Search to RefSeqBP_Rel49
BLASTX 2.2.24 [Aug-08-2010]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= 20110601C-013117
(517 letters)
Database: RefSeq49_BP.fasta
33,088 sequences; 17,681,374 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
Alignment gi|NP_001124230.1| copper transport protein ATOX1 [Bos taurus]. 132 2e-31
>ref|NP_001124230.1| copper transport protein ATOX1 [Bos taurus].
Length = 68
Score = 132 bits (332), Expect = 2e-31
Identities = 63/64 (98%), Positives = 64/64 (100%)
Frame = +1
Query: 112 MPKHEFSVDMTCEGCSNAVTRVLNKLGGVQFDIDLPNKKVCIDSEHSVDTLLETLGKTGK 291
MPKHEFSVDMTCEGCSNAVTRVLNKLGGVQFDIDLPNKKVCI+SEHSVDTLLETLGKTGK
Sbjct: 1 MPKHEFSVDMTCEGCSNAVTRVLNKLGGVQFDIDLPNKKVCINSEHSVDTLLETLGKTGK 60
Query: 292 AVSY 303
AVSY
Sbjct: 61 AVSY 64
Database: RefSeq49_BP.fasta
Posted date: Oct 17, 2011 1:42 PM
Number of letters in database: 17,681,374
Number of sequences in database: 33,088
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 33088
Number of Hits to DB: 18,634,478
Number of extensions: 549965
Number of successful extensions: 3170
Number of sequences better than 1.0e-05: 1
Number of HSP's gapped: 3142
Number of HSP's successfully gapped: 1
Length of query: 172
Length of database: 17,681,374
Length adjustment: 95
Effective length of query: 77
Effective length of database: 14,538,014
Effective search space: 1119427078
Effective search space used: 1119427078
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 32 (16.9 bits)
Animal-Genome cDNA 20110601C-013117
Search to RefSeqCP_Rel49
BLASTX 2.2.24 [Aug-08-2010]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= 20110601C-013117
(517 letters)
Database: RefSeq49_CP.fasta
33,336 sequences; 18,874,504 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
Alignment gi|NP_001003119.1| copper transport protein ATOX1 [Canis lupus ... 124 5e-29
>ref|NP_001003119.1| copper transport protein ATOX1 [Canis lupus familiaris].
Length = 68
Score = 124 bits (311), Expect = 5e-29
Identities = 59/64 (92%), Positives = 62/64 (96%)
Frame = +1
Query: 112 MPKHEFSVDMTCEGCSNAVTRVLNKLGGVQFDIDLPNKKVCIDSEHSVDTLLETLGKTGK 291
MPKHEFSVDMTCEGCSNAV+RVLNKLGGV+FDIDLPNKKVCI+SEHSVD LLETL KTGK
Sbjct: 1 MPKHEFSVDMTCEGCSNAVSRVLNKLGGVEFDIDLPNKKVCINSEHSVDILLETLEKTGK 60
Query: 292 AVSY 303
AVSY
Sbjct: 61 AVSY 64
Database: RefSeq49_CP.fasta
Posted date: Oct 17, 2011 1:42 PM
Number of letters in database: 18,874,504
Number of sequences in database: 33,336
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 33336
Number of Hits to DB: 19,290,436
Number of extensions: 546892
Number of successful extensions: 3160
Number of sequences better than 1.0e-05: 1
Number of HSP's gapped: 3138
Number of HSP's successfully gapped: 1
Length of query: 172
Length of database: 18,874,504
Length adjustment: 95
Effective length of query: 77
Effective length of database: 15,707,584
Effective search space: 1209483968
Effective search space used: 1209483968
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 32 (16.9 bits)
Search to RefSeqSP_Rel49
BLASTX 2.2.24 [Aug-08-2010]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= 20110601C-013117
(517 letters)
Database: RefSeq49_SP.fasta
24,897 sequences; 11,343,932 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
Alignment gi|NP_001161113.1| copper transport protein ATOX1 [Sus scrofa]. 134 3e-32
>ref|NP_001161113.1| copper transport protein ATOX1 [Sus scrofa].
Length = 68
Score = 134 bits (337), Expect = 3e-32
Identities = 64/64 (100%), Positives = 64/64 (100%)
Frame = +1
Query: 112 MPKHEFSVDMTCEGCSNAVTRVLNKLGGVQFDIDLPNKKVCIDSEHSVDTLLETLGKTGK 291
MPKHEFSVDMTCEGCSNAVTRVLNKLGGVQFDIDLPNKKVCIDSEHSVDTLLETLGKTGK
Sbjct: 1 MPKHEFSVDMTCEGCSNAVTRVLNKLGGVQFDIDLPNKKVCIDSEHSVDTLLETLGKTGK 60
Query: 292 AVSY 303
AVSY
Sbjct: 61 AVSY 64
Database: RefSeq49_SP.fasta
Posted date: Oct 17, 2011 1:42 PM
Number of letters in database: 11,343,932
Number of sequences in database: 24,897
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 24897
Number of Hits to DB: 12,195,178
Number of extensions: 376702
Number of successful extensions: 1971
Number of sequences better than 1.0e-05: 1
Number of HSP's gapped: 1955
Number of HSP's successfully gapped: 1
Length of query: 172
Length of database: 11,343,932
Length adjustment: 92
Effective length of query: 80
Effective length of database: 9,053,408
Effective search space: 724272640
Effective search space used: 724272640
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 31 (16.5 bits)
Search to RefSeqMP_Rel49
BLASTX 2.2.24 [Aug-08-2010]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= 20110601C-013117
(517 letters)
Database: RefSeq49_MP.fasta
30,036 sequences; 15,617,559 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
Alignment gi|NP_033850.1| copper transport protein ATOX1 [Mus musculus]. 119 1e-27
>ref|NP_033850.1| copper transport protein ATOX1 [Mus musculus].
Length = 68
Score = 119 bits (298), Expect = 1e-27
Identities = 56/64 (87%), Positives = 60/64 (93%)
Frame = +1
Query: 112 MPKHEFSVDMTCEGCSNAVTRVLNKLGGVQFDIDLPNKKVCIDSEHSVDTLLETLGKTGK 291
MPKHEFSVDMTCEGC+ AV+RVLNKLGGV+F+IDLPNKKVCIDSEHS DTLL TL KTGK
Sbjct: 1 MPKHEFSVDMTCEGCAEAVSRVLNKLGGVEFNIDLPNKKVCIDSEHSSDTLLATLNKTGK 60
Query: 292 AVSY 303
AVSY
Sbjct: 61 AVSY 64
Database: RefSeq49_MP.fasta
Posted date: Oct 17, 2011 1:42 PM
Number of letters in database: 15,617,559
Number of sequences in database: 30,036
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 30036
Number of Hits to DB: 15,856,128
Number of extensions: 437650
Number of successful extensions: 2618
Number of sequences better than 1.0e-05: 1
Number of HSP's gapped: 2572
Number of HSP's successfully gapped: 1
Length of query: 172
Length of database: 15,617,559
Length adjustment: 94
Effective length of query: 78
Effective length of database: 12,794,175
Effective search space: 997945650
Effective search space used: 997945650
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 32 (16.9 bits)
Search to RefSeqHP_Rel49
BLASTX 2.2.24 [Aug-08-2010]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= 20110601C-013117
(517 letters)
Database: RefSeq49_HP.fasta
32,964 sequences; 18,297,164 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
Alignment gi|NP_004036.1| copper transport protein ATOX1 [Homo sapiens]. 114 5e-26
>ref|NP_004036.1| copper transport protein ATOX1 [Homo sapiens].
Length = 68
Score = 114 bits (285), Expect = 5e-26
Identities = 53/64 (82%), Positives = 59/64 (92%)
Frame = +1
Query: 112 MPKHEFSVDMTCEGCSNAVTRVLNKLGGVQFDIDLPNKKVCIDSEHSVDTLLETLGKTGK 291
MPKHEFSVDMTC GC+ AV+RVLNKLGGV++DIDLPNKKVCI+SEHS+DTLL TL KTGK
Sbjct: 1 MPKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDTLLATLKKTGK 60
Query: 292 AVSY 303
VSY
Sbjct: 61 TVSY 64
Database: RefSeq49_HP.fasta
Posted date: Oct 17, 2011 1:42 PM
Number of letters in database: 18,297,164
Number of sequences in database: 32,964
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 32964
Number of Hits to DB: 18,875,078
Number of extensions: 531500
Number of successful extensions: 2952
Number of sequences better than 1.0e-05: 1
Number of HSP's gapped: 2928
Number of HSP's successfully gapped: 1
Length of query: 172
Length of database: 18,297,164
Length adjustment: 95
Effective length of query: 77
Effective length of database: 15,165,584
Effective search space: 1167749968
Effective search space used: 1167749968
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 32 (16.9 bits)
Search to Sscrofa10_2
BLASTN 2.2.24 [Aug-08-2010]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= 20110601C-013117
(517 letters)
Database: Sscrofa_10.2.fasta
4582 sequences; 2,808,509,378 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
gb|GL894053.2| Sus scrofa unplaced genomic scaffold ChrUScaf1937 343 6e-92
Sscrofa_Chr16 335 1e-89
Sscrofa_Chr08 170 5e-40
Sscrofa_Chr02 159 2e-36
>gb|GL894053.2| Sus scrofa unplaced genomic scaffold ChrUScaf1937
Length = 64625
Score = 343 bits (173), Expect = 6e-92
Identities = 173/173 (100%)
Strand = Plus / Plus
Query: 192 aggagttcagtttgacattgacctgcccaacaagaaggtctgcattgactctgagcacag 251
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1618 aggagttcagtttgacattgacctgcccaacaagaaggtctgcattgactctgagcacag 1677
Query: 252 cgtggacactctgctggagaccctggggaagacaggaaaggccgtttcctacctcggccc 311
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1678 cgtggacactctgctggagaccctggggaagacaggaaaggccgtttcctacctcggccc 1737
Query: 312 caagtagtgagggctcgggcccctggcctgcaggatggaccaaagtgggcagg 364
|||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1738 caagtagtgagggctcgggcccctggcctgcaggatggaccaaagtgggcagg 1790
Score = 264 bits (133), Expect = 4e-68
Identities = 133/133 (100%)
Strand = Plus / Plus
Query: 360 gcaggatgctgatctgccttccagacagatgtaaggcctggcagtcctgctcaacgacgg 419
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 5984 gcaggatgctgatctgccttccagacagatgtaaggcctggcagtcctgctcaacgacgg 6043
Query: 420 gaattcctgtggagaccctcacttcccctgctcctctgtagcttccctctaataaagtca 479
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 6044 gaattcctgtggagaccctcacttcccctgctcctctgtagcttccctctaataaagtca 6103
Query: 480 agctgcttttgct 492
|||||||||||||
Sbjct: 6104 agctgcttttgct 6116
Score = 155 bits (78), Expect = 3e-35
Identities = 78/78 (100%)
Strand = Plus / Plus
Query: 117 gaagcacgagttctccgtggacatgacctgtgagggctgctctaacgcagtcactcgggt 176
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 294 gaagcacgagttctccgtggacatgacctgtgagggctgctctaacgcagtcactcgggt 353
Query: 177 cctcaacaagctgggagg 194
||||||||||||||||||
Sbjct: 354 cctcaacaagctgggagg 371
>Sscrofa_Chr16
|| Length = 86898991
Score = 335 bits (169), Expect = 1e-89
Identities = 172/173 (99%)
Strand = Plus / Plus
Query: 192 aggagttcagtttgacattgacctgcccaacaagaaggtctgcattgactctgagcacag 251
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 77537838 aggagttcagtttgacattgacctgcccaacaagaaggtctgcattgactctgagcacag 77537897
Query: 252 cgtggacactctgctggagaccctggggaagacaggaaaggccgtttcctacctcggccc 311
|||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||
Sbjct: 77537898 cgtggacactctgctggagaccctggggaagacaggaaaggccgtttcctaccttggccc 77537957
Query: 312 caagtagtgagggctcgggcccctggcctgcaggatggaccaaagtgggcagg 364
|||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 77537958 caagtagtgagggctcgggcccctggcctgcaggatggaccaaagtgggcagg 77538010
Score = 264 bits (133), Expect = 4e-68
Identities = 133/133 (100%)
Strand = Plus / Plus
Query: 360 gcaggatgctgatctgccttccagacagatgtaaggcctggcagtcctgctcaacgacgg 419
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 77542536 gcaggatgctgatctgccttccagacagatgtaaggcctggcagtcctgctcaacgacgg 77542595
Query: 420 gaattcctgtggagaccctcacttcccctgctcctctgtagcttccctctaataaagtca 479
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 77542596 gaattcctgtggagaccctcacttcccctgctcctctgtagcttccctctaataaagtca 77542655
Query: 480 agctgcttttgct 492
|||||||||||||
Sbjct: 77542656 agctgcttttgct 77542668
Score = 220 bits (111), Expect = 6e-55
Identities = 114/115 (99%)
Strand = Plus / Minus
Query: 3 ggggccgggaccaaagagcggctgctgcggggcgcgcgcacccggaagcgcaaccgcgcc 62
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 77451946 ggggccgggaccaaagagcggctgctgcggggcgcgcgcacccggaagcgcaaccgcgcc 77451887
Query: 63 agcgctgagagccgcgggaggcgtcgccacggccaccacgtcctcagtcatgccg 117
|||||| ||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 77451886 agcgctcagagccgcgggaggcgtcgccacggccaccacgtcctcagtcatgccg 77451832
Score = 155 bits (78), Expect = 3e-35
Identities = 78/78 (100%)
Strand = Plus / Minus
Query: 117 gaagcacgagttctccgtggacatgacctgtgagggctgctctaacgcagtcactcgggt 176
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 77444383 gaagcacgagttctccgtggacatgacctgtgagggctgctctaacgcagtcactcgggt 77444324
Query: 177 cctcaacaagctgggagg 194
||||||||||||||||||
Sbjct: 77444323 cctcaacaagctgggagg 77444306
>Sscrofa_Chr08
|| Length = 148491826
Score = 170 bits (86), Expect = 5e-40
Identities = 313/385 (81%), Gaps = 9/385 (2%)
Strand = Plus / Minus
Query: 88 gccacggccaccacgtcctcagtcatgccgaagcacgagttctccgtggacatgacctgt 147
||||| |||||||| ||||||| |||||| | |||| |||||||| | ||||| || |
Sbjct: 78461427 gccacagccaccacctcctcagccatgccaaggcac-agttctccacgaacatgtccagg 78461369
Query: 148 gagggctgctctaacgcagtcactcgggtcctcaacaagctgggaggagttcagtttgac 207
||||||||||||| | ||| |||| |||| ||||||| || |||||| ||||||||||
Sbjct: 78461368 gagggctgctctattgtagtaactcaggtcttcaacaaacttagaggaggtcagtttgac 78461309
Query: 208 attgacctgcccaacaagaaggtctgcattgactctgagcacagcgtggacactctgctg 267
||||| |||||||| | |||||||||||||||||| ||||||| ||||||| ||| |||
Sbjct: 78461308 attgatctgcccaagaggaaggtctgcattgactc--agcacagtgtggacattcttctg 78461251
Query: 268 gagaccctggggaagacaggaaaggccgtttcctacctcggccccaagtagtgagggctc 327
|||||||||||||| ||||||||||| || || || || | || ||| || ||||
Sbjct: 78461250 gagaccctggggaaaacaggaaaggctgtgtcttatcttag-ccaaagcagcaagggtct 78461192
Query: 328 gggcccctggcctgcaggatggaccaaagtgggcagg-----atgctgatctgccttcca 382
|||| ||||||||| |||||| |||||||||||||| || || | || |||||
Sbjct: 78461191 gggctcctggcctgtaggatgagccaaagtgggcaggacaccatcctttccagctttcca 78461132
Query: 383 gacagatgtaaggcctggcagtcctgctcaacgacgggaattcctgtggagaccctcact 442
| ||||| | | ||||||||||||||||| || | || |||||| |||||||||||||
Sbjct: 78461131 ggcagatccaggaactggcagtcctgctcaaggatgtgagttcctgcggagaccctcact 78461072
Query: 443 tcccctgctcctctgtagcttccct 467
| |||||||||||||||||||||||
Sbjct: 78461071 taccctgctcctctgtagcttccct 78461047
>Sscrofa_Chr02
|| Length = 162569375
Score = 159 bits (80), Expect = 2e-36
Identities = 329/412 (79%), Gaps = 25/412 (6%)
Strand = Plus / Plus
Query: 103 tcctcagtcatgccgaagca----cgagttctccgtggacatgacctgtgagggctgctc 158
|||||||||||||||||||| ||||||||| ||||||| | |||||| ||||||||
Sbjct: 30534393 tcctcagtcatgccgaagcatgactgagttctccatggacataaactgtgaaggctgctc 30534452
Query: 159 taacgcagtcactcgggtcctcaacaagctgggaggagttcagtttgacattgacctgcc 218
||||||||||||| || ||||||| ||| ||||||||||||||||||||||||||| ||
Sbjct: 30534453 taacgcagtcacttggctcctcaatgagccgggaggagttcagtttgacattgacctacc 30534512
Query: 219 ------------caacaagaaggtctgcattgactctgagcacagcgtggacactctgct 266
||| |||| |||||||| |||||||||| || ||| ||||||||||
Sbjct: 30534513 acagagttgatgcaatgagaaagtctgcatcaactctgagcatagtgtgcacactctgct 30534572
Query: 267 ggagaccctggggaagacaggaaaggccgtttcctacctcggccccaagtagtgagggct 326
|||||| ||||| || ||||||||||| |||||||||||| |||||||| ||| |||||
Sbjct: 30534573 ggagacactgggaaaaacaggaaaggctgtttcctacctcagccccaagcagt--gggct 30534630
Query: 327 cgggcccctggcctgcaggatggaccaaagtgggcaggatgctgat------ctgccttc 380
||||| | ||| |||||| | ||||| ||||||| ||||| ||||||||
Sbjct: 30534631 -gggcctcaggctggcaggagaaatgaaagtaggcaggactctgatccactgctgccttc 30534689
Query: 381 cagacagatgtaaggcctggcagtcctgctcaacgacgggaattcctgtggagaccctca 440
|||| |||| | | || |||| ||||||||| || |||| || || |||| |||||
Sbjct: 30534690 cagagagatctcggacccggcaatcctgctcagtgaagggagtttgtggagagatcctca 30534749
Query: 441 cttcccctgctcctctgtagcttccctctaataaagtcaagctgcttttgct 492
||| |||||||||||||||||||| || ||||||| |||||||||||||||
Sbjct: 30534750 cttgccctgctcctctgtagcttctctgcaataaaggcaagctgcttttgct 30534801
Database: Sscrofa_10.2.fasta
Posted date: Nov 16, 2011 10:34 AM
Number of letters in database: 2,808,509,378
Number of sequences in database: 4582
Lambda K H
1.37 0.711 1.31
Gapped
Lambda K H
1.37 0.711 1.31
Matrix: blastn matrix:1 -3
Gap Penalties: Existence: 5, Extension: 2
Number of Sequences: 4582
Number of Hits to DB: 11,615,310
Number of extensions: 351
Number of successful extensions: 351
Number of sequences better than 1.0e-05: 4
Number of HSP's gapped: 350
Number of HSP's successfully gapped: 12
Length of query: 517
Length of database: 2,808,509,378
Length adjustment: 21
Effective length of query: 496
Effective length of database: 2,808,413,156
Effective search space: 1392972925376
Effective search space used: 1392972925376
X1: 11 (21.8 bits)
X2: 15 (29.7 bits)
X3: 50 (99.1 bits)
S1: 17 (34.2 bits)
S2: 29 (58.0 bits)