Animal-Genome cDNA 20060611S-063085


Search to RefSeqSP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611S-063085
         (825 letters)

Database: RefSeqSP 
           1040 sequences; 434,620 total letters

Searching...done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_999478.1| thioredoxin [Sus scrofa]                              50   9e-08

>ref|NP_999478.1| thioredoxin [Sus scrofa]
          Length = 105

 Score = 49.7 bits (117), Expect = 9e-08
 Identities = 25/96 (26%), Positives = 48/96 (50%)
 Frame = +3

Query: 48  VVEVGSAGQFEELLRLRAKSLLVVHFWAPWAPQGAQMNDVMAELAKEHPQVSFVKLEAEA 227
           V ++ S   F+E L    + L+VV F A W      +      L++++  V F++++ + 
Sbjct: 2   VKQIESKYAFQEALNSAGEKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVVFLEVDVDD 61

Query: 228 VPEVSEKYGISSVPTFLFFKNSQSIDRLDGAHAPEL 335
             +V+ +  +  +PTF FFK  Q +    GA+  +L
Sbjct: 62  CQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKL 97


  Database: RefSeqSP
    Posted date:  Aug 1, 2006  7:14 PM
  Number of letters in database: 434,620
  Number of sequences in database:  1040
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 790,382
Number of Sequences: 1040
Number of extensions: 20537
Number of successful extensions: 61
Number of sequences better than 1.0e-05: 1
Number of HSP's better than  0.0 without gapping: 53
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 61
length of database: 434,620
effective HSP length: 75
effective length of database: 356,620
effective search space used: 70967380
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqBP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611S-063085
         (825 letters)

Database: RefSeqBP 
           33,508 sequences; 16,112,626 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_001030273.1| thioredoxin-like [Bos taurus]                     263   2e-70
Alignment   gi|XP_873370.1| PREDICTED: similar to Thioredoxin-like protein ...    79   3e-15
Alignment   gi|NP_776393.1| thioredoxin [Bos taurus]                              49   4e-06

>ref|NP_001030273.1| thioredoxin-like [Bos taurus]
          Length = 334

 Score =  263 bits (671), Expect = 2e-70
 Identities = 132/148 (89%), Positives = 133/148 (89%)
 Frame = +3

Query: 48  VVEVGSAGQFEELLRLRAKSLLVVHFWAPWAPQGAQMNDVMAELAKEHPQVSFVKLEAEA 227
           VVEVGS+GQFEELLRLRAKSLLVVHFWAPWAPQ AQMNDVMAELAKEH QVSFVKLEAEA
Sbjct: 12  VVEVGSSGQFEELLRLRAKSLLVVHFWAPWAPQCAQMNDVMAELAKEHQQVSFVKLEAEA 71

Query: 228 VPEVSEKYGISSVPTFLFFKNSQSIDRLDGAHAPELTKKVQRHAXXXXXXXXXXEHLKED 407
           VPEVSEKY ISSVPTFLFFKNSQ IDRLDGAHAPELTKKVQRHA          EH KED
Sbjct: 72  VPEVSEKYEISSVPTFLFFKNSQKIDRLDGAHAPELTKKVQRHASSGSFSPSGSEHPKED 131

Query: 408 LSLRLKKLTHAAPCMLFMKGTPQEPRCG 491
           LSLRLKKLTHAAPCMLFMKGTPQEPRCG
Sbjct: 132 LSLRLKKLTHAAPCMLFMKGTPQEPRCG 159


>ref|XP_873370.1| PREDICTED: similar to Thioredoxin-like protein 2 (PKC-interacting
           cousin of thioredoxin) (PKC-theta-interacting protein)
           (PKCq-interacting protein) (HUSSY-22) [Bos taurus]
          Length = 164

 Score = 79.3 bits (194), Expect = 3e-15
 Identities = 38/56 (67%), Positives = 42/56 (75%)
 Frame = +3

Query: 324 APELTKKVQRHAXXXXXXXXXXEHLKEDLSLRLKKLTHAAPCMLFMKGTPQEPRCG 491
           APEL+KKVQ+HA          EHLKEDL+  LKKL  AAPC+LFMKGTPQEPRCG
Sbjct: 2   APELSKKVQQHASGGSFSPSGSEHLKEDLNQPLKKLFLAAPCILFMKGTPQEPRCG 57


>ref|NP_776393.1| thioredoxin [Bos taurus]
          Length = 105

 Score = 49.3 bits (116), Expect = 4e-06
 Identities = 25/96 (26%), Positives = 48/96 (50%)
 Frame = +3

Query: 48  VVEVGSAGQFEELLRLRAKSLLVVHFWAPWAPQGAQMNDVMAELAKEHPQVSFVKLEAEA 227
           V ++ S   F+E L    + L+VV F A W      +      L++++  V F++++ + 
Sbjct: 2   VKQIESKYAFQEALNSAGEKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVVFLEVDVDD 61

Query: 228 VPEVSEKYGISSVPTFLFFKNSQSIDRLDGAHAPEL 335
             +V+ +  +  +PTF FFK  Q +    GA+  +L
Sbjct: 62  CQDVAAECEVKCMPTFQFFKKGQKVGEFSGANKEKL 97


  Database: RefSeqBP
    Posted date:  Aug 1, 2006  7:14 PM
  Number of letters in database: 16,112,626
  Number of sequences in database:  33,508
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 30,034,456
Number of Sequences: 33508
Number of extensions: 830434
Number of successful extensions: 3188
Number of sequences better than 1.0e-05: 3
Number of HSP's better than  0.0 without gapping: 2859
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3173
length of database: 16,112,626
effective HSP length: 100
effective length of database: 12,761,826
effective search space used: 2220557724
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqHP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611S-063085
         (825 letters)

Database: RefSeqHP 
           39,411 sequences; 17,774,539 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_006532.2| thioredoxin-like [Homo sapiens]                      257   7e-69
Alignment   gi|NP_004777.1| thioredoxin-like 1 [Homo sapiens]                     52   8e-07
Alignment   gi|NP_003320.2| thioredoxin [Homo sapiens]                            49   5e-06
Alignment   gi|XP_947255.1| PREDICTED: similar to Thioredoxin domain-contai...    49   7e-06
Alignment   gi|XP_950856.1| PREDICTED: similar to thioredoxin domain-contai...    49   7e-06
Alignment   gi|XP_950855.1| PREDICTED: similar to thioredoxin domain-contai...    49   7e-06
Alignment   gi|NP_115619.4| thioredoxin domain-containing 2 [Homo sapiens]        49   7e-06

>ref|NP_006532.2| thioredoxin-like [Homo sapiens]
          Length = 335

 Score =  257 bits (657), Expect = 7e-69
 Identities = 129/148 (87%), Positives = 132/148 (89%)
 Frame = +3

Query: 48  VVEVGSAGQFEELLRLRAKSLLVVHFWAPWAPQGAQMNDVMAELAKEHPQVSFVKLEAEA 227
           V EVGSAGQFEELLRL+AKSLLVVHFWAPWAPQ AQMN+VMAELAKE PQVSFVKLEAE 
Sbjct: 13  VEEVGSAGQFEELLRLKAKSLLVVHFWAPWAPQCAQMNEVMAELAKELPQVSFVKLEAEG 72

Query: 228 VPEVSEKYGISSVPTFLFFKNSQSIDRLDGAHAPELTKKVQRHAXXXXXXXXXXEHLKED 407
           VPEVSEKY ISSVPTFLFFKNSQ IDRLDGAHAPELTKKVQRHA          EHLKED
Sbjct: 73  VPEVSEKYEISSVPTFLFFKNSQKIDRLDGAHAPELTKKVQRHASSGSFLPSANEHLKED 132

Query: 408 LSLRLKKLTHAAPCMLFMKGTPQEPRCG 491
           L+LRLKKLTHAAPCMLFMKGTPQEPRCG
Sbjct: 133 LNLRLKKLTHAAPCMLFMKGTPQEPRCG 160


>ref|NP_004777.1| thioredoxin-like 1 [Homo sapiens]
          Length = 289

 Score = 51.6 bits (122), Expect = 8e-07
 Identities = 30/103 (29%), Positives = 50/103 (48%)
 Frame = +3

Query: 48  VVEVGSAGQFEELLRLRAKSLLVVHFWAPWAPQGAQMNDVMAELAKEHPQVSFVKLEAEA 227
           V  VGS   F+  L      L VV F         ++    + ++ ++PQ  F++++   
Sbjct: 4   VKPVGSDPDFQPELSGAGSRLAVVKFTMRGCGPCLRIAPAFSSMSNKYPQAVFLEVDVHQ 63

Query: 228 VPEVSEKYGISSVPTFLFFKNSQSIDRLDGAHAPELTKKVQRH 356
               +    IS+ PTFLFF+N   ID+  GA A  L +K+++H
Sbjct: 64  CQGTAATNNISATPTFLFFRNKVRIDQYQGADAVGLEEKIKQH 106


>ref|NP_003320.2| thioredoxin [Homo sapiens]
          Length = 105

 Score = 48.9 bits (115), Expect = 5e-06
 Identities = 25/96 (26%), Positives = 47/96 (48%)
 Frame = +3

Query: 48  VVEVGSAGQFEELLRLRAKSLLVVHFWAPWAPQGAQMNDVMAELAKEHPQVSFVKLEAEA 227
           V ++ S   F+E L      L+VV F A W      +      L++++  V F++++ + 
Sbjct: 2   VKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDD 61

Query: 228 VPEVSEKYGISSVPTFLFFKNSQSIDRLDGAHAPEL 335
             +V+ +  +  +PTF FFK  Q +    GA+  +L
Sbjct: 62  CQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKL 97


>ref|XP_947255.1| PREDICTED: similar to Thioredoxin domain-containing protein 2
           (Spermatid-specific thioredoxin-1) (Sptrx-1) isoform 1
           [Homo sapiens]
          Length = 538

 Score = 48.5 bits (114), Expect = 7e-06
 Identities = 27/86 (31%), Positives = 42/86 (48%)
 Frame = +3

Query: 63  SAGQFEELLRLRAKSLLVVHFWAPWAPQGAQMNDVMAELAKEHPQVSFVKLEAEAVPEVS 242
           S   FE  L+   + L+ V F A W      +      L+ +H  V F++++A+   EV 
Sbjct: 440 SKEDFEASLKEAGERLVAVDFSATWCGPCRTIRPFFHALSVKHEDVVFLEVDADNCEEVV 499

Query: 243 EKYGISSVPTFLFFKNSQSIDRLDGA 320
            +  I  VPTF F+K  + +D L GA
Sbjct: 500 RECAIMCVPTFQFYKKEEKVDELCGA 525


>ref|XP_950856.1| PREDICTED: similar to thioredoxin domain-containing 2 isoform 3
           [Homo sapiens]
          Length = 471

 Score = 48.5 bits (114), Expect = 7e-06
 Identities = 27/86 (31%), Positives = 42/86 (48%)
 Frame = +3

Query: 63  SAGQFEELLRLRAKSLLVVHFWAPWAPQGAQMNDVMAELAKEHPQVSFVKLEAEAVPEVS 242
           S   FE  L+   + L+ V F A W      +      L+ +H  V F++++A+   EV 
Sbjct: 373 SKEDFEASLKEAGERLVAVDFSATWCGPCRTIRPFFHALSVKHEDVVFLEVDADNCEEVV 432

Query: 243 EKYGISSVPTFLFFKNSQSIDRLDGA 320
            +  I  VPTF F+K  + +D L GA
Sbjct: 433 RECAIMCVPTFQFYKKEEKVDELCGA 458


>ref|XP_950855.1| PREDICTED: similar to thioredoxin domain-containing 2 isoform 2
           [Homo sapiens]
          Length = 471

 Score = 48.5 bits (114), Expect = 7e-06
 Identities = 27/86 (31%), Positives = 42/86 (48%)
 Frame = +3

Query: 63  SAGQFEELLRLRAKSLLVVHFWAPWAPQGAQMNDVMAELAKEHPQVSFVKLEAEAVPEVS 242
           S   FE  L+   + L+ V F A W      +      L+ +H  V F++++A+   EV 
Sbjct: 373 SKEDFEASLKEAGERLVAVDFSATWCGPCRTIRPFFHALSVKHEDVVFLEVDADNCEEVV 432

Query: 243 EKYGISSVPTFLFFKNSQSIDRLDGA 320
            +  I  VPTF F+K  + +D L GA
Sbjct: 433 RECAIMCVPTFQFYKKEEKVDELCGA 458


>ref|NP_115619.4| thioredoxin domain-containing 2 [Homo sapiens]
          Length = 486

 Score = 48.5 bits (114), Expect = 7e-06
 Identities = 27/86 (31%), Positives = 42/86 (48%)
 Frame = +3

Query: 63  SAGQFEELLRLRAKSLLVVHFWAPWAPQGAQMNDVMAELAKEHPQVSFVKLEAEAVPEVS 242
           S   FE  L+   + L+ V F A W      +      L+ +H  V F++++A+   EV 
Sbjct: 388 SKEDFEASLKEAGERLVAVDFSATWCGPCRTIRPFFHALSVKHEDVVFLEVDADNCEEVV 447

Query: 243 EKYGISSVPTFLFFKNSQSIDRLDGA 320
            +  I  VPTF F+K  + +D L GA
Sbjct: 448 RECAIMCVPTFQFYKKEEKVDELCGA 473


  Database: RefSeqHP
    Posted date:  Aug 2, 2006 12:57 AM
  Number of letters in database: 17,774,539
  Number of sequences in database:  39,411
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 34,291,424
Number of Sequences: 39411
Number of extensions: 986366
Number of successful extensions: 3658
Number of sequences better than 1.0e-05: 7
Number of HSP's better than  0.0 without gapping: 3117
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3648
length of database: 17,774,539
effective HSP length: 100
effective length of database: 13,833,439
effective search space used: 2407018386
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqCP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611S-063085
         (825 letters)

Database: RefSeqCP 
           33,732 sequences; 19,266,565 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|XP_535061.2| PREDICTED: similar to Thioredoxin-like 2 protei...   255   4e-68

>ref|XP_535061.2| PREDICTED: similar to Thioredoxin-like 2 protein (PKC-interacting
           cousin of thioredoxin) (PKCq-interacting protein)
           (PKC-theta-interacting protein) [Canis familiaris]
          Length = 333

 Score =  255 bits (651), Expect = 4e-68
 Identities = 128/148 (86%), Positives = 130/148 (87%)
 Frame = +3

Query: 48  VVEVGSAGQFEELLRLRAKSLLVVHFWAPWAPQGAQMNDVMAELAKEHPQVSFVKLEAEA 227
           VVEVGSA QFEELLRLRAKSL+VVHFWAPWAPQ  QMNDVMAELAKEHPQVSFVKLEAEA
Sbjct: 11  VVEVGSAPQFEELLRLRAKSLVVVHFWAPWAPQCVQMNDVMAELAKEHPQVSFVKLEAEA 70

Query: 228 VPEVSEKYGISSVPTFLFFKNSQSIDRLDGAHAPELTKKVQRHAXXXXXXXXXXEHLKED 407
           VPEVSEKY ISSVPTFL FKNSQ IDRLDGAHAPELTKKVQRHA          EH KED
Sbjct: 71  VPEVSEKYEISSVPTFLLFKNSQKIDRLDGAHAPELTKKVQRHASSGSFPPSTNEHPKED 130

Query: 408 LSLRLKKLTHAAPCMLFMKGTPQEPRCG 491
           L +RLKKLTHAAPCMLFMKGTPQEPRCG
Sbjct: 131 LHVRLKKLTHAAPCMLFMKGTPQEPRCG 158


  Database: RefSeqCP
    Posted date:  Aug 1, 2006  9:25 PM
  Number of letters in database: 19,266,565
  Number of sequences in database:  33,732
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 35,229,836
Number of Sequences: 33732
Number of extensions: 971244
Number of successful extensions: 3704
Number of sequences better than 1.0e-05: 1
Number of HSP's better than  0.0 without gapping: 3198
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3686
length of database: 19,266,565
effective HSP length: 101
effective length of database: 15,859,633
effective search space used: 2743716509
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqMP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611S-063085
         (825 letters)

Database: RefSeqMP 
           45,328 sequences; 21,768,885 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_075629.2| thioredoxin-like 2 [Mus musculus]                    258   7e-69
Alignment   gi|XP_995522.1| PREDICTED: similar to thioredoxin-like 2 [Mus m...   188   5e-48
Alignment   gi|XP_978406.1| PREDICTED: similar to thioredoxin-like 2 [Mus m...   188   5e-48
Alignment   gi|XP_978323.1| PREDICTED: similar to thioredoxin-like 2 [Mus m...   188   5e-48
Alignment   gi|NP_058072.2| thioredoxin-like 1 [Mus musculus]                     52   1e-06
Alignment   gi|NP_705739.1| thioredoxin domain containing 2 (spermatozoa) [...    51   1e-06

>ref|NP_075629.2| thioredoxin-like 2 [Mus musculus]
          Length = 337

 Score =  258 bits (658), Expect = 7e-69
 Identities = 128/148 (86%), Positives = 130/148 (87%)
 Frame = +3

Query: 48  VVEVGSAGQFEELLRLRAKSLLVVHFWAPWAPQGAQMNDVMAELAKEHPQVSFVKLEAEA 227
           VVEVGSA QFEELLRL+ KSLLVVHFWAPWAPQ  QMNDVMAELAKEHP VSFVKLEAEA
Sbjct: 15  VVEVGSAQQFEELLRLKTKSLLVVHFWAPWAPQCVQMNDVMAELAKEHPHVSFVKLEAEA 74

Query: 228 VPEVSEKYGISSVPTFLFFKNSQSIDRLDGAHAPELTKKVQRHAXXXXXXXXXXEHLKED 407
           VPEVSEKY ISSVPTFLFFKNSQ +DRLDGAHAPELTKKVQRH           EHLKED
Sbjct: 75  VPEVSEKYEISSVPTFLFFKNSQKVDRLDGAHAPELTKKVQRHVSSGAFPPSTNEHLKED 134

Query: 408 LSLRLKKLTHAAPCMLFMKGTPQEPRCG 491
           LSLRLKKLTHAAPCMLFMKGTPQEPRCG
Sbjct: 135 LSLRLKKLTHAAPCMLFMKGTPQEPRCG 162


>ref|XP_995522.1| PREDICTED: similar to thioredoxin-like 2 [Mus musculus]
          Length = 365

 Score =  188 bits (478), Expect = 5e-48
 Identities = 97/133 (72%), Positives = 102/133 (76%)
 Frame = +3

Query: 48  VVEVGSAGQFEELLRLRAKSLLVVHFWAPWAPQGAQMNDVMAELAKEHPQVSFVKLEAEA 227
           VVEVGSA QFEELLRL+ KSLLVVHFWAPWAPQ  QMNDVMAELAKEHP VSFVKLEAEA
Sbjct: 43  VVEVGSAQQFEELLRLKTKSLLVVHFWAPWAPQCVQMNDVMAELAKEHPHVSFVKLEAEA 102

Query: 228 VPEVSEKYGISSVPTFLFFKNSQSIDRLDGAHAPELTKKVQRHAXXXXXXXXXXEHLKED 407
           VPEVSEKY ISSVP+FLFFKNSQ +DRLDGAHAPELTKKVQRH             LK+ 
Sbjct: 103 VPEVSEKYEISSVPSFLFFKNSQKVDRLDGAHAPELTKKVQRHVSSGAFRLVLMNILKKT 162

Query: 408 LSLRLKKLTHAAP 446
            +   K      P
Sbjct: 163 SAFAXKSXLTLPP 175


>ref|XP_978406.1| PREDICTED: similar to thioredoxin-like 2 [Mus musculus]
          Length = 365

 Score =  188 bits (478), Expect = 5e-48
 Identities = 97/133 (72%), Positives = 102/133 (76%)
 Frame = +3

Query: 48  VVEVGSAGQFEELLRLRAKSLLVVHFWAPWAPQGAQMNDVMAELAKEHPQVSFVKLEAEA 227
           VVEVGSA QFEELLRL+ KSLLVVHFWAPWAPQ  QMNDVMAELAKEHP VSFVKLEAEA
Sbjct: 43  VVEVGSAQQFEELLRLKTKSLLVVHFWAPWAPQCVQMNDVMAELAKEHPHVSFVKLEAEA 102

Query: 228 VPEVSEKYGISSVPTFLFFKNSQSIDRLDGAHAPELTKKVQRHAXXXXXXXXXXEHLKED 407
           VPEVSEKY ISSVP+FLFFKNSQ +DRLDGAHAPELTKKVQRH             LK+ 
Sbjct: 103 VPEVSEKYEISSVPSFLFFKNSQKVDRLDGAHAPELTKKVQRHVSSGAFRLVLMNILKKT 162

Query: 408 LSLRLKKLTHAAP 446
            +   K      P
Sbjct: 163 SAFAXKSXLTLPP 175


>ref|XP_978323.1| PREDICTED: similar to thioredoxin-like 2 [Mus musculus]
          Length = 365

 Score =  188 bits (478), Expect = 5e-48
 Identities = 97/133 (72%), Positives = 102/133 (76%)
 Frame = +3

Query: 48  VVEVGSAGQFEELLRLRAKSLLVVHFWAPWAPQGAQMNDVMAELAKEHPQVSFVKLEAEA 227
           VVEVGSA QFEELLRL+ KSLLVVHFWAPWAPQ  QMNDVMAELAKEHP VSFVKLEAEA
Sbjct: 43  VVEVGSAQQFEELLRLKTKSLLVVHFWAPWAPQCVQMNDVMAELAKEHPHVSFVKLEAEA 102

Query: 228 VPEVSEKYGISSVPTFLFFKNSQSIDRLDGAHAPELTKKVQRHAXXXXXXXXXXEHLKED 407
           VPEVSEKY ISSVP+FLFFKNSQ +DRLDGAHAPELTKKVQRH             LK+ 
Sbjct: 103 VPEVSEKYEISSVPSFLFFKNSQKVDRLDGAHAPELTKKVQRHVSSGAFRLVLMNILKKT 162

Query: 408 LSLRLKKLTHAAP 446
            +   K      P
Sbjct: 163 SAFAXKSXLTLPP 175


>ref|NP_058072.2| thioredoxin-like 1 [Mus musculus]
          Length = 289

 Score = 51.6 bits (122), Expect = 1e-06
 Identities = 30/103 (29%), Positives = 50/103 (48%)
 Frame = +3

Query: 48  VVEVGSAGQFEELLRLRAKSLLVVHFWAPWAPQGAQMNDVMAELAKEHPQVSFVKLEAEA 227
           V  VGS   F+  L      L VV F         ++    + ++ ++PQ  F++++   
Sbjct: 4   VKPVGSDPDFQPELSGAGSRLAVVKFTMRGCGPCLRIAPAFSSMSNKYPQAVFLEVDVHQ 63

Query: 228 VPEVSEKYGISSVPTFLFFKNSQSIDRLDGAHAPELTKKVQRH 356
               +    IS+ PTFLFF+N   ID+  GA A  L +K+++H
Sbjct: 64  CQGTAATNNISATPTFLFFRNKVRIDQYQGADAVGLEEKIKQH 106


>ref|NP_705739.1| thioredoxin domain containing 2 (spermatozoa) [Mus musculus]
          Length = 462

 Score = 51.2 bits (121), Expect = 1e-06
 Identities = 25/92 (27%), Positives = 47/92 (51%)
 Frame = +3

Query: 72  QFEELLRLRAKSLLVVHFWAPWAPQGAQMNDVMAELAKEHPQVSFVKLEAEAVPEVSEKY 251
           +FEE+L+   + L+ V F A W      M  +   L+ +H  V F++++ E   ++ +  
Sbjct: 367 EFEEVLKDAGEKLVAVDFSAAWCGPCRMMKPLFHSLSLKHEDVIFLEVDTEDCEQLVQDC 426

Query: 252 GISSVPTFLFFKNSQSIDRLDGAHAPELTKKV 347
            I  +PTF F+KN + +    GA   +L + +
Sbjct: 427 EIFHLPTFQFYKNEEKVGEFSGALVGKLERSI 458


  Database: RefSeqMP
    Posted date:  Aug 2, 2006 12:58 AM
  Number of letters in database: 21,768,885
  Number of sequences in database:  45,328
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 40,199,037
Number of Sequences: 45328
Number of extensions: 1107144
Number of successful extensions: 4170
Number of sequences better than 1.0e-05: 6
Number of HSP's better than  0.0 without gapping: 3624
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4143
length of database: 21,768,885
effective HSP length: 102
effective length of database: 17,145,429
effective search space used: 2949013788
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)