Animal-Genome cDNA 20060611S-064517


Search to RefSeqSP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611S-064517
         (1084 letters)

Database: RefSeqSP 
           1040 sequences; 434,620 total letters

Searching...done

 ***** No hits found ******

  Database: RefSeqSP
    Posted date:  Aug 1, 2006  7:14 PM
  Number of letters in database: 434,620
  Number of sequences in database:  1040
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 856,535
Number of Sequences: 1040
Number of extensions: 20277
Number of successful extensions: 121
Number of sequences better than 1.0e-05: 0
Number of HSP's better than  0.0 without gapping: 91
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 112
length of database: 434,620
effective HSP length: 78
effective length of database: 353,500
effective search space used: 99687000
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqBP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611S-064517
         (1084 letters)

Database: RefSeqBP 
           33,508 sequences; 16,112,626 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_776702.1| clathrin, light polypeptide B (light chain B) [...   301   2e-83
Alignment   gi|NP_776447.1| clathrin, light polypeptide (Lca) [Bos taurus]       187   4e-49

>ref|NP_776702.1| clathrin, light polypeptide B (light chain B) [Bos taurus]
          Length = 210

 Score =  301 bits (771), Expect(2) = 2e-83
 Identities = 151/156 (96%), Positives = 152/156 (97%)
 Frame = +1

Query: 319 QPGPASGAGPEDMGTTVNGDVFQDANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQ 498
           QPGPASGA  EDMG TVNGDVFQ+ANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQ
Sbjct: 56  QPGPASGAS-EDMGATVNGDVFQEANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQ 114

Query: 499 ELDAASKVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNRASEEAFVKESKEETPGTEWE 678
           ELDAASKV EQEWREKAKKDLEEWNQRQSEQVEKNKINNRASEEAFVKESKEETPGTEWE
Sbjct: 115 ELDAASKVMEQEWREKAKKDLEEWNQRQSEQVEKNKINNRASEEAFVKESKEETPGTEWE 174

Query: 679 KVAQLCDFNPKSSKQCKDVSRLRSVLMSLKQTPLSR 786
           KVAQLCDFNPKSSKQCKDVSRLRSVLMSLKQTPLSR
Sbjct: 175 KVAQLCDFNPKSSKQCKDVSRLRSVLMSLKQTPLSR 210



 Score = 27.3 bits (59), Expect(2) = 2e-83
 Identities = 15/37 (40%), Positives = 15/37 (40%)
 Frame = +2

Query: 209 MADDXXXXXXXXXXXXXXXXXXXXXXFLAQQESEIAG 319
           MADD                      FLAQQESEIAG
Sbjct: 1   MADDFGFFSSSESGAPEAAEEDPAAAFLAQQESEIAG 37


>ref|NP_776447.1| clathrin, light polypeptide (Lca) [Bos taurus]
          Length = 243

 Score =  187 bits (475), Expect(2) = 4e-49
 Identities = 95/175 (54%), Positives = 117/175 (66%), Gaps = 30/175 (17%)
 Frame = +1

Query: 346 PEDMGTTVNGDVFQDANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAASKVT 525
           P+ +    NGD +Q++NGP D YAAI+Q DRL  EPESIRKWREEQ +RL+ LDA S+  
Sbjct: 67  PDAVDGVTNGDYYQESNGPTDSYAAISQVDRLQSEPESIRKWREEQTERLEALDANSRKQ 126

Query: 526 EQEWREKAKKDLEEWNQRQSEQVEKNKINNR----------------------------- 618
           E EW+EKA K+L+EW  RQ EQ++K K NNR                             
Sbjct: 127 EAEWKEKAIKELDEWYARQDEQLQKTKANNRVADEAFYKQPFADVIGYVTNINHPCYSLE 186

Query: 619 -ASEEAFVKESKEETPGTEWEKVAQLCDFNPKSSKQCKDVSRLRSVLMSLKQTPL 780
            A+EEAFV + +E +PGTEWE+VA+LCDFNPKSSKQ KDVSR+RSVL+SLKQ PL
Sbjct: 187 QAAEEAFVNDIEESSPGTEWERVARLCDFNPKSSKQAKDVSRMRSVLISLKQAPL 241



 Score = 26.6 bits (57), Expect(2) = 4e-49
 Identities = 14/28 (50%), Positives = 16/28 (57%)
 Frame = +2

Query: 287 FLAQQESEIAGSRDQRVGQVLRTWGPQS 370
           FLAQQESEIAG  +     +L    P S
Sbjct: 30  FLAQQESEIAGIENDEAFAILDGGAPGS 57


  Database: RefSeqBP
    Posted date:  Aug 1, 2006  7:14 PM
  Number of letters in database: 16,112,626
  Number of sequences in database:  33,508
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 33,323,182
Number of Sequences: 33508
Number of extensions: 838055
Number of successful extensions: 5431
Number of sequences better than 1.0e-05: 2
Number of HSP's better than  0.0 without gapping: 4114
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5326
length of database: 16,112,626
effective HSP length: 103
effective length of database: 12,661,302
effective search space used: 3253954614
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqCP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611S-064517
         (1084 letters)

Database: RefSeqCP 
           33,732 sequences; 19,266,565 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|XP_866115.1| PREDICTED: similar to clathrin, light polypepti...   310   5e-86
Alignment   gi|XP_866083.1| PREDICTED: similar to clathrin, light polypepti...   300   7e-83
Alignment   gi|XP_546220.2| PREDICTED: similar to Clathrin light chain B (L...   299   1e-82
Alignment   gi|XP_866066.1| PREDICTED: similar to clathrin, light polypepti...   296   5e-82
Alignment   gi|XP_866050.1| PREDICTED: similar to clathrin, light polypepti...   292   1e-80
Alignment   gi|XP_866787.1| PREDICTED: similar to clathrin, light polypepti...   202   4e-52
Alignment   gi|XP_866835.1| PREDICTED: similar to clathrin, light polypepti...   192   5e-49
Alignment   gi|XP_866825.1| PREDICTED: similar to Clathrin light chain A (L...   192   5e-49
Alignment   gi|XP_866761.1| PREDICTED: similar to Clathrin light chain A (L...   191   8e-49
Alignment   gi|XP_531996.2| PREDICTED: similar to Clathrin light chain A (L...   187   2e-47

>ref|XP_866115.1| PREDICTED: similar to clathrin, light polypeptide isoform a isoform
           5 [Canis familiaris]
          Length = 211

 Score =  310 bits (794), Expect(2) = 5e-86
 Identities = 152/156 (97%), Positives = 154/156 (98%)
 Frame = +1

Query: 319 QPGPASGAGPEDMGTTVNGDVFQDANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQ 498
           QPGPA GAG EDMGTT+NGDVFQ+ANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQ
Sbjct: 56  QPGPAGGAGSEDMGTTINGDVFQEANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQ 115

Query: 499 ELDAASKVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNRASEEAFVKESKEETPGTEWE 678
           ELDAASKVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNRASEEAFVKESKEETPGTEWE
Sbjct: 116 ELDAASKVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNRASEEAFVKESKEETPGTEWE 175

Query: 679 KVAQLCDFNPKSSKQCKDVSRLRSVLMSLKQTPLSR 786
           KVAQLCDFNPKSSKQCKDVSRLRSVLMSLKQTPLSR
Sbjct: 176 KVAQLCDFNPKSSKQCKDVSRLRSVLMSLKQTPLSR 211



 Score = 27.3 bits (59), Expect(2) = 5e-86
 Identities = 15/37 (40%), Positives = 15/37 (40%)
 Frame = +2

Query: 209 MADDXXXXXXXXXXXXXXXXXXXXXXFLAQQESEIAG 319
           MADD                      FLAQQESEIAG
Sbjct: 1   MADDFGFFSSSESGAPEAAEEDPAAAFLAQQESEIAG 37


>ref|XP_866083.1| PREDICTED: similar to clathrin, light polypeptide isoform a isoform
           4 [Canis familiaris]
          Length = 213

 Score =  300 bits (767), Expect(2) = 7e-83
 Identities = 148/153 (96%), Positives = 150/153 (98%)
 Frame = +1

Query: 328 PASGAGPEDMGTTVNGDVFQDANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELD 507
           P S AG EDMGTT+NGDVFQ+ANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELD
Sbjct: 61  PPSTAGSEDMGTTINGDVFQEANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELD 120

Query: 508 AASKVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNRASEEAFVKESKEETPGTEWEKVA 687
           AASKVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNRASEEAFVKESKEETPGTEWEKVA
Sbjct: 121 AASKVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNRASEEAFVKESKEETPGTEWEKVA 180

Query: 688 QLCDFNPKSSKQCKDVSRLRSVLMSLKQTPLSR 786
           QLCDFNPKSSKQCKDVSRLRSVLMSLKQTPLSR
Sbjct: 181 QLCDFNPKSSKQCKDVSRLRSVLMSLKQTPLSR 213



 Score = 27.3 bits (59), Expect(2) = 7e-83
 Identities = 15/37 (40%), Positives = 15/37 (40%)
 Frame = +2

Query: 209 MADDXXXXXXXXXXXXXXXXXXXXXXFLAQQESEIAG 319
           MADD                      FLAQQESEIAG
Sbjct: 1   MADDFGFFSSSESGAPEAAEEDPAAAFLAQQESEIAG 37


>ref|XP_546220.2| PREDICTED: similar to Clathrin light chain B (Lcb) isoform 1 [Canis
           familiaris]
          Length = 229

 Score =  299 bits (765), Expect(2) = 1e-82
 Identities = 152/174 (87%), Positives = 154/174 (88%), Gaps = 18/174 (10%)
 Frame = +1

Query: 319 QPGPASGAGPEDMGTTVNGDVFQDANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQ 498
           QPGPA GAG EDMGTT+NGDVFQ+ANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQ
Sbjct: 56  QPGPAGGAGSEDMGTTINGDVFQEANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQ 115

Query: 499 ELDAASKVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNR------------------AS 624
           ELDAASKVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNR                  AS
Sbjct: 116 ELDAASKVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNRIADKAFYQQPDADIIGYVAS 175

Query: 625 EEAFVKESKEETPGTEWEKVAQLCDFNPKSSKQCKDVSRLRSVLMSLKQTPLSR 786
           EEAFVKESKEETPGTEWEKVAQLCDFNPKSSKQCKDVSRLRSVLMSLKQTPLSR
Sbjct: 176 EEAFVKESKEETPGTEWEKVAQLCDFNPKSSKQCKDVSRLRSVLMSLKQTPLSR 229



 Score = 27.3 bits (59), Expect(2) = 1e-82
 Identities = 15/37 (40%), Positives = 15/37 (40%)
 Frame = +2

Query: 209 MADDXXXXXXXXXXXXXXXXXXXXXXFLAQQESEIAG 319
           MADD                      FLAQQESEIAG
Sbjct: 1   MADDFGFFSSSESGAPEAAEEDPAAAFLAQQESEIAG 37


>ref|XP_866066.1| PREDICTED: similar to clathrin, light polypeptide isoform a isoform
           3 [Canis familiaris]
          Length = 207

 Score =  296 bits (759), Expect(2) = 5e-82
 Identities = 146/149 (97%), Positives = 148/149 (99%)
 Frame = +1

Query: 340 AGPEDMGTTVNGDVFQDANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAASK 519
           AG EDMGTT+NGDVFQ+ANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAASK
Sbjct: 59  AGSEDMGTTINGDVFQEANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAASK 118

Query: 520 VTEQEWREKAKKDLEEWNQRQSEQVEKNKINNRASEEAFVKESKEETPGTEWEKVAQLCD 699
           VTEQEWREKAKKDLEEWNQRQSEQVEKNKINNRASEEAFVKESKEETPGTEWEKVAQLCD
Sbjct: 119 VTEQEWREKAKKDLEEWNQRQSEQVEKNKINNRASEEAFVKESKEETPGTEWEKVAQLCD 178

Query: 700 FNPKSSKQCKDVSRLRSVLMSLKQTPLSR 786
           FNPKSSKQCKDVSRLRSVLMSLKQTPLSR
Sbjct: 179 FNPKSSKQCKDVSRLRSVLMSLKQTPLSR 207



 Score = 27.3 bits (59), Expect(2) = 5e-82
 Identities = 15/37 (40%), Positives = 15/37 (40%)
 Frame = +2

Query: 209 MADDXXXXXXXXXXXXXXXXXXXXXXFLAQQESEIAG 319
           MADD                      FLAQQESEIAG
Sbjct: 1   MADDFGFFSSSESGAPEAAEEDPAAAFLAQQESEIAG 37


>ref|XP_866050.1| PREDICTED: similar to clathrin, light polypeptide isoform a isoform
           2 [Canis familiaris]
          Length = 208

 Score =  292 bits (747), Expect(2) = 1e-80
 Identities = 147/162 (90%), Positives = 150/162 (92%), Gaps = 9/162 (5%)
 Frame = +1

Query: 328 PASGAGPE---------DMGTTVNGDVFQDANGPADGYAAIAQADRLTQEPESIRKWREE 480
           PA  +G E         DMGTT+NGDVFQ+ANGPADGYAAIAQADRLTQEPESIRKWREE
Sbjct: 47  PAGNSGEEEGPRYGPLGDMGTTINGDVFQEANGPADGYAAIAQADRLTQEPESIRKWREE 106

Query: 481 QRKRLQELDAASKVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNRASEEAFVKESKEET 660
           QRKRLQELDAASKVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNRASEEAFVKESKEET
Sbjct: 107 QRKRLQELDAASKVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNRASEEAFVKESKEET 166

Query: 661 PGTEWEKVAQLCDFNPKSSKQCKDVSRLRSVLMSLKQTPLSR 786
           PGTEWEKVAQLCDFNPKSSKQCKDVSRLRSVLMSLKQTPLSR
Sbjct: 167 PGTEWEKVAQLCDFNPKSSKQCKDVSRLRSVLMSLKQTPLSR 208



 Score = 27.3 bits (59), Expect(2) = 1e-80
 Identities = 15/37 (40%), Positives = 15/37 (40%)
 Frame = +2

Query: 209 MADDXXXXXXXXXXXXXXXXXXXXXXFLAQQESEIAG 319
           MADD                      FLAQQESEIAG
Sbjct: 1   MADDFGFFSSSESGAPEAAEEDPAAAFLAQQESEIAG 37


>ref|XP_866787.1| PREDICTED: similar to clathrin, light polypeptide A isoform a
           isoform 3 [Canis familiaris]
          Length = 218

 Score =  202 bits (515), Expect = 4e-52
 Identities = 97/154 (62%), Positives = 119/154 (77%)
 Frame = +1

Query: 319 QPGPASGAGPEDMGTTVNGDVFQDANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQ 498
           QP       P+ +   +NG+ +Q++NGP D YAAI+Q DRL  EPESIRKWREEQ +RL+
Sbjct: 63  QPHGEPPGVPDAVDGVMNGEYYQESNGPTDSYAAISQVDRLQSEPESIRKWREEQTERLE 122

Query: 499 ELDAASKVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNRASEEAFVKESKEETPGTEWE 678
            LDA S+  E EW+EKA K+LEEW  RQ EQ++K K NNRA+EEAFV +  E +PGTEWE
Sbjct: 123 ALDANSRKQEAEWKEKAIKELEEWYARQDEQLQKTKANNRAAEEAFVNDIDESSPGTEWE 182

Query: 679 KVAQLCDFNPKSSKQCKDVSRLRSVLMSLKQTPL 780
           +VA+LCDFNPKSSKQ KDVSR+RSVL+SLKQ PL
Sbjct: 183 RVARLCDFNPKSSKQAKDVSRMRSVLISLKQAPL 216


>ref|XP_866835.1| PREDICTED: similar to clathrin, light polypeptide A isoform a
           isoform 7 [Canis familiaris]
          Length = 139

 Score =  192 bits (488), Expect = 5e-49
 Identities = 91/132 (68%), Positives = 109/132 (82%)
 Frame = +1

Query: 385 QDANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAASKVTEQEWREKAKKDLE 564
           +++NGP D YAAI+Q DRL  EPESIRKWREEQ +RL+ LDA S+  E EW+EKA K+LE
Sbjct: 6   RESNGPTDSYAAISQVDRLQSEPESIRKWREEQTERLEALDANSRKQEAEWKEKAIKELE 65

Query: 565 EWNQRQSEQVEKNKINNRASEEAFVKESKEETPGTEWEKVAQLCDFNPKSSKQCKDVSRL 744
           EW  RQ EQ++K K NNRA+EEAFV +  E +PGTEWE+VA+LCDFNPKSSKQ KDVSR+
Sbjct: 66  EWYARQDEQLQKTKANNRAAEEAFVNDIDESSPGTEWERVARLCDFNPKSSKQAKDVSRM 125

Query: 745 RSVLMSLKQTPL 780
           RSVL+SLKQ PL
Sbjct: 126 RSVLISLKQAPL 137


>ref|XP_866825.1| PREDICTED: similar to Clathrin light chain A (Lca) isoform 6 [Canis
           familiaris]
          Length = 230

 Score =  192 bits (488), Expect = 5e-49
 Identities = 96/166 (57%), Positives = 119/166 (71%), Gaps = 12/166 (7%)
 Frame = +1

Query: 319 QPGPASGAGPEDMGTTVNGDVFQDANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQ 498
           QP       P+ +   +NG+ +Q++NGP D YAAI+Q DRL  EPESIRKWREEQ +RL+
Sbjct: 63  QPHGEPPGVPDAVDGVMNGEYYQESNGPTDSYAAISQVDRLQSEPESIRKWREEQTERLE 122

Query: 499 ELDAASKVTEQEWREKAKKDLEEWNQRQSEQVEKNKINN------------RASEEAFVK 642
            LDA S+  E EW+EKA K+LEEW  RQ EQ++K K NN            +A+EEAFV 
Sbjct: 123 ALDANSRKQEAEWKEKAIKELEEWYARQDEQLQKTKANNSTNINHPCYSLEQAAEEAFVN 182

Query: 643 ESKEETPGTEWEKVAQLCDFNPKSSKQCKDVSRLRSVLMSLKQTPL 780
           +  E +PGTEWE+VA+LCDFNPKSSKQ KDVSR+RSVL+SLKQ PL
Sbjct: 183 DIDESSPGTEWERVARLCDFNPKSSKQAKDVSRMRSVLISLKQAPL 228


>ref|XP_866761.1| PREDICTED: similar to Clathrin light chain A (Lca) isoform 2 [Canis
           familiaris]
          Length = 236

 Score =  191 bits (486), Expect = 8e-49
 Identities = 97/172 (56%), Positives = 119/172 (69%), Gaps = 18/172 (10%)
 Frame = +1

Query: 319 QPGPASGAGPEDMGTTVNGDVFQDANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQ 498
           QP       P+ +   +NG+ +Q++NGP D YAAI+Q DRL  EPESIRKWREEQ +RL+
Sbjct: 63  QPHGEPPGVPDAVDGVMNGEYYQESNGPTDSYAAISQVDRLQSEPESIRKWREEQTERLE 122

Query: 499 ELDAASKVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNR------------------AS 624
            LDA S+  E EW+EKA K+LEEW  RQ EQ++K K NNR                  A+
Sbjct: 123 ALDANSRKQEAEWKEKAIKELEEWYARQDEQLQKTKANNRVADEAFYKQPFADVIGYVAA 182

Query: 625 EEAFVKESKEETPGTEWEKVAQLCDFNPKSSKQCKDVSRLRSVLMSLKQTPL 780
           EEAFV +  E +PGTEWE+VA+LCDFNPKSSKQ KDVSR+RSVL+SLKQ PL
Sbjct: 183 EEAFVNDIDESSPGTEWERVARLCDFNPKSSKQAKDVSRMRSVLISLKQAPL 234


>ref|XP_531996.2| PREDICTED: similar to Clathrin light chain A (Lca) isoform 1 [Canis
           familiaris]
          Length = 248

 Score =  187 bits (474), Expect = 2e-47
 Identities = 97/184 (52%), Positives = 119/184 (64%), Gaps = 30/184 (16%)
 Frame = +1

Query: 319 QPGPASGAGPEDMGTTVNGDVFQDANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQ 498
           QP       P+ +   +NG+ +Q++NGP D YAAI+Q DRL  EPESIRKWREEQ +RL+
Sbjct: 63  QPHGEPPGVPDAVDGVMNGEYYQESNGPTDSYAAISQVDRLQSEPESIRKWREEQTERLE 122

Query: 499 ELDAASKVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNR-------------------- 618
            LDA S+  E EW+EKA K+LEEW  RQ EQ++K K NNR                    
Sbjct: 123 ALDANSRKQEAEWKEKAIKELEEWYARQDEQLQKTKANNRVADEAFYKQPFADVIGYVTN 182

Query: 619 ----------ASEEAFVKESKEETPGTEWEKVAQLCDFNPKSSKQCKDVSRLRSVLMSLK 768
                     A+EEAFV +  E +PGTEWE+VA+LCDFNPKSSKQ KDVSR+RSVL+SLK
Sbjct: 183 INHPCYSLEQAAEEAFVNDIDESSPGTEWERVARLCDFNPKSSKQAKDVSRMRSVLISLK 242

Query: 769 QTPL 780
           Q PL
Sbjct: 243 QAPL 246


  Database: RefSeqCP
    Posted date:  Aug 1, 2006  9:25 PM
  Number of letters in database: 19,266,565
  Number of sequences in database:  33,732
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 39,203,021
Number of Sequences: 33732
Number of extensions: 989471
Number of successful extensions: 7181
Number of sequences better than 1.0e-05: 10
Number of HSP's better than  0.0 without gapping: 5082
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6932
length of database: 19,266,565
effective HSP length: 104
effective length of database: 15,758,437
effective search space used: 4034159872
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqHP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611S-064517
         (1084 letters)

Database: RefSeqHP 
           39,411 sequences; 17,774,539 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_001825.1| clathrin, light polypeptide isoform a [Homo sap...   310   3e-86
Alignment   gi|NP_009028.1| clathrin, light polypeptide isoform b [Homo sap...   299   7e-83
Alignment   gi|NP_001824.1| clathrin, light polypeptide A isoform a [Homo s...   206   3e-53
Alignment   gi|NP_009027.1| clathrin, light polypeptide A isoform b [Homo s...   190   2e-48

>ref|NP_001825.1| clathrin, light polypeptide isoform a [Homo sapiens]
          Length = 211

 Score =  310 bits (795), Expect(2) = 3e-86
 Identities = 153/156 (98%), Positives = 154/156 (98%)
 Frame = +1

Query: 319 QPGPASGAGPEDMGTTVNGDVFQDANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQ 498
           QPGP SGAG EDMGTTVNGDVFQ+ANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQ
Sbjct: 56  QPGPTSGAGSEDMGTTVNGDVFQEANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQ 115

Query: 499 ELDAASKVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNRASEEAFVKESKEETPGTEWE 678
           ELDAASKVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNRASEEAFVKESKEETPGTEWE
Sbjct: 116 ELDAASKVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNRASEEAFVKESKEETPGTEWE 175

Query: 679 KVAQLCDFNPKSSKQCKDVSRLRSVLMSLKQTPLSR 786
           KVAQLCDFNPKSSKQCKDVSRLRSVLMSLKQTPLSR
Sbjct: 176 KVAQLCDFNPKSSKQCKDVSRLRSVLMSLKQTPLSR 211



 Score = 27.3 bits (59), Expect(2) = 3e-86
 Identities = 15/37 (40%), Positives = 15/37 (40%)
 Frame = +2

Query: 209 MADDXXXXXXXXXXXXXXXXXXXXXXFLAQQESEIAG 319
           MADD                      FLAQQESEIAG
Sbjct: 1   MADDFGFFSSSESGAPEAAEEDPAAAFLAQQESEIAG 37


>ref|NP_009028.1| clathrin, light polypeptide isoform b [Homo sapiens]
          Length = 229

 Score =  299 bits (766), Expect(2) = 7e-83
 Identities = 153/174 (87%), Positives = 154/174 (88%), Gaps = 18/174 (10%)
 Frame = +1

Query: 319 QPGPASGAGPEDMGTTVNGDVFQDANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQ 498
           QPGP SGAG EDMGTTVNGDVFQ+ANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQ
Sbjct: 56  QPGPTSGAGSEDMGTTVNGDVFQEANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQ 115

Query: 499 ELDAASKVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNR------------------AS 624
           ELDAASKVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNR                  AS
Sbjct: 116 ELDAASKVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNRIADKAFYQQPDADIIGYVAS 175

Query: 625 EEAFVKESKEETPGTEWEKVAQLCDFNPKSSKQCKDVSRLRSVLMSLKQTPLSR 786
           EEAFVKESKEETPGTEWEKVAQLCDFNPKSSKQCKDVSRLRSVLMSLKQTPLSR
Sbjct: 176 EEAFVKESKEETPGTEWEKVAQLCDFNPKSSKQCKDVSRLRSVLMSLKQTPLSR 229



 Score = 27.3 bits (59), Expect(2) = 7e-83
 Identities = 15/37 (40%), Positives = 15/37 (40%)
 Frame = +2

Query: 209 MADDXXXXXXXXXXXXXXXXXXXXXXFLAQQESEIAG 319
           MADD                      FLAQQESEIAG
Sbjct: 1   MADDFGFFSSSESGAPEAAEEDPAAAFLAQQESEIAG 37


>ref|NP_001824.1| clathrin, light polypeptide A isoform a [Homo sapiens]
          Length = 218

 Score =  206 bits (524), Expect = 3e-53
 Identities = 98/154 (63%), Positives = 120/154 (77%)
 Frame = +1

Query: 319 QPGPASGAGPEDMGTTVNGDVFQDANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQ 498
           QP      GP+ +   +NG+ +Q++NGP D YAAI+Q DRL  EPESIRKWREEQ +RL+
Sbjct: 63  QPHGEPPGGPDAVDGVMNGEYYQESNGPTDSYAAISQVDRLQSEPESIRKWREEQMERLE 122

Query: 499 ELDAASKVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNRASEEAFVKESKEETPGTEWE 678
            LDA S+  E EW+EKA K+LEEW  RQ EQ++K K NNRA+EEAFV +  E +PGTEWE
Sbjct: 123 ALDANSRKQEAEWKEKAIKELEEWYARQDEQLQKTKANNRAAEEAFVNDIDESSPGTEWE 182

Query: 679 KVAQLCDFNPKSSKQCKDVSRLRSVLMSLKQTPL 780
           +VA+LCDFNPKSSKQ KDVSR+RSVL+SLKQ PL
Sbjct: 183 RVARLCDFNPKSSKQAKDVSRMRSVLISLKQAPL 216


>ref|NP_009027.1| clathrin, light polypeptide A isoform b [Homo sapiens]
          Length = 248

 Score =  190 bits (483), Expect = 2e-48
 Identities = 98/184 (53%), Positives = 120/184 (65%), Gaps = 30/184 (16%)
 Frame = +1

Query: 319 QPGPASGAGPEDMGTTVNGDVFQDANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQ 498
           QP      GP+ +   +NG+ +Q++NGP D YAAI+Q DRL  EPESIRKWREEQ +RL+
Sbjct: 63  QPHGEPPGGPDAVDGVMNGEYYQESNGPTDSYAAISQVDRLQSEPESIRKWREEQMERLE 122

Query: 499 ELDAASKVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNR-------------------- 618
            LDA S+  E EW+EKA K+LEEW  RQ EQ++K K NNR                    
Sbjct: 123 ALDANSRKQEAEWKEKAIKELEEWYARQDEQLQKTKANNRVADEAFYKQPFADVIGYVTN 182

Query: 619 ----------ASEEAFVKESKEETPGTEWEKVAQLCDFNPKSSKQCKDVSRLRSVLMSLK 768
                     A+EEAFV +  E +PGTEWE+VA+LCDFNPKSSKQ KDVSR+RSVL+SLK
Sbjct: 183 INHPCYSLEQAAEEAFVNDIDESSPGTEWERVARLCDFNPKSSKQAKDVSRMRSVLISLK 242

Query: 769 QTPL 780
           Q PL
Sbjct: 243 QAPL 246


  Database: RefSeqHP
    Posted date:  Aug 2, 2006 12:57 AM
  Number of letters in database: 17,774,539
  Number of sequences in database:  39,411
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 38,310,925
Number of Sequences: 39411
Number of extensions: 1008823
Number of successful extensions: 6919
Number of sequences better than 1.0e-05: 4
Number of HSP's better than  0.0 without gapping: 4793
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6719
length of database: 17,774,539
effective HSP length: 103
effective length of database: 13,715,206
effective search space used: 3524807942
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqMP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20060611S-064517
         (1084 letters)

Database: RefSeqMP 
           45,328 sequences; 21,768,885 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_083146.1| clathrin, light polypeptide (Lcb) [Mus musculus]     305   6e-84
Alignment   gi|NP_058040.1| clathrin, light polypeptide (Lca) [Mus musculus]     195   8e-50

>ref|NP_083146.1| clathrin, light polypeptide (Lcb) [Mus musculus]
          Length = 211

 Score =  305 bits (780), Expect(2) = 6e-84
 Identities = 151/156 (96%), Positives = 153/156 (98%)
 Frame = +1

Query: 319 QPGPASGAGPEDMGTTVNGDVFQDANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQ 498
           QPG ASGAG EDM TTVNGDVFQ+ANGPADGYAAIAQADRLTQEPESIRKWREEQ+KRLQ
Sbjct: 56  QPGLASGAGSEDMSTTVNGDVFQEANGPADGYAAIAQADRLTQEPESIRKWREEQKKRLQ 115

Query: 499 ELDAASKVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNRASEEAFVKESKEETPGTEWE 678
           ELDAASKVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNRASEEAFVKESKEETPGTEWE
Sbjct: 116 ELDAASKVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNRASEEAFVKESKEETPGTEWE 175

Query: 679 KVAQLCDFNPKSSKQCKDVSRLRSVLMSLKQTPLSR 786
           KVAQLCDFNPKSSKQCKDVSRLRSVLMSLKQTPLSR
Sbjct: 176 KVAQLCDFNPKSSKQCKDVSRLRSVLMSLKQTPLSR 211



 Score = 25.8 bits (55), Expect(2) = 6e-84
 Identities = 14/37 (37%), Positives = 15/37 (40%)
 Frame = +2

Query: 209 MADDXXXXXXXXXXXXXXXXXXXXXXFLAQQESEIAG 319
           MA+D                      FLAQQESEIAG
Sbjct: 1   MAEDFGFFSSSESGAPEAAEEDPAAAFLAQQESEIAG 37


>ref|NP_058040.1| clathrin, light polypeptide (Lca) [Mus musculus]
          Length = 235

 Score =  195 bits (495), Expect = 8e-50
 Identities = 99/174 (56%), Positives = 122/174 (70%), Gaps = 21/174 (12%)
 Frame = +1

Query: 322 PGPAS---GAGPEDMGTTVNGDVFQDANGPADGYAAIAQADRLTQEPESIRKWREEQRKR 492
           PG A+   G GP+ +   +NG+ +Q++NGP D YAAI++ DRL  EPESIRKWREEQ +R
Sbjct: 60  PGRATRRAGGGPDAVDGVMNGEYYQESNGPTDSYAAISEVDRLQSEPESIRKWREEQTER 119

Query: 493 LQELDAASKVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNRASEEAFVKES-------- 648
           L+ LDA S+  E EW+EKA K+LEEW  RQ EQ++K K NNRA+EEAF K+         
Sbjct: 120 LEALDANSRKQEAEWKEKAIKELEEWYARQDEQLQKTKANNRAAEEAFYKQPFADVIGYV 179

Query: 649 ----------KEETPGTEWEKVAQLCDFNPKSSKQCKDVSRLRSVLMSLKQTPL 780
                      E +PGTEWE+VA LCDFNPKSSKQ KDVSR+RSVL+SLKQ PL
Sbjct: 180 AAEEAFVNDIDESSPGTEWERVAPLCDFNPKSSKQAKDVSRMRSVLISLKQAPL 233


  Database: RefSeqMP
    Posted date:  Aug 2, 2006 12:58 AM
  Number of letters in database: 21,768,885
  Number of sequences in database:  45,328
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 44,212,129
Number of Sequences: 45328
Number of extensions: 1098827
Number of successful extensions: 8931
Number of sequences better than 1.0e-05: 2
Number of HSP's better than  0.0 without gapping: 5290
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7716
length of database: 21,768,885
effective HSP length: 105
effective length of database: 17,009,445
effective search space used: 4337408475
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)