Frame = +3

Query: 312 GELILTEDEKRLLENEXXXXXXXXXXXKMEEQVLRRVRRKIRNIKSALESRKNNKVYVGS 491
           G L+LTE+EKR L  E           K EE+ L+RVRRKI+N  SA ESR+  K YV  
Sbjct: 258 GPLLLTEEEKRTLIAEGYPIPTKLPLTKAEEKALKRVRRKIKNKISAQESRRKKKEYVEC 317

Query: 492 LDSTVLKYSAQNLELLNKVQLLEEQNLSLLDHFEQLQSMVIQTANK-----ASCSSTC 650
           L+  V  ++++N EL  KV+ LE  N +LL   ++LQ++V    ++     A+ + TC
Sbjct: 318 LEKKVETFTSENNELWKKVETLENANRTLLQQLQKLQTLVTNKISRPYKMAATQTGTC 375


  Database: RefSeqHP
    Posted date:  Aug 2, 2006 12:57 AM
  Number of letters in database: 17,774,539
  Number of sequences in database:  39,411
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 49,028,829
Number of Sequences: 39411
Number of extensions: 1422737
Number of successful extensions: 7124
Number of sequences better than 1.0e-05: 5
Number of HSP's better than  0.0 without gapping: 5295
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7080
length of database: 17,774,539
effective HSP length: 104
effective length of database: 13,675,795
effective search space used: 4089062705
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqMP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611S-057125
         (1212 letters)

Database: RefSeqMP 
           45,328 sequences; 21,768,885 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_038525.1| cAMP responsive element binding protein 3 [Mus ...   194   1e-49
Alignment   gi|NP_663340.1| cAMP responsive element binding protein 3-like ...   102   1e-21
Alignment   gi|NP_084356.1| androgen-induced basic leucine zipper [Mus musc...    99   9e-21
Alignment   gi|NP_848776.1| cAMP responsive element binding protein 3-like ...    84   4e-16
Alignment   gi|XP_919654.2| PREDICTED: similar to cAMP responsive element b...    83   7e-16
Alignment   gi|NP_036087.1| cAMP responsive element binding protein 3-like ...    79   1e-14

>ref|NP_038525.1| cAMP responsive element binding protein 3 [Mus musculus]
          Length = 379

 Score =  194 bits (494), Expect = 1e-49
 Identities = 115/209 (55%), Positives = 136/209 (65%), Gaps = 1/209 (0%)
 Frame = +3

Query: 192 DWELPLSEEYVSIDLDNEDYEKEGAQMTSLR-VEAPA*QEIGELILTEDEKRLLENEXXX 368
           D    L +E+VSIDLD E +EKEG  +T L   E  A QE+  LILTE+EK+LLE E   
Sbjct: 87  DHNYSLPQEHVSIDLDTESFEKEGFHVTPLPGEERAAEQEMSRLILTEEEKKLLEKEGLT 146

Query: 369 XXXXXXXXKMEEQVLRRVRRKIRNIKSALESRKNNKVYVGSLDSTVLKYSAQNLELLNKV 548
                   K+EEQVL+RVRRKIRN ++A ESRK  KVYV  L+S VLKY+AQN EL NKV
Sbjct: 147 LPSTLPLTKVEEQVLKRVRRKIRNKRAAQESRKKKKVYVVGLESRVLKYTAQNRELQNKV 206

Query: 549 QLLEEQNLSLLDHFEQLQSMVIQTANKASCSSTCNXXXXXXXXXXFVPAMYSSDTRGSPP 728
           Q LEEQNLSLLD   +LQ+MVI+ ANK S  STC            VPAMYSSD RGS P
Sbjct: 207 QRLEEQNLSLLDQLRKLQAMVIEIANKTSSGSTCVLVLVFSFCLLLVPAMYSSDARGSVP 266

Query: 729 AQHGVLSRHFLALPSQEVPPRELPALLSE 815
           A++ VL R   ALPS++    +  AL SE
Sbjct: 267 AEYVVLHRKLRALPSEDDHQPKPSALSSE 295


>ref|NP_663340.1| cAMP responsive element binding protein 3-like 3 [Mus musculus]
          Length = 479

 Score =  102 bits (253), Expect = 1e-21
 Identities = 57/139 (41%), Positives = 85/139 (61%), Gaps = 2/139 (1%)
 Frame = +3

Query: 315 ELILTEDEKRLLENEXXXXXXXXXXXKMEEQVLRRVRRKIRNIKSALESRKNNKVYVGSL 494
           EL+LTEDEK+LL  E           K EE+VL+++RRKIRN +SA ESRK  K Y+  L
Sbjct: 208 ELVLTEDEKKLLAKEGVTLPTQLPLTKYEERVLKKIRRKIRNKQSAQESRKKKKEYIDGL 267

Query: 495 DSTVLKYSAQNLELLNKVQLLEEQNLSLLDHFEQLQSMVIQTANKASCSSTCNXXXXXXX 674
           ++ +   +AQN EL  KV  LE+QNLSLL+  + LQ++V+Q+ +K + + TC        
Sbjct: 268 ENRMSACTAQNQELQRKVLHLEKQNLSLLEQLKHLQALVVQSTSKPAHAGTCIAVLLLSF 327

Query: 675 XXXFVPAM--YSSDTRGSP 725
               +P++  ++S+   SP
Sbjct: 328 ALIILPSISPFNSNKVDSP 346


>ref|NP_084356.1| androgen-induced basic leucine zipper [Mus musculus]
          Length = 370

 Score = 99.0 bits (245), Expect = 9e-21
 Identities = 58/152 (38%), Positives = 84/152 (55%), Gaps = 4/152 (2%)
 Frame = +3

Query: 318 LILTEDEKRLLENEXXXXXXXXXXXKMEEQVLRRVRRKIRNIKSALESRKNNKVYVGSLD 497
           L LT++EK+LL  E           K EE++L+++RRKIRN +SA +SR+  K Y+  L+
Sbjct: 163 LFLTDEEKQLLAQEGITLPSHLPLTKAEERILKKIRRKIRNKQSAQDSRRRKKEYLDGLE 222

Query: 498 STVLKYSAQNLELLNKVQLLEEQNLSLLDHFEQLQSMVIQTANKASCSSTCNXXXXXXXX 677
           S V   S QN +L  KVQ LE QN+ L++   QLQ +  QT+++A+ +STC         
Sbjct: 223 SRVAACSEQNQKLQRKVQELERQNIFLMEQVRQLQKLTAQTSSRAAQTSTCVLILLFSLA 282

Query: 678 X----XFVPAMYSSDTRGSPPAQHGVLSRHFL 761
                 F P    S+ R      HGV+SR+ L
Sbjct: 283 LIILPSFSPFQGQSEARPEDYQLHGVISRNIL 314


>ref|NP_848776.1| cAMP responsive element binding protein 3-like 2 [Mus musculus]
          Length = 521

 Score = 83.6 bits (205), Expect = 4e-16
 Identities = 58/159 (36%), Positives = 82/159 (51%), Gaps = 1/159 (0%)
 Frame = +3

Query: 303 QEIGELILTEDEKRLLENEXXXXXXXXXXXKMEEQVLRRVRRKIRNIKSALESRKNNKVY 482
           Q  G L+LTE+EKR L  E           K EE+ L+++RRKI+N  SA ESR+  K Y
Sbjct: 259 QGSGPLVLTEEEKRTLVAEGYPIPTKLPLTKSEEKALKKIRRKIKNKISAQESRRKKKEY 318

Query: 483 VGSLDSTVLKYSAQNLELLNKVQLLEEQNLSLLDHFEQLQSMVIQTANKASCSSTCNXXX 662
           + SL+  V   S +NLEL  KV++LE+ N +LL   ++LQ++V+        S TC    
Sbjct: 319 MDSLEKKVESCSTENLELRKKVEVLEDTNRTLLQQLQKLQTLVM-----GKVSRTCKLAG 373

Query: 663 XXXXXXXFVPAMYSSDTRGSPPAQHGVL-SRHFLALPSQ 776
                   V  +  +   GS    +G   S   +ALPSQ
Sbjct: 374 TQTGTCLMVVVLCFAVAFGSFFQGYGPYPSATKMALPSQ 412


>ref|XP_919654.2| PREDICTED: similar to cAMP responsive element binding protein
           3-like 2 [Mus musculus]
          Length = 477

 Score = 82.8 bits (203), Expect = 7e-16
 Identities = 58/159 (36%), Positives = 81/159 (50%), Gaps = 1/159 (0%)
 Frame = +3

Query: 303 QEIGELILTEDEKRLLENEXXXXXXXXXXXKMEEQVLRRVRRKIRNIKSALESRKNNKVY 482
           Q  G L+LTE+EKR L  E           K EE+ L+++RRKI+N  SA ESR+  K Y
Sbjct: 215 QGSGPLVLTEEEKRTLVAEGYPIPTKLPLTKSEEKALKKIRRKIKNKISAQESRRKKKEY 274

Query: 483 VGSLDSTVLKYSAQNLELLNKVQLLEEQNLSLLDHFEQLQSMVIQTANKASCSSTCNXXX 662
           + SL+  V   S +NLEL  KV++LE  N +LL   ++LQ++V+        S TC    
Sbjct: 275 MDSLEKKVESCSTENLELRKKVEVLENTNRTLLQQLQKLQTLVM-----GKVSRTCKLAG 329

Query: 663 XXXXXXXFVPAMYSSDTRGSPPAQHGVL-SRHFLALPSQ 776
                   V  +  +   GS    +G   S   +ALPSQ
Sbjct: 330 TQTGTCLMVVVLCFAVAFGSFFQGYGPYPSATKMALPSQ 368


>ref|NP_036087.1| cAMP responsive element binding protein 3-like 1 [Mus musculus]
          Length = 507

 Score = 79.0 bits (193), Expect = 1e-14
 Identities = 48/118 (40%), Positives = 68/118 (57%), Gaps = 5/118 (4%)
 Frame = +3

Query: 312 GELILTEDEKRLLENEXXXXXXXXXXXKMEEQVLRRVRRKIRNIKSALESRKNNKVYVGS 491
           G L+LTE+EKR L  E           K EE+ L+RVRRKI+N  SA ESR+  K YV  
Sbjct: 258 GPLLLTEEEKRTLIAEGYPIPTKLPLTKAEEKALKRVRRKIKNKISAQESRRKKKEYVEC 317

Query: 492 LDSTVLKYSAQNLELLNKVQLLEEQNLSLLDHFEQLQSMVIQTANK-----ASCSSTC 650
           L+  V  Y+++N EL  KV+ LE  N +LL   ++LQ++V    ++     A+ + TC
Sbjct: 318 LEKKVETYTSENNELWKKVETLETANRTLLQQLQKLQTLVTSKISRPYKMAATQTGTC 375


  Database: RefSeqMP
    Posted date:  Aug 2, 2006 12:58 AM
  Number of letters in database: 21,768,885
  Number of sequences in database:  45,328
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 56,994,143
Number of Sequences: 45328
Number of extensions: 1551679
Number of successful extensions: 7721
Number of sequences better than 1.0e-05: 6
Number of HSP's better than  0.0 without gapping: 5703
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7627
length of database: 21,768,885
effective HSP length: 106
effective length of database: 16,964,117
effective search space used: 5038342749
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)