Animal-Genome cDNA 20060611S-058624


Search to RefSeqSP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611S-058624
         (958 letters)

Database: RefSeqSP 
           1040 sequences; 434,620 total letters

Searching...done

 ***** No hits found ******

  Database: RefSeqSP
    Posted date:  Aug 1, 2006  7:14 PM
  Number of letters in database: 434,620
  Number of sequences in database:  1040
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 910,975
Number of Sequences: 1040
Number of extensions: 23010
Number of successful extensions: 73
Number of sequences better than 1.0e-05: 0
Number of HSP's better than  0.0 without gapping: 66
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 73
length of database: 434,620
effective HSP length: 77
effective length of database: 354,540
effective search space used: 85444140
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqBP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611S-058624
         (958 letters)

Database: RefSeqBP 
           33,508 sequences; 16,112,626 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|XP_612082.2| PREDICTED: similar to LanC-like protein 1 (40 k...   101   1e-41
Alignment   gi|XP_614740.2| PREDICTED: similar to LanC-like protein 2 (Test...    64   1e-17

>ref|XP_612082.2| PREDICTED: similar to LanC-like protein 1 (40 kDa erythrocyte
           membrane protein) (p40) [Bos taurus]
          Length = 399

 Score =  101 bits (251), Expect(3) = 1e-41
 Identities = 57/104 (54%), Positives = 64/104 (61%)
 Frame = +2

Query: 206 LLSLMDRCLQSPDPRHGSAYPVWACIAVLYLPLYDVIGDPAYLTMARVLTTVSLSCLTYL 385
           LL  M+R L+S DPR  + Y  WA IAVLYL LYDV GDP YL MA      SL+ L+  
Sbjct: 43  LLQQMERGLKSADPRDSTVYTGWAGIAVLYLHLYDVFGDPNYLQMAHGYVKQSLNSLSKH 102

Query: 386 SFPFLCGDASPLRVAAVVHVILNCADPADYCICRLILLLNIDTH 517
           S  FLCGD  PL VAAVVH  +N    A+ CI RLI L  ID H
Sbjct: 103 SITFLCGDGGPLAVAAVVHHKMNNEKQAEECITRLIHLNKIDPH 146



 Score = 78.2 bits (191), Expect(3) = 1e-41
 Identities = 41/79 (51%), Positives = 50/79 (63%)
 Frame = +3

Query: 507 LTPMAPCDLLSGLMGYVYALLLVNNIFGVEHIPTTPIPLICPSVLSSGHYLA*QINFC*Y 686
           + P AP ++L G MGY+ ALL VN  FG E IP + I  IC +VL+SG  LA +  F   
Sbjct: 143 IDPHAPSEMLYGRMGYISALLFVNKNFGEEKIPQSHIQQICETVLTSGEDLARKRRFTGK 202

Query: 687 TPLMLQWYPEYYVSDAHVL 743
           TPLM +WY EYYV  AH L
Sbjct: 203 TPLMYEWYQEYYVGAAHGL 221



 Score = 29.6 bits (65), Expect(3) = 1e-41
 Identities = 12/18 (66%), Positives = 15/18 (83%)
 Frame = +3

Query: 120 QSLAQSYFDSAGTLIPEY 173
           +SLA+ YFDSAG L PE+
Sbjct: 15  KSLAEGYFDSAGRLTPEF 32


>ref|XP_614740.2| PREDICTED: similar to LanC-like protein 2 (Testis-specific
           adriamycin sensitivity protein), partial [Bos taurus]
          Length = 331

 Score = 63.5 bits (153), Expect(2) = 1e-17
 Identities = 40/98 (40%), Positives = 51/98 (52%)
 Frame = +2

Query: 206 LLSLMDRCLQSPDPRHGSAYPVWACIAVLYLPLYDVIGDPAYLTMARVLTTVSLSCLTYL 385
           LL  M+  L++ DP   SAY  W  IA+LYL LY V  D +YL  +      +L  L   
Sbjct: 79  LLQQMEEGLKTADPHDCSAYTGWTGIALLYLQLYRVTCDQSYLLRSLDYVKRTLRNLNGR 138

Query: 386 SFPFLCGDASPLRVAAVVHVILNCADPADYCICRLILL 499
              FLCGDA PL V AVV+  L     +  CI +L+ L
Sbjct: 139 RVTFLCGDAGPLAVGAVVYHKLKSDCESQECITKLLQL 176



 Score = 44.7 bits (104), Expect(2) = 1e-17
 Identities = 25/72 (34%), Positives = 38/72 (52%)
 Frame = +3

Query: 522 PCDLLSGLMGYVYALLLVNNIFGVEHIPTTPIPLICPSVLSSGHYLA*QINFC*YTPLML 701
           P +LL G  GY+YALL VN   G   +  + I  +  +++ SG  L+ +       PL+ 
Sbjct: 188 PDELLYGRAGYLYALLYVNTEIGPGAVCESAIKEVVNAIIESGKALSKEEKKVERCPLLY 247

Query: 702 QWYPEYYVSDAH 737
           QW+ + YV  AH
Sbjct: 248 QWHRKQYVGAAH 259


  Database: RefSeqBP
    Posted date:  Aug 1, 2006  7:14 PM
  Number of letters in database: 16,112,626
  Number of sequences in database:  33,508
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 33,405,991
Number of Sequences: 33508
Number of extensions: 828646
Number of successful extensions: 2225
Number of sequences better than 1.0e-05: 2
Number of HSP's better than  0.0 without gapping: 2047
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2222
length of database: 16,112,626
effective HSP length: 101
effective length of database: 12,728,318
effective search space used: 2762045006
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqCP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611S-058624
         (958 letters)

Database: RefSeqCP 
           33,732 sequences; 19,266,565 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|XP_536055.1| PREDICTED: similar to LanC-like protein 1 (40 k...   100   3e-43
Alignment   gi|XP_540359.2| PREDICTED: similar to LanC-like protein 2 (Test...    63   4e-17

>ref|XP_536055.1| PREDICTED: similar to LanC-like protein 1 (40 kDa erythrocyte
           membrane protein) (p40) [Canis familiaris]
          Length = 399

 Score =  100 bits (250), Expect(3) = 3e-43
 Identities = 56/104 (53%), Positives = 65/104 (62%)
 Frame = +2

Query: 206 LLSLMDRCLQSPDPRHGSAYPVWACIAVLYLPLYDVIGDPAYLTMARVLTTVSLSCLTYL 385
           LL  M+R L+S DPR  + Y  WA IA+LYL LYDV GDPAYL MA      SL+ LT  
Sbjct: 43  LLQQMERGLKSADPRDSTVYTGWAGIALLYLHLYDVFGDPAYLQMAHGYVKQSLNSLTKR 102

Query: 386 SFPFLCGDASPLRVAAVVHVILNCADPADYCICRLILLLNIDTH 517
           S  FLCGDA PL + AVV+  +N    A+ CI RLI L  ID H
Sbjct: 103 SITFLCGDAGPLAIGAVVYHKMNNEKQAEDCITRLIHLNKIDHH 146



 Score = 84.0 bits (206), Expect(3) = 3e-43
 Identities = 44/75 (58%), Positives = 51/75 (68%)
 Frame = +3

Query: 519 APCDLLSGLMGYVYALLLVNNIFGVEHIPTTPIPLICPSVLSSGHYLA*QINFC*YTPLM 698
           AP ++L G MGYVYALL VN  FGVE IP + I  IC +VL+SG  LA + NF   TPLM
Sbjct: 147 APNEMLYGRMGYVYALLFVNKNFGVEKIPQSHIQQICEAVLTSGENLAQKRNFTAKTPLM 206

Query: 699 LQWYPEYYVSDAHVL 743
            +WY EYYV  AH L
Sbjct: 207 YEWYQEYYVGAAHGL 221



 Score = 30.4 bits (67), Expect(3) = 3e-43
 Identities = 13/20 (65%), Positives = 16/20 (80%)
 Frame = +3

Query: 114 FLQSLAQSYFDSAGTLIPEY 173
           F +SLA+SYFD AG L PE+
Sbjct: 13  FNKSLAESYFDCAGRLTPEF 32


>ref|XP_540359.2| PREDICTED: similar to LanC-like protein 2 (Testis-specific
           adriamycin sensitivity protein) [Canis familiaris]
          Length = 452

 Score = 63.2 bits (152), Expect(2) = 4e-17
 Identities = 40/98 (40%), Positives = 50/98 (51%)
 Frame = +2

Query: 206 LLSLMDRCLQSPDPRHGSAYPVWACIAVLYLPLYDVIGDPAYLTMARVLTTVSLSCLTYL 385
           LL  M+  L++ DP   SAY  W  IA+LYL LY V  D  YL  +      +L  L   
Sbjct: 83  LLQQMEEGLKTADPHDCSAYTGWTGIALLYLQLYRVTCDQTYLLRSLDYVKRTLRNLNGR 142

Query: 386 SFPFLCGDASPLRVAAVVHVILNCADPADYCICRLILL 499
              FLCGDA PL V AVV+  L     +  CI +L+ L
Sbjct: 143 RVTFLCGDAGPLAVGAVVYHKLKSDCESQECITKLLQL 180



 Score = 43.5 bits (101), Expect(2) = 4e-17
 Identities = 24/72 (33%), Positives = 38/72 (52%)
 Frame = +3

Query: 522 PCDLLSGLMGYVYALLLVNNIFGVEHIPTTPIPLICPSVLSSGHYLA*QINFC*YTPLML 701
           P +LL G  GY+YALL +N   G   +  + I  +  +++ SG  L+ +       PL+ 
Sbjct: 192 PDELLYGRAGYLYALLYLNTEIGPGTVCESAIKEVVCAIIESGKTLSREERKAERCPLLY 251

Query: 702 QWYPEYYVSDAH 737
           QW+ + YV  AH
Sbjct: 252 QWHRKQYVGAAH 263


  Database: RefSeqCP
    Posted date:  Aug 1, 2006  9:25 PM
  Number of letters in database: 19,266,565
  Number of sequences in database:  33,732
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 39,075,416
Number of Sequences: 33732
Number of extensions: 965963
Number of successful extensions: 2577
Number of sequences better than 1.0e-05: 2
Number of HSP's better than  0.0 without gapping: 2373
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2574
length of database: 19,266,565
effective HSP length: 103
effective length of database: 15,792,169
effective search space used: 3395316335
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqHP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611S-058624
         (958 letters)

Database: RefSeqHP 
           39,411 sequences; 17,774,539 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_006046.1| lanthionine synthetase C-like protein 1 [Homo s...   108   2e-44
Alignment   gi|NP_061167.1| LanC lantibiotic synthetase component C-like 2 ...    62   6e-17

>ref|NP_006046.1| lanthionine synthetase C-like protein 1 [Homo sapiens]
          Length = 399

 Score =  108 bits (269), Expect(3) = 2e-44
 Identities = 59/104 (56%), Positives = 68/104 (65%)
 Frame = +2

Query: 206 LLSLMDRCLQSPDPRHGSAYPVWACIAVLYLPLYDVIGDPAYLTMARVLTTVSLSCLTYL 385
           LL  M+R L+S DPR G+ Y  WA IAVLYL LYDV GDPAYL +A      SL+CLT  
Sbjct: 43  LLQQMERGLKSADPRDGTGYTGWAGIAVLYLHLYDVFGDPAYLQLAHGYVKQSLNCLTKR 102

Query: 386 SFPFLCGDASPLRVAAVVHVILNCADPADYCICRLILLLNIDTH 517
           S  FLCGDA PL VAAV++  +N    A+ CI RLI L  ID H
Sbjct: 103 SITFLCGDAGPLAVAAVLYHKMNNEKQAEDCITRLIHLNKIDPH 146



 Score = 82.4 bits (202), Expect(3) = 2e-44
 Identities = 41/79 (51%), Positives = 53/79 (67%)
 Frame = +3

Query: 507 LTPMAPCDLLSGLMGYVYALLLVNNIFGVEHIPTTPIPLICPSVLSSGHYLA*QINFC*Y 686
           + P AP ++L G +GY+YALL VN  FGVE IP + I  IC ++L+SG  LA + NF   
Sbjct: 143 IDPHAPNEMLYGRIGYIYALLFVNKNFGVEKIPQSHIQQICETILTSGENLARKRNFTAK 202

Query: 687 TPLMLQWYPEYYVSDAHVL 743
           +PLM +WY EYYV  AH L
Sbjct: 203 SPLMYEWYQEYYVGAAHGL 221



 Score = 28.5 bits (62), Expect(3) = 2e-44
 Identities = 11/18 (61%), Positives = 15/18 (83%)
 Frame = +3

Query: 120 QSLAQSYFDSAGTLIPEY 173
           +SLA+ YFD+AG L PE+
Sbjct: 15  KSLAEGYFDAAGRLTPEF 32


>ref|NP_061167.1| LanC lantibiotic synthetase component C-like 2 [Homo sapiens]
          Length = 450

 Score = 62.4 bits (150), Expect(2) = 6e-17
 Identities = 38/98 (38%), Positives = 50/98 (51%)
 Frame = +2

Query: 206 LLSLMDRCLQSPDPRHGSAYPVWACIAVLYLPLYDVIGDPAYLTMARVLTTVSLSCLTYL 385
           LL  M+  L++ DP   SAY  W  IA+LYL LY V  D  YL  +      +L  L   
Sbjct: 84  LLQQMEEGLKTADPHDCSAYTGWTGIALLYLQLYRVTCDQTYLLRSLDYVKRTLRNLNGR 143

Query: 386 SFPFLCGDASPLRVAAVVHVILNCADPADYCICRLILL 499
              FLCGDA PL V AV++  L     +  C+ +L+ L
Sbjct: 144 RVTFLCGDAGPLAVGAVIYHKLRSDCESQECVTKLLQL 181



 Score = 43.5 bits (101), Expect(2) = 6e-17
 Identities = 24/72 (33%), Positives = 38/72 (52%)
 Frame = +3

Query: 522 PCDLLSGLMGYVYALLLVNNIFGVEHIPTTPIPLICPSVLSSGHYLA*QINFC*YTPLML 701
           P +LL G  GY+YALL +N   G   +  + I  +  +++ SG  L+ +       PL+ 
Sbjct: 193 PDELLYGRAGYLYALLYLNTEIGPGTVCESAIKEVVNAIIESGKTLSREERKTERCPLLY 252

Query: 702 QWYPEYYVSDAH 737
           QW+ + YV  AH
Sbjct: 253 QWHRKQYVGAAH 264


  Database: RefSeqHP
    Posted date:  Aug 2, 2006 12:57 AM
  Number of letters in database: 17,774,539
  Number of sequences in database:  39,411
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 37,687,781
Number of Sequences: 39411
Number of extensions: 959751
Number of successful extensions: 2571
Number of sequences better than 1.0e-05: 2
Number of HSP's better than  0.0 without gapping: 2342
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2566
length of database: 17,774,539
effective HSP length: 102
effective length of database: 13,754,617
effective search space used: 2970997272
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqMP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611S-058624
         (958 letters)

Database: RefSeqMP 
           45,328 sequences; 21,768,885 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_067270.1| LanC (bacterial lantibiotic synthetase componen...   105   3e-41
Alignment   gi|NP_598498.1| LanC (bacterial lantibiotic synthetase componen...    66   1e-18
Alignment   gi|XP_984245.1| PREDICTED: similar to LanC (bacterial lantibiot...    66   1e-18

>ref|NP_067270.1| LanC (bacterial lantibiotic synthetase component C)-like 1 [Mus
           musculus]
          Length = 399

 Score =  105 bits (263), Expect(3) = 3e-41
 Identities = 59/113 (52%), Positives = 70/113 (61%)
 Frame = +2

Query: 179 HTWTL*FHMLLSLMDRCLQSPDPRHGSAYPVWACIAVLYLPLYDVIGDPAYLTMARVLTT 358
           H  T     LL  M+R L+S DPR G+ Y  WA IAVLYL L++V GDPAYL MA     
Sbjct: 34  HRLTNKIRELLQQMERGLKSADPRDGTGYTGWAGIAVLYLHLHNVFGDPAYLQMAHSYVK 93

Query: 359 VSLSCLTYLSFPFLCGDASPLRVAAVVHVILNCADPADYCICRLILLLNIDTH 517
            SL+CL+  S  FLCGDA PL VAAV++  +N    A+ CI RLI L  ID H
Sbjct: 94  QSLNCLSRRSITFLCGDAGPLAVAAVLYHKMNSEKQAEECITRLIHLNKIDPH 146



 Score = 73.9 bits (180), Expect(3) = 3e-41
 Identities = 36/79 (45%), Positives = 50/79 (63%)
 Frame = +3

Query: 507 LTPMAPCDLLSGLMGYVYALLLVNNIFGVEHIPTTPIPLICPSVLSSGHYLA*QINFC*Y 686
           + P  P ++L G +GY++ALL VN  FG E IP + I  IC ++L+SG  L+ + N    
Sbjct: 143 IDPHVPNEMLYGRIGYIFALLFVNKNFGEEKIPQSHIQQICENILTSGENLSRKRNLAAK 202

Query: 687 TPLMLQWYPEYYVSDAHVL 743
           +PLM +WY EYYV  AH L
Sbjct: 203 SPLMYEWYQEYYVGAAHGL 221



 Score = 28.5 bits (62), Expect(3) = 3e-41
 Identities = 11/18 (61%), Positives = 15/18 (83%)
 Frame = +3

Query: 120 QSLAQSYFDSAGTLIPEY 173
           +SLA++YFDS G L PE+
Sbjct: 15  KSLAENYFDSTGRLTPEF 32


>ref|NP_598498.1| LanC (bacterial lantibiotic synthetase component C)-like 2 [Mus
           musculus]
          Length = 450

 Score = 66.2 bits (160), Expect(2) = 1e-18
 Identities = 39/96 (40%), Positives = 51/96 (53%)
 Frame = +2

Query: 206 LLSLMDRCLQSPDPRHGSAYPVWACIAVLYLPLYDVIGDPAYLTMARVLTTVSLSCLTYL 385
           LL  M+  L++ DP   SAY  W  IA+LYL LY V GD  YL  +      +L  L+  
Sbjct: 84  LLQQMEEGLKTADPHDCSAYTGWTGIALLYLQLYRVTGDQTYLLRSLDYVKRTLRNLSGR 143

Query: 386 SFPFLCGDASPLRVAAVVHVILNCADPADYCICRLI 493
              FLCGDA PL V AV++  L     +  CI +L+
Sbjct: 144 RVTFLCGDAGPLAVGAVIYHKLKSECESQECITKLL 179



 Score = 45.8 bits (107), Expect(2) = 1e-18
 Identities = 25/72 (34%), Positives = 38/72 (52%)
 Frame = +3

Query: 522 PCDLLSGLMGYVYALLLVNNIFGVEHIPTTPIPLICPSVLSSGHYLA*QINFC*YTPLML 701
           P +LL G  GY+YALL +N   G   +  T I  +  +++ SG  L+ +       PL+ 
Sbjct: 193 PDELLYGRAGYLYALLYLNTEIGPGTVGETAIKEVVSAIIESGKSLSREERKSERCPLLY 252

Query: 702 QWYPEYYVSDAH 737
           QW+ + YV  AH
Sbjct: 253 QWHRKQYVGAAH 264


>ref|XP_984245.1| PREDICTED: similar to LanC (bacterial lantibiotic synthetase
           component C)-like 2 [Mus musculus]
          Length = 390

 Score = 66.2 bits (160), Expect(2) = 1e-18
 Identities = 39/96 (40%), Positives = 51/96 (53%)
 Frame = +2

Query: 206 LLSLMDRCLQSPDPRHGSAYPVWACIAVLYLPLYDVIGDPAYLTMARVLTTVSLSCLTYL 385
           LL  M+  L++ DP   SAY  W  IA+LYL LY V GD  YL  +      +L  L+  
Sbjct: 84  LLQQMEEGLKTADPHDCSAYTGWTGIALLYLQLYRVTGDQTYLLRSLDYVKRTLRNLSGR 143

Query: 386 SFPFLCGDASPLRVAAVVHVILNCADPADYCICRLI 493
              FLCGDA PL V AV++  L     +  CI +L+
Sbjct: 144 RVTFLCGDAGPLAVGAVIYHKLKSECESQECITKLL 179



 Score = 45.8 bits (107), Expect(2) = 1e-18
 Identities = 25/72 (34%), Positives = 38/72 (52%)
 Frame = +3

Query: 522 PCDLLSGLMGYVYALLLVNNIFGVEHIPTTPIPLICPSVLSSGHYLA*QINFC*YTPLML 701
           P +LL G  GY+YALL +N   G   +  T I  +  +++ SG  L+ +       PL+ 
Sbjct: 193 PDELLYGRAGYLYALLYLNTEIGPGTVGETAIKEVVSAIIESGKSLSREERKSERCPLLY 252

Query: 702 QWYPEYYVSDAH 737
           QW+ + YV  AH
Sbjct: 253 QWHRKQYVGAAH 264


  Database: RefSeqMP
    Posted date:  Aug 2, 2006 12:58 AM
  Number of letters in database: 21,768,885
  Number of sequences in database:  45,328
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 45,284,297
Number of Sequences: 45328
Number of extensions: 1131697
Number of successful extensions: 3131
Number of sequences better than 1.0e-05: 3
Number of HSP's better than  0.0 without gapping: 2849
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3129
length of database: 21,768,885
effective HSP length: 103
effective length of database: 17,100,101
effective search space used: 3676521715
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)