Animal-Genome cDNA 20060611S-063860


Search to RefSeqSP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611S-063860
         (911 letters)

Database: RefSeqSP 
           1040 sequences; 434,620 total letters

Searching...done

 ***** No hits found ******

  Database: RefSeqSP
    Posted date:  Aug 1, 2006  7:14 PM
  Number of letters in database: 434,620
  Number of sequences in database:  1040
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 793,906
Number of Sequences: 1040
Number of extensions: 18782
Number of successful extensions: 54
Number of sequences better than 1.0e-05: 0
Number of HSP's better than  0.0 without gapping: 47
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 54
length of database: 434,620
effective HSP length: 76
effective length of database: 355,580
effective search space used: 80716660
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqBP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611S-063860
         (911 letters)

Database: RefSeqBP 
           33,508 sequences; 16,112,626 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_001030273.1| thioredoxin-like [Bos taurus]                     403   e-112
Alignment   gi|XP_873370.1| PREDICTED: similar to Thioredoxin-like protein ...   174   7e-44
Alignment   gi|XP_582303.1| PREDICTED: similar to CG14407-PA [Bos taurus]         92   4e-19

>ref|NP_001030273.1| thioredoxin-like [Bos taurus]
          Length = 334

 Score =  403 bits (1035), Expect = e-112
 Identities = 205/230 (89%), Positives = 207/230 (90%)
 Frame = +3

Query: 51  SAGQFEELLRLRAKSLLVVHIWAPWAPQCAQMNDVMAELAKEHPQVSSVKLEAEAVPEVS 230
           S+GQFEELLRLRAKSLLVVH WAPWAPQCAQMNDVMAELAKEH QVS VKLEAEAVPEVS
Sbjct: 17  SSGQFEELLRLRAKSLLVVHFWAPWAPQCAQMNDVMAELAKEHQQVSFVKLEAEAVPEVS 76

Query: 231 EKYGISSVPTFLFFKMTFYLQNSQSIDRLDGAHAPELTKKVQRHAXXXXXXXXXXEHLKE 410
           EKY ISSVPTFLFFK      NSQ IDRLDGAHAPELTKKVQRHA          EH KE
Sbjct: 77  EKYEISSVPTFLFFK------NSQKIDRLDGAHAPELTKKVQRHASSGSFSPSGSEHPKE 130

Query: 411 DLSLRLKKLTHAAPCMLFMKGTPQEPRCGFSKQMVEILNKHNIQFSSFGIFSDEEVRQGL 590
           DLSLRLKKLTHAAPCMLFMKGTPQEPRCGFSKQMVEILNKHNIQFSSF IFSDEEVRQGL
Sbjct: 131 DLSLRLKKLTHAAPCMLFMKGTPQEPRCGFSKQMVEILNKHNIQFSSFDIFSDEEVRQGL 190

Query: 591 KTYSNWPTYPQLYVSGELIGGLDIIKELEASKELDTICPKAPKLEERLKV 740
           KTYS+WPTYPQLYVSGELIGGLDIIKELEASKELDTICPKAPKLEERLKV
Sbjct: 191 KTYSSWPTYPQLYVSGELIGGLDIIKELEASKELDTICPKAPKLEERLKV 240



 Score =  129 bits (323), Expect = 4e-30
 Identities = 61/93 (65%), Positives = 73/93 (78%)
 Frame = +3

Query: 414 LSLRLKKLTHAAPCMLFMKGTPQEPRCGFSKQMVEILNKHNIQFSSFGIFSDEEVRQGLK 593
           L  RLK LT+ A  MLFMKG  QE +CGFS+Q++EILN   I++ +F I  DEEVRQGLK
Sbjct: 234 LEERLKVLTNKASVMLFMKGNKQEAKCGFSRQILEILNSTGIEYETFDILEDEEVRQGLK 293

Query: 594 TYSNWPTYPQLYVSGELIGGLDIIKELEASKEL 692
            YSNWPTYPQLYV GEL+GGLDI+KEL+ + EL
Sbjct: 294 AYSNWPTYPQLYVKGELVGGLDIVKELKENGEL 326



 Score = 91.7 bits (226), Expect = 7e-19
 Identities = 45/62 (72%), Positives = 51/62 (82%)
 Frame = +1

Query: 706 PKLPN*RKGSKYLTNKASVMLFMKGNKQEAQCGFTRQILEILNSTGVYYQTFRLTEDEEN 885
           PK P   +  K LTNKASVMLFMKGNKQEA+CGF+RQILEILNSTG+ Y+TF + EDEE 
Sbjct: 229 PKAPKLEERLKVLTNKASVMLFMKGNKQEAKCGFSRQILEILNSTGIEYETFDILEDEEV 288

Query: 886 RQ 891
           RQ
Sbjct: 289 RQ 290



 Score = 56.6 bits (135), Expect = 3e-08
 Identities = 26/52 (50%), Positives = 36/52 (69%)
 Frame = +1

Query: 736 KYLTNKASVMLFMKGNKQEAQCGFTRQILEILNSTGVYYQTFRLTEDEENRQ 891
           K LT+ A  MLFMKG  QE +CGF++Q++EILN   + + +F +  DEE RQ
Sbjct: 137 KKLTHAAPCMLFMKGTPQEPRCGFSKQMVEILNKHNIQFSSFDIFSDEEVRQ 188


>ref|XP_873370.1| PREDICTED: similar to Thioredoxin-like protein 2 (PKC-interacting
           cousin of thioredoxin) (PKC-theta-interacting protein)
           (PKCq-interacting protein) (HUSSY-22) [Bos taurus]
          Length = 164

 Score =  174 bits (442), Expect = 7e-44
 Identities = 92/136 (67%), Positives = 97/136 (71%)
 Frame = +3

Query: 330 APELTKKVQRHAXXXXXXXXXXEHLKEDLSLRLKKLTHAAPCMLFMKGTPQEPRCGFSKQ 509
           APEL+KKVQ+HA          EHLKEDL+  LKKL  AAPC+LFMKGTPQEPRCGF+  
Sbjct: 2   APELSKKVQQHASGGSFSPSGSEHLKEDLNQPLKKLFLAAPCILFMKGTPQEPRCGFN-- 59

Query: 510 MVEILNKHNIQFSSFGIFSDEEVRQGLKTYSNWPTYPQLYVSGELIGGLDIIKELEASKE 689
                                EVRQ LKTYSNWPTYPQLYVSGELIGGLDIIKELEASKE
Sbjct: 60  ---------------------EVRQALKTYSNWPTYPQLYVSGELIGGLDIIKELEASKE 98

Query: 690 LDTICPKAPKLEERLK 737
           LD ICPKAPKLEERLK
Sbjct: 99  LDMICPKAPKLEERLK 114


>ref|XP_582303.1| PREDICTED: similar to CG14407-PA [Bos taurus]
          Length = 158

 Score = 92.4 bits (228), Expect = 4e-19
 Identities = 38/93 (40%), Positives = 65/93 (69%), Gaps = 1/93 (1%)
 Frame = +3

Query: 417 SLRLKKLTHAAPCMLFMKGTPQEPRCGFSKQMVEILNKHNIQ-FSSFGIFSDEEVRQGLK 593
           S  L  L      ++F+KGTP++P+CGFS  +V+IL  H ++ ++++ +  D ++RQG+K
Sbjct: 43  SEHLDALVKKDKVVVFLKGTPEQPQCGFSNAVVQILRLHGVRDYAAYNVLDDPQLRQGIK 102

Query: 594 TYSNWPTYPQLYVSGELIGGLDIIKELEASKEL 692
            YSNWPT PQ+Y++GE +GG DI+ ++  + +L
Sbjct: 103 DYSNWPTIPQVYLNGEFVGGCDILLQMHQNGDL 135


  Database: RefSeqBP
    Posted date:  Aug 1, 2006  7:14 PM
  Number of letters in database: 16,112,626
  Number of sequences in database:  33,508
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 29,527,329
Number of Sequences: 33508
Number of extensions: 721467
Number of successful extensions: 2345
Number of sequences better than 1.0e-05: 3
Number of HSP's better than  0.0 without gapping: 2169
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2342
length of database: 16,112,626
effective HSP length: 101
effective length of database: 12,728,318
effective search space used: 2571120236
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqHP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611S-063860
         (911 letters)

Database: RefSeqHP 
           39,411 sequences; 17,774,539 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_006532.2| thioredoxin-like [Homo sapiens]                      394   e-110
Alignment   gi|NP_057501.2| glutaredoxin 5 [Homo sapiens]                         94   2e-19

>ref|NP_006532.2| thioredoxin-like [Homo sapiens]
          Length = 335

 Score =  394 bits (1013), Expect = e-110
 Identities = 200/230 (86%), Positives = 206/230 (89%)
 Frame = +3

Query: 51  SAGQFEELLRLRAKSLLVVHIWAPWAPQCAQMNDVMAELAKEHPQVSSVKLEAEAVPEVS 230
           SAGQFEELLRL+AKSLLVVH WAPWAPQCAQMN+VMAELAKE PQVS VKLEAE VPEVS
Sbjct: 18  SAGQFEELLRLKAKSLLVVHFWAPWAPQCAQMNEVMAELAKELPQVSFVKLEAEGVPEVS 77

Query: 231 EKYGISSVPTFLFFKMTFYLQNSQSIDRLDGAHAPELTKKVQRHAXXXXXXXXXXEHLKE 410
           EKY ISSVPTFLFFK      NSQ IDRLDGAHAPELTKKVQRHA          EHLKE
Sbjct: 78  EKYEISSVPTFLFFK------NSQKIDRLDGAHAPELTKKVQRHASSGSFLPSANEHLKE 131

Query: 411 DLSLRLKKLTHAAPCMLFMKGTPQEPRCGFSKQMVEILNKHNIQFSSFGIFSDEEVRQGL 590
           DL+LRLKKLTHAAPCMLFMKGTPQEPRCGFSKQMVEIL+KHNIQFSSF IFSDEEVRQGL
Sbjct: 132 DLNLRLKKLTHAAPCMLFMKGTPQEPRCGFSKQMVEILHKHNIQFSSFDIFSDEEVRQGL 191

Query: 591 KTYSNWPTYPQLYVSGELIGGLDIIKELEASKELDTICPKAPKLEERLKV 740
           K YS+WPTYPQLYVSGELIGGLDIIKELEAS+ELDTICPKAPKLEERLKV
Sbjct: 192 KAYSSWPTYPQLYVSGELIGGLDIIKELEASEELDTICPKAPKLEERLKV 241



 Score =  129 bits (325), Expect = 3e-30
 Identities = 61/93 (65%), Positives = 73/93 (78%)
 Frame = +3

Query: 414 LSLRLKKLTHAAPCMLFMKGTPQEPRCGFSKQMVEILNKHNIQFSSFGIFSDEEVRQGLK 593
           L  RLK LT+ A  MLFMKG  QE +CGFSKQ++EILN   +++ +F I  DEEVRQGLK
Sbjct: 235 LEERLKVLTNKASVMLFMKGNKQEAKCGFSKQILEILNSTGVEYETFDILEDEEVRQGLK 294

Query: 594 TYSNWPTYPQLYVSGELIGGLDIIKELEASKEL 692
            YSNWPTYPQLYV GEL+GGLDI+KEL+ + EL
Sbjct: 295 AYSNWPTYPQLYVKGELVGGLDIVKELKENGEL 327



 Score = 90.9 bits (224), Expect = 1e-18
 Identities = 45/62 (72%), Positives = 51/62 (82%)
 Frame = +1

Query: 706 PKLPN*RKGSKYLTNKASVMLFMKGNKQEAQCGFTRQILEILNSTGVYYQTFRLTEDEEN 885
           PK P   +  K LTNKASVMLFMKGNKQEA+CGF++QILEILNSTGV Y+TF + EDEE 
Sbjct: 230 PKAPKLEERLKVLTNKASVMLFMKGNKQEAKCGFSKQILEILNSTGVEYETFDILEDEEV 289

Query: 886 RQ 891
           RQ
Sbjct: 290 RQ 291



 Score = 54.7 bits (130), Expect = 1e-07
 Identities = 25/52 (48%), Positives = 36/52 (69%)
 Frame = +1

Query: 736 KYLTNKASVMLFMKGNKQEAQCGFTRQILEILNSTGVYYQTFRLTEDEENRQ 891
           K LT+ A  MLFMKG  QE +CGF++Q++EIL+   + + +F +  DEE RQ
Sbjct: 138 KKLTHAAPCMLFMKGTPQEPRCGFSKQMVEILHKHNIQFSSFDIFSDEEVRQ 189


>ref|NP_057501.2| glutaredoxin 5 [Homo sapiens]
          Length = 157

 Score = 93.6 bits (231), Expect = 2e-19
 Identities = 38/91 (41%), Positives = 65/91 (71%), Gaps = 1/91 (1%)
 Frame = +3

Query: 423 RLKKLTHAAPCMLFMKGTPQEPRCGFSKQMVEILNKHNIQ-FSSFGIFSDEEVRQGLKTY 599
           +L  L      ++F+KGTP++P+CGFS  +V+IL  H ++ ++++ +  D E+RQG+K Y
Sbjct: 44  QLDALVKKDKVVVFLKGTPEQPQCGFSNAVVQILRLHGVRDYAAYNVLDDPELRQGIKDY 103

Query: 600 SNWPTYPQLYVSGELIGGLDIIKELEASKEL 692
           SNWPT PQ+Y++GE +GG DI+ ++  + +L
Sbjct: 104 SNWPTIPQVYLNGEFVGGCDILLQMHQNGDL 134


  Database: RefSeqHP
    Posted date:  Aug 2, 2006 12:57 AM
  Number of letters in database: 17,774,539
  Number of sequences in database:  39,411
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 33,414,564
Number of Sequences: 39411
Number of extensions: 835798
Number of successful extensions: 2844
Number of sequences better than 1.0e-05: 2
Number of HSP's better than  0.0 without gapping: 2490
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2839
length of database: 17,774,539
effective HSP length: 101
effective length of database: 13,794,028
effective search space used: 2786393656
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqCP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611S-063860
         (911 letters)

Database: RefSeqCP 
           33,732 sequences; 19,266,565 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|XP_535061.2| PREDICTED: similar to Thioredoxin-like 2 protei...   395   e-110

>ref|XP_535061.2| PREDICTED: similar to Thioredoxin-like 2 protein (PKC-interacting
           cousin of thioredoxin) (PKCq-interacting protein)
           (PKC-theta-interacting protein) [Canis familiaris]
          Length = 333

 Score =  395 bits (1014), Expect = e-110
 Identities = 201/230 (87%), Positives = 203/230 (88%)
 Frame = +3

Query: 51  SAGQFEELLRLRAKSLLVVHIWAPWAPQCAQMNDVMAELAKEHPQVSSVKLEAEAVPEVS 230
           SA QFEELLRLRAKSL+VVH WAPWAPQC QMNDVMAELAKEHPQVS VKLEAEAVPEVS
Sbjct: 16  SAPQFEELLRLRAKSLVVVHFWAPWAPQCVQMNDVMAELAKEHPQVSFVKLEAEAVPEVS 75

Query: 231 EKYGISSVPTFLFFKMTFYLQNSQSIDRLDGAHAPELTKKVQRHAXXXXXXXXXXEHLKE 410
           EKY ISSVPTFL FK      NSQ IDRLDGAHAPELTKKVQRHA          EH KE
Sbjct: 76  EKYEISSVPTFLLFK------NSQKIDRLDGAHAPELTKKVQRHASSGSFPPSTNEHPKE 129

Query: 411 DLSLRLKKLTHAAPCMLFMKGTPQEPRCGFSKQMVEILNKHNIQFSSFGIFSDEEVRQGL 590
           DL +RLKKLTHAAPCMLFMKGTPQEPRCGFSKQMVEILNKHNIQFSSF IFSDEEVRQGL
Sbjct: 130 DLHVRLKKLTHAAPCMLFMKGTPQEPRCGFSKQMVEILNKHNIQFSSFDIFSDEEVRQGL 189

Query: 591 KTYSNWPTYPQLYVSGELIGGLDIIKELEASKELDTICPKAPKLEERLKV 740
           KTYSNWPTYPQLYVSGELIGGLDIIKELEAS ELDTICPKAPKLEERLKV
Sbjct: 190 KTYSNWPTYPQLYVSGELIGGLDIIKELEASDELDTICPKAPKLEERLKV 239



 Score =  131 bits (329), Expect = 1e-30
 Identities = 62/93 (66%), Positives = 74/93 (79%)
 Frame = +3

Query: 414 LSLRLKKLTHAAPCMLFMKGTPQEPRCGFSKQMVEILNKHNIQFSSFGIFSDEEVRQGLK 593
           L  RLK LT+ A  MLFMKG  QE +CGFSKQ++EILN   +++ +F I  DEEVRQGLK
Sbjct: 233 LEERLKVLTNKASVMLFMKGNKQEAKCGFSKQILEILNSTGVEYETFDILEDEEVRQGLK 292

Query: 594 TYSNWPTYPQLYVSGELIGGLDIIKELEASKEL 692
           TYSNWPTYPQLYV GEL+GGLDI+KEL+ + EL
Sbjct: 293 TYSNWPTYPQLYVKGELVGGLDIVKELKDNGEL 325



 Score = 90.9 bits (224), Expect = 2e-18
 Identities = 45/62 (72%), Positives = 51/62 (82%)
 Frame = +1

Query: 706 PKLPN*RKGSKYLTNKASVMLFMKGNKQEAQCGFTRQILEILNSTGVYYQTFRLTEDEEN 885
           PK P   +  K LTNKASVMLFMKGNKQEA+CGF++QILEILNSTGV Y+TF + EDEE 
Sbjct: 228 PKAPKLEERLKVLTNKASVMLFMKGNKQEAKCGFSKQILEILNSTGVEYETFDILEDEEV 287

Query: 886 RQ 891
           RQ
Sbjct: 288 RQ 289



 Score = 56.6 bits (135), Expect = 3e-08
 Identities = 26/52 (50%), Positives = 36/52 (69%)
 Frame = +1

Query: 736 KYLTNKASVMLFMKGNKQEAQCGFTRQILEILNSTGVYYQTFRLTEDEENRQ 891
           K LT+ A  MLFMKG  QE +CGF++Q++EILN   + + +F +  DEE RQ
Sbjct: 136 KKLTHAAPCMLFMKGTPQEPRCGFSKQMVEILNKHNIQFSSFDIFSDEEVRQ 187


  Database: RefSeqCP
    Posted date:  Aug 1, 2006  9:25 PM
  Number of letters in database: 19,266,565
  Number of sequences in database:  33,732
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 34,730,231
Number of Sequences: 33732
Number of extensions: 851129
Number of successful extensions: 2831
Number of sequences better than 1.0e-05: 1
Number of HSP's better than  0.0 without gapping: 2597
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2825
length of database: 19,266,565
effective HSP length: 102
effective length of database: 15,825,901
effective search space used: 3181006101
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqMP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611S-063860
         (911 letters)

Database: RefSeqMP 
           45,328 sequences; 21,768,885 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_075629.2| thioredoxin-like 2 [Mus musculus]                    396   e-110
Alignment   gi|XP_995522.1| PREDICTED: similar to thioredoxin-like 2 [Mus m...   172   4e-43
Alignment   gi|XP_978406.1| PREDICTED: similar to thioredoxin-like 2 [Mus m...   172   4e-43
Alignment   gi|XP_978323.1| PREDICTED: similar to thioredoxin-like 2 [Mus m...   172   4e-43
Alignment   gi|NP_082695.1| glutaredoxin 5 [Mus musculus]                         94   3e-19

>ref|NP_075629.2| thioredoxin-like 2 [Mus musculus]
          Length = 337

 Score =  396 bits (1018), Expect = e-110
 Identities = 200/230 (86%), Positives = 204/230 (88%)
 Frame = +3

Query: 51  SAGQFEELLRLRAKSLLVVHIWAPWAPQCAQMNDVMAELAKEHPQVSSVKLEAEAVPEVS 230
           SA QFEELLRL+ KSLLVVH WAPWAPQC QMNDVMAELAKEHP VS VKLEAEAVPEVS
Sbjct: 20  SAQQFEELLRLKTKSLLVVHFWAPWAPQCVQMNDVMAELAKEHPHVSFVKLEAEAVPEVS 79

Query: 231 EKYGISSVPTFLFFKMTFYLQNSQSIDRLDGAHAPELTKKVQRHAXXXXXXXXXXEHLKE 410
           EKY ISSVPTFLFFK      NSQ +DRLDGAHAPELTKKVQRH           EHLKE
Sbjct: 80  EKYEISSVPTFLFFK------NSQKVDRLDGAHAPELTKKVQRHVSSGAFPPSTNEHLKE 133

Query: 411 DLSLRLKKLTHAAPCMLFMKGTPQEPRCGFSKQMVEILNKHNIQFSSFGIFSDEEVRQGL 590
           DLSLRLKKLTHAAPCMLFMKGTPQEPRCGFSKQMVEIL+KHNIQFSSF IFSDEEVRQGL
Sbjct: 134 DLSLRLKKLTHAAPCMLFMKGTPQEPRCGFSKQMVEILHKHNIQFSSFDIFSDEEVRQGL 193

Query: 591 KTYSNWPTYPQLYVSGELIGGLDIIKELEASKELDTICPKAPKLEERLKV 740
           KTYSNWPTYPQLYVSGELIGGLDIIKELEAS+ELDTICPKAPKLEERLKV
Sbjct: 194 KTYSNWPTYPQLYVSGELIGGLDIIKELEASEELDTICPKAPKLEERLKV 243



 Score =  128 bits (321), Expect = 9e-30
 Identities = 60/93 (64%), Positives = 74/93 (79%)
 Frame = +3

Query: 414 LSLRLKKLTHAAPCMLFMKGTPQEPRCGFSKQMVEILNKHNIQFSSFGIFSDEEVRQGLK 593
           L  RLK LT+ A  MLFMKG  QE +CGFSKQ++EILN   +++ +F I  DEEVRQGLK
Sbjct: 237 LEERLKVLTNKASVMLFMKGNKQEAKCGFSKQILEILNSTGVEYETFDILEDEEVRQGLK 296

Query: 594 TYSNWPTYPQLYVSGELIGGLDIIKELEASKEL 692
           T+SNWPTYPQLYV G+L+GGLDI+KEL+ + EL
Sbjct: 297 TFSNWPTYPQLYVRGDLVGGLDIVKELKDNGEL 329



 Score = 90.9 bits (224), Expect = 2e-18
 Identities = 45/62 (72%), Positives = 51/62 (82%)
 Frame = +1

Query: 706 PKLPN*RKGSKYLTNKASVMLFMKGNKQEAQCGFTRQILEILNSTGVYYQTFRLTEDEEN 885
           PK P   +  K LTNKASVMLFMKGNKQEA+CGF++QILEILNSTGV Y+TF + EDEE 
Sbjct: 232 PKAPKLEERLKVLTNKASVMLFMKGNKQEAKCGFSKQILEILNSTGVEYETFDILEDEEV 291

Query: 886 RQ 891
           RQ
Sbjct: 292 RQ 293



 Score = 54.7 bits (130), Expect = 1e-07
 Identities = 25/52 (48%), Positives = 36/52 (69%)
 Frame = +1

Query: 736 KYLTNKASVMLFMKGNKQEAQCGFTRQILEILNSTGVYYQTFRLTEDEENRQ 891
           K LT+ A  MLFMKG  QE +CGF++Q++EIL+   + + +F +  DEE RQ
Sbjct: 140 KKLTHAAPCMLFMKGTPQEPRCGFSKQMVEILHKHNIQFSSFDIFSDEEVRQ 191


>ref|XP_995522.1| PREDICTED: similar to thioredoxin-like 2 [Mus musculus]
          Length = 365

 Score =  172 bits (436), Expect = 4e-43
 Identities = 91/134 (67%), Positives = 96/134 (71%)
 Frame = +3

Query: 51  SAGQFEELLRLRAKSLLVVHIWAPWAPQCAQMNDVMAELAKEHPQVSSVKLEAEAVPEVS 230
           SA QFEELLRL+ KSLLVVH WAPWAPQC QMNDVMAELAKEHP VS VKLEAEAVPEVS
Sbjct: 48  SAQQFEELLRLKTKSLLVVHFWAPWAPQCVQMNDVMAELAKEHPHVSFVKLEAEAVPEVS 107

Query: 231 EKYGISSVPTFLFFKMTFYLQNSQSIDRLDGAHAPELTKKVQRHAXXXXXXXXXXEHLKE 410
           EKY ISSVP+FLFFK      NSQ +DRLDGAHAPELTKKVQRH             LK+
Sbjct: 108 EKYEISSVPSFLFFK------NSQKVDRLDGAHAPELTKKVQRHVSSGAFRLVLMNILKK 161

Query: 411 DLSLRLKKLTHAAP 452
             +   K      P
Sbjct: 162 TSAFAXKSXLTLPP 175



 Score =  127 bits (318), Expect(2) = 2e-34
 Identities = 71/111 (63%), Positives = 79/111 (71%)
 Frame = +1

Query: 406 KKTSAFA*RS*PTLPPACCS*REHPRSRAAVSASRWWKFLTNIISSLAVLVSSQMKKFAK 585
           KKTSAFA +S  TLPPACCS REH ++RA VSASRWWK  TN I S A L+SSQMKKF +
Sbjct: 160 KKTSAFAXKSXLTLPPACCSXREHLKNRAVVSASRWWKSFTNTIFSSAALISSQMKKFDR 219

Query: 586 ASKPIPIGPPTPSSMFLESS*EDLI*SRS*KHLKN*IQFAPKLPN*RKGSK 738
            SK   IGPP  SSMFLES  EDL   RS KH K+  +  PK P+ RKGSK
Sbjct: 220 GSKRTLIGPPILSSMFLESXXEDLTXLRSWKHQKSWTRSVPKHPSXRKGSK 270



 Score = 38.1 bits (87), Expect(2) = 2e-34
 Identities = 23/48 (47%), Positives = 29/48 (60%)
 Frame = +2

Query: 749 IKLL*CSL*RETNRKPSVVSPDKSWKF*IVLVSTTRRSDLLKMRKTGR 892
           IKL  CSL +ETNRK +V S +K WK+ IVL    +     KM+K  R
Sbjct: 274 IKLRXCSLXKETNRKQNVDSANKFWKYXIVLGLNMKLLIYWKMKKCVR 321


>ref|XP_978406.1| PREDICTED: similar to thioredoxin-like 2 [Mus musculus]
          Length = 365

 Score =  172 bits (436), Expect = 4e-43
 Identities = 91/134 (67%), Positives = 96/134 (71%)
 Frame = +3

Query: 51  SAGQFEELLRLRAKSLLVVHIWAPWAPQCAQMNDVMAELAKEHPQVSSVKLEAEAVPEVS 230
           SA QFEELLRL+ KSLLVVH WAPWAPQC QMNDVMAELAKEHP VS VKLEAEAVPEVS
Sbjct: 48  SAQQFEELLRLKTKSLLVVHFWAPWAPQCVQMNDVMAELAKEHPHVSFVKLEAEAVPEVS 107

Query: 231 EKYGISSVPTFLFFKMTFYLQNSQSIDRLDGAHAPELTKKVQRHAXXXXXXXXXXEHLKE 410
           EKY ISSVP+FLFFK      NSQ +DRLDGAHAPELTKKVQRH             LK+
Sbjct: 108 EKYEISSVPSFLFFK------NSQKVDRLDGAHAPELTKKVQRHVSSGAFRLVLMNILKK 161

Query: 411 DLSLRLKKLTHAAP 452
             +   K      P
Sbjct: 162 TSAFAXKSXLTLPP 175



 Score =  127 bits (318), Expect(2) = 2e-34
 Identities = 71/111 (63%), Positives = 79/111 (71%)
 Frame = +1

Query: 406 KKTSAFA*RS*PTLPPACCS*REHPRSRAAVSASRWWKFLTNIISSLAVLVSSQMKKFAK 585
           KKTSAFA +S  TLPPACCS REH ++RA VSASRWWK  TN I S A L+SSQMKKF +
Sbjct: 160 KKTSAFAXKSXLTLPPACCSXREHLKNRAVVSASRWWKSFTNTIFSSAALISSQMKKFDR 219

Query: 586 ASKPIPIGPPTPSSMFLESS*EDLI*SRS*KHLKN*IQFAPKLPN*RKGSK 738
            SK   IGPP  SSMFLES  EDL   RS KH K+  +  PK P+ RKGSK
Sbjct: 220 GSKRTLIGPPILSSMFLESXXEDLTXLRSWKHQKSWTRSVPKHPSXRKGSK 270



 Score = 38.1 bits (87), Expect(2) = 2e-34
 Identities = 23/48 (47%), Positives = 29/48 (60%)
 Frame = +2

Query: 749 IKLL*CSL*RETNRKPSVVSPDKSWKF*IVLVSTTRRSDLLKMRKTGR 892
           IKL  CSL +ETNRK +V S +K WK+ IVL    +     KM+K  R
Sbjct: 274 IKLRXCSLXKETNRKQNVDSANKFWKYXIVLGLNMKLLIYWKMKKCVR 321


>ref|XP_978323.1| PREDICTED: similar to thioredoxin-like 2 [Mus musculus]
          Length = 365

 Score =  172 bits (436), Expect = 4e-43
 Identities = 91/134 (67%), Positives = 96/134 (71%)
 Frame = +3

Query: 51  SAGQFEELLRLRAKSLLVVHIWAPWAPQCAQMNDVMAELAKEHPQVSSVKLEAEAVPEVS 230
           SA QFEELLRL+ KSLLVVH WAPWAPQC QMNDVMAELAKEHP VS VKLEAEAVPEVS
Sbjct: 48  SAQQFEELLRLKTKSLLVVHFWAPWAPQCVQMNDVMAELAKEHPHVSFVKLEAEAVPEVS 107

Query: 231 EKYGISSVPTFLFFKMTFYLQNSQSIDRLDGAHAPELTKKVQRHAXXXXXXXXXXEHLKE 410
           EKY ISSVP+FLFFK      NSQ +DRLDGAHAPELTKKVQRH             LK+
Sbjct: 108 EKYEISSVPSFLFFK------NSQKVDRLDGAHAPELTKKVQRHVSSGAFRLVLMNILKK 161

Query: 411 DLSLRLKKLTHAAP 452
             +   K      P
Sbjct: 162 TSAFAXKSXLTLPP 175



 Score =  127 bits (318), Expect(2) = 2e-34
 Identities = 71/111 (63%), Positives = 79/111 (71%)
 Frame = +1

Query: 406 KKTSAFA*RS*PTLPPACCS*REHPRSRAAVSASRWWKFLTNIISSLAVLVSSQMKKFAK 585
           KKTSAFA +S  TLPPACCS REH ++RA VSASRWWK  TN I S A L+SSQMKKF +
Sbjct: 160 KKTSAFAXKSXLTLPPACCSXREHLKNRAVVSASRWWKSFTNTIFSSAALISSQMKKFDR 219

Query: 586 ASKPIPIGPPTPSSMFLESS*EDLI*SRS*KHLKN*IQFAPKLPN*RKGSK 738
            SK   IGPP  SSMFLES  EDL   RS KH K+  +  PK P+ RKGSK
Sbjct: 220 GSKRTLIGPPILSSMFLESXXEDLTXLRSWKHQKSWTRSVPKHPSXRKGSK 270



 Score = 38.1 bits (87), Expect(2) = 2e-34
 Identities = 23/48 (47%), Positives = 29/48 (60%)
 Frame = +2

Query: 749 IKLL*CSL*RETNRKPSVVSPDKSWKF*IVLVSTTRRSDLLKMRKTGR 892
           IKL  CSL +ETNRK +V S +K WK+ IVL    +     KM+K  R
Sbjct: 274 IKLRXCSLXKETNRKQNVDSANKFWKYXIVLGLNMKLLIYWKMKKCVR 321


>ref|NP_082695.1| glutaredoxin 5 [Mus musculus]
          Length = 152

 Score = 93.6 bits (231), Expect = 3e-19
 Identities = 38/91 (41%), Positives = 65/91 (71%), Gaps = 1/91 (1%)
 Frame = +3

Query: 423 RLKKLTHAAPCMLFMKGTPQEPRCGFSKQMVEILNKHNIQ-FSSFGIFSDEEVRQGLKTY 599
           +L  L      ++F+KGTP++P+CGFS  +V+IL  H ++ ++++ +  D E+RQG+K Y
Sbjct: 40  QLDALVKKDKVVVFLKGTPEQPQCGFSNAVVQILRLHGVRDYAAYNVLDDPELRQGIKDY 99

Query: 600 SNWPTYPQLYVSGELIGGLDIIKELEASKEL 692
           SNWPT PQ+Y++GE +GG DI+ ++  + +L
Sbjct: 100 SNWPTIPQVYLNGEFVGGCDILLQMHQNGDL 130


  Database: RefSeqMP
    Posted date:  Aug 2, 2006 12:58 AM
  Number of letters in database: 21,768,885
  Number of sequences in database:  45,328
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 39,643,166
Number of Sequences: 45328
Number of extensions: 962249
Number of successful extensions: 3212
Number of sequences better than 1.0e-05: 5
Number of HSP's better than  0.0 without gapping: 2870
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3207
length of database: 21,768,885
effective HSP length: 103
effective length of database: 17,100,101
effective search space used: 3420020200
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)