Search to RefSeqBP_Rel49
BLASTX 2.2.24 [Aug-08-2010]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= 20110601C-000610
(835 letters)
Database: RefSeq49_BP.fasta
33,088 sequences; 17,681,374 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
Alignment gi|XP_002687884.1| PREDICTED: C-type lectin domain family 2, me... 48 9e-06
>ref|XP_002687884.1| PREDICTED: C-type lectin domain family 2, member e-like [Bos
taurus].
Length = 208
Score = 48.1 bits (113), Expect = 9e-06
Identities = 30/69 (43%), Positives = 41/69 (59%), Gaps = 3/69 (4%)
Frame = +3
Query: 39 MTSLEA-LKFLQTGHTCRESMSEGQSGEDLQRKCLSITS--LPFPKLACFIIPMAVLAAA 209
MTS E LK L+T T RE+ +SG+ LQ+KCL+ITS P C +I + ++A
Sbjct: 1 MTSTEVFLKILETDPTYRENTEAWRSGKGLQKKCLAITSSVTPATLCCCILIILILVALN 60
Query: 210 VIALSTFLA 236
V+ LS LA
Sbjct: 61 VVTLSVLLA 69
Database: RefSeq49_BP.fasta
Posted date: Oct 17, 2011 1:42 PM
Number of letters in database: 17,681,374
Number of sequences in database: 33,088
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 33088
Number of Hits to DB: 16,634,846
Number of extensions: 741639
Number of successful extensions: 617
Number of sequences better than 1.0e-05: 1
Number of HSP's gapped: 617
Number of HSP's successfully gapped: 1
Length of query: 278
Length of database: 17,681,374
Length adjustment: 101
Effective length of query: 177
Effective length of database: 14,339,486
Effective search space: 2538089022
Effective search space used: 2538089022
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 34 (17.7 bits)
Search to RefSeqCP_Rel49
BLASTX 2.2.24 [Aug-08-2010]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= 20110601C-000610
(835 letters)
Database: RefSeq49_CP.fasta
33,336 sequences; 18,874,504 total letters
Searching..................................................done
***** No hits found ******
Database: RefSeq49_CP.fasta
Posted date: Oct 17, 2011 1:42 PM
Number of letters in database: 18,874,504
Number of sequences in database: 33,336
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 33336
Number of Hits to DB: 14,784,345
Number of extensions: 295879
Number of successful extensions: 666
Number of sequences better than 1.0e-05: 0
Number of HSP's gapped: 666
Number of HSP's successfully gapped: 0
Length of query: 278
Length of database: 18,874,504
Length adjustment: 101
Effective length of query: 177
Effective length of database: 15,507,568
Effective search space: 2744839536
Effective search space used: 2744839536
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 34 (17.7 bits)
Search to RefSeqHP_Rel49
BLASTX 2.2.24 [Aug-08-2010]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= 20110601C-000610
(835 letters)
Database: RefSeq49_HP.fasta
32,964 sequences; 18,297,164 total letters
Searching..................................................done
***** No hits found ******
Database: RefSeq49_HP.fasta
Posted date: Oct 17, 2011 1:42 PM
Number of letters in database: 18,297,164
Number of sequences in database: 32,964
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 32964
Number of Hits to DB: 14,525,567
Number of extensions: 258746
Number of successful extensions: 623
Number of sequences better than 1.0e-05: 0
Number of HSP's gapped: 623
Number of HSP's successfully gapped: 0
Length of query: 278
Length of database: 18,297,164
Length adjustment: 101
Effective length of query: 177
Effective length of database: 14,967,800
Effective search space: 2649300600
Effective search space used: 2649300600
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 34 (17.7 bits)
Search to RefSeqMP_Rel49
BLASTX 2.2.24 [Aug-08-2010]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= 20110601C-000610
(835 letters)
Database: RefSeq49_MP.fasta
30,036 sequences; 15,617,559 total letters
Searching..................................................done
***** No hits found ******
Database: RefSeq49_MP.fasta
Posted date: Oct 17, 2011 1:42 PM
Number of letters in database: 15,617,559
Number of sequences in database: 30,036
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 30036
Number of Hits to DB: 12,554,366
Number of extensions: 244933
Number of successful extensions: 557
Number of sequences better than 1.0e-05: 0
Number of HSP's gapped: 556
Number of HSP's successfully gapped: 0
Length of query: 278
Length of database: 15,617,559
Length adjustment: 100
Effective length of query: 178
Effective length of database: 12,613,959
Effective search space: 2245284702
Effective search space used: 2245284702
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 33 (17.3 bits)
Search to RefSeqSP_Rel49
BLASTX 2.2.24 [Aug-08-2010]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= 20110601C-000610
(835 letters)
Database: RefSeq49_SP.fasta
24,897 sequences; 11,343,932 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
Alignment gi|XP_003126541.1| PREDICTED: c-type lectin domain family 2 mem... 130 7e-31
Alignment gi|XP_003126540.1| PREDICTED: c-type lectin domain family 2 mem... 130 7e-31
>ref|XP_003126541.1| PREDICTED: c-type lectin domain family 2 member H-like isoform 2
[Sus scrofa].
Length = 229
Score = 130 bits (328), Expect = 7e-31
Identities = 66/66 (100%), Positives = 66/66 (100%)
Frame = +3
Query: 39 MTSLEALKFLQTGHTCRESMSEGQSGEDLQRKCLSITSLPFPKLACFIIPMAVLAAAVIA 218
MTSLEALKFLQTGHTCRESMSEGQSGEDLQRKCLSITSLPFPKLACFIIPMAVLAAAVIA
Sbjct: 1 MTSLEALKFLQTGHTCRESMSEGQSGEDLQRKCLSITSLPFPKLACFIIPMAVLAAAVIA 60
Query: 219 LSTFLA 236
LSTFLA
Sbjct: 61 LSTFLA 66
>ref|XP_003126540.1| PREDICTED: c-type lectin domain family 2 member H-like isoform 1
[Sus scrofa].
Length = 212
Score = 130 bits (328), Expect = 7e-31
Identities = 66/66 (100%), Positives = 66/66 (100%)
Frame = +3
Query: 39 MTSLEALKFLQTGHTCRESMSEGQSGEDLQRKCLSITSLPFPKLACFIIPMAVLAAAVIA 218
MTSLEALKFLQTGHTCRESMSEGQSGEDLQRKCLSITSLPFPKLACFIIPMAVLAAAVIA
Sbjct: 1 MTSLEALKFLQTGHTCRESMSEGQSGEDLQRKCLSITSLPFPKLACFIIPMAVLAAAVIA 60
Query: 219 LSTFLA 236
LSTFLA
Sbjct: 61 LSTFLA 66
Database: RefSeq49_SP.fasta
Posted date: Oct 17, 2011 1:42 PM
Number of letters in database: 11,343,932
Number of sequences in database: 24,897
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 24897
Number of Hits to DB: 14,857,053
Number of extensions: 1194544
Number of successful extensions: 389
Number of sequences better than 1.0e-05: 2
Number of HSP's gapped: 389
Number of HSP's successfully gapped: 2
Length of query: 278
Length of database: 11,343,932
Length adjustment: 98
Effective length of query: 180
Effective length of database: 8,904,026
Effective search space: 1602724680
Effective search space used: 1602724680
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 33 (17.3 bits)
Search to Sscrofa10_2
BLASTN 2.2.24 [Aug-08-2010]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= 20110601C-000610
(835 letters)
Database: Sscrofa_10.2.fasta
4582 sequences; 2,808,509,378 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
Sscrofa_Chr05 325 2e-86
>Sscrofa_Chr05
|| Length = 111506441
Score = 325 bits (164), Expect = 2e-86
Identities = 164/164 (100%)
Strand = Plus / Minus
Query: 114 ggggaggatctccaaagaaaatgtctatccattacatctctaccttttcccaagcttgct 173
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 65038517 ggggaggatctccaaagaaaatgtctatccattacatctctaccttttcccaagcttgct 65038458
Query: 174 tgtttcatcatccctatggcagtcttagctgcagctgtgattgcactttccacttttttg 233
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 65038457 tgtttcatcatccctatggcagtcttagctgcagctgtgattgcactttccacttttttg 65038398
Query: 234 gcaggtaagtgacgtgtgctccacacttgacaatgttcttcaca 277
||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 65038397 gcaggtaagtgacgtgtgctccacacttgacaatgttcttcaca 65038354
Score = 226 bits (114), Expect = 2e-56
Identities = 114/114 (100%)
Strand = Plus / Minus
Query: 2 agtcgtgttccgggaacaagctgaaaggagcctgaacatgacttcgttggaggctttgaa 61
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 65041254 agtcgtgttccgggaacaagctgaaaggagcctgaacatgacttcgttggaggctttgaa 65041195
Query: 62 attcttacagacaggtcatacctgcagagaaagcatgtctgaagggcaatctgg 115
||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 65041194 attcttacagacaggtcatacctgcagagaaagcatgtctgaagggcaatctgg 65041141
Score = 97.6 bits (49), Expect = 9e-18
Identities = 49/49 (100%)
Strand = Plus / Minus
Query: 519 ccatgtggctgtctggagaaagcattctggaccaagtagaatcacctct 567
|||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 65038112 ccatgtggctgtctggagaaagcattctggaccaagtagaatcacctct 65038064
Database: Sscrofa_10.2.fasta
Posted date: Nov 16, 2011 10:34 AM
Number of letters in database: 2,808,509,378
Number of sequences in database: 4582
Lambda K H
1.37 0.711 1.31
Gapped
Lambda K H
1.37 0.711 1.31
Matrix: blastn matrix:1 -3
Gap Penalties: Existence: 5, Extension: 2
Number of Sequences: 4582
Number of Hits to DB: 10,692,672
Number of extensions: 76
Number of successful extensions: 76
Number of sequences better than 1.0e-05: 1
Number of HSP's gapped: 76
Number of HSP's successfully gapped: 3
Length of query: 835
Length of database: 2,808,509,378
Length adjustment: 21
Effective length of query: 814
Effective length of database: 2,808,413,156
Effective search space: 2286048308984
Effective search space used: 2286048308984
X1: 11 (21.8 bits)
X2: 15 (29.7 bits)
X3: 50 (99.1 bits)
S1: 18 (36.2 bits)
S2: 29 (58.0 bits)