Animal-Genome cDNA 20110601C-013158


Search to RefSeqBP_Rel49

BLASTX 2.2.24 [Aug-08-2010]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20110601C-013158
         (1176 letters)

Database: RefSeq49_BP.fasta 
           33,088 sequences; 17,681,374 total letters

Searching..................................................done

 ***** No hits found ******


  Database: RefSeq49_BP.fasta
    Posted date:  Oct 17, 2011  1:42 PM
  Number of letters in database: 17,681,374
  Number of sequences in database:  33,088
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 33088
Number of Hits to DB: 48,521,836
Number of extensions: 1587988
Number of successful extensions: 5967
Number of sequences better than 1.0e-05: 0
Number of HSP's gapped: 5955
Number of HSP's successfully gapped: 0
Length of query: 392
Length of database: 17,681,374
Length adjustment: 104
Effective length of query: 288
Effective length of database: 14,240,222
Effective search space: 4101183936
Effective search space used: 4101183936
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 35 (18.1 bits)

Search to RefSeqCP_Rel49

BLASTX 2.2.24 [Aug-08-2010]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20110601C-013158
         (1176 letters)

Database: RefSeq49_CP.fasta 
           33,336 sequences; 18,874,504 total letters

Searching..................................................done

 ***** No hits found ******


  Database: RefSeq49_CP.fasta
    Posted date:  Oct 17, 2011  1:42 PM
  Number of letters in database: 18,874,504
  Number of sequences in database:  33,336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 33336
Number of Hits to DB: 49,921,652
Number of extensions: 1527669
Number of successful extensions: 5792
Number of sequences better than 1.0e-05: 0
Number of HSP's gapped: 5776
Number of HSP's successfully gapped: 0
Length of query: 392
Length of database: 18,874,504
Length adjustment: 105
Effective length of query: 287
Effective length of database: 15,374,224
Effective search space: 4412402288
Effective search space used: 4412402288
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 35 (18.1 bits)

Search to RefSeqSP_Rel49

BLASTX 2.2.24 [Aug-08-2010]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20110601C-013158
         (1176 letters)

Database: RefSeq49_SP.fasta 
           24,897 sequences; 11,343,932 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|XP_003122045.1| PREDICTED: hypothetical protein LOC100515120...   125   5e-29

>ref|XP_003122045.1| PREDICTED: hypothetical protein LOC100515120 [Sus scrofa].
          Length = 75

 Score =  125 bits (314), Expect = 5e-29
 Identities = 55/55 (100%), Positives = 55/55 (100%)
 Frame = +3

Query: 561 CVLCCFSCDSRARDPQRGPGHSFTVATFRQEASLFTGPGCHIQPVAGARDFWTFM 725
           CVLCCFSCDSRARDPQRGPGHSFTVATFRQEASLFTGPGCHIQPVAGARDFWTFM
Sbjct: 21  CVLCCFSCDSRARDPQRGPGHSFTVATFRQEASLFTGPGCHIQPVAGARDFWTFM 75


  Database: RefSeq49_SP.fasta
    Posted date:  Oct 17, 2011  1:42 PM
  Number of letters in database: 11,343,932
  Number of sequences in database:  24,897
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 24897
Number of Hits to DB: 32,306,894
Number of extensions: 1179814
Number of successful extensions: 3897
Number of sequences better than 1.0e-05: 1
Number of HSP's gapped: 3897
Number of HSP's successfully gapped: 1
Length of query: 392
Length of database: 11,343,932
Length adjustment: 101
Effective length of query: 291
Effective length of database: 8,829,335
Effective search space: 2569336485
Effective search space used: 2569336485
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 34 (17.7 bits)

Search to RefSeqMP_Rel49

BLASTX 2.2.24 [Aug-08-2010]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20110601C-013158
         (1176 letters)

Database: RefSeq49_MP.fasta 
           30,036 sequences; 15,617,559 total letters

Searching..................................................done

 ***** No hits found ******


  Database: RefSeq49_MP.fasta
    Posted date:  Oct 17, 2011  1:42 PM
  Number of letters in database: 15,617,559
  Number of sequences in database:  30,036
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 30036
Number of Hits to DB: 40,948,428
Number of extensions: 1203123
Number of successful extensions: 4430
Number of sequences better than 1.0e-05: 0
Number of HSP's gapped: 4427
Number of HSP's successfully gapped: 0
Length of query: 392
Length of database: 15,617,559
Length adjustment: 103
Effective length of query: 289
Effective length of database: 12,523,851
Effective search space: 3619392939
Effective search space used: 3619392939
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 35 (18.1 bits)

Search to RefSeqHP_Rel49

BLASTX 2.2.24 [Aug-08-2010]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20110601C-013158
         (1176 letters)

Database: RefSeq49_HP.fasta 
           32,964 sequences; 18,297,164 total letters

Searching..................................................done

 ***** No hits found ******


  Database: RefSeq49_HP.fasta
    Posted date:  Oct 17, 2011  1:42 PM
  Number of letters in database: 18,297,164
  Number of sequences in database:  32,964
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 32964
Number of Hits to DB: 48,848,489
Number of extensions: 1474801
Number of successful extensions: 5610
Number of sequences better than 1.0e-05: 0
Number of HSP's gapped: 5598
Number of HSP's successfully gapped: 0
Length of query: 392
Length of database: 18,297,164
Length adjustment: 105
Effective length of query: 287
Effective length of database: 14,835,944
Effective search space: 4257915928
Effective search space used: 4257915928
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 35 (18.1 bits)

Search to Sscrofa10_2

BLASTN 2.2.24 [Aug-08-2010]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20110601C-013158
         (1176 letters)

Database: Sscrofa_10.2.fasta 
           4582 sequences; 2,808,509,378 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Sscrofa_Chr01                                                        1754   0.0  

>Sscrofa_Chr01 
||          Length = 315321322

 Score = 1754 bits (885), Expect = 0.0
 Identities = 903/909 (99%)
 Strand = Plus / Plus

                                                                             
Query: 161       gcccctccgagtccagggagtcttgagctcacactttaaaggacatcgcttcttccagag 220
                 ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 264392234 gcccctccgagtccagggagtcttgagctcacactttaaaggacatcgcttcttccagag 264392293

                                                                             
Query: 221       ctgccagtggagttgcccatggctctcagaagcctggcctgaggctcaggaaacagtgac 280
                 ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 264392294 ctgccagtggagttgcccatggctctcagaagcctggcctgaggctcaggaaacagtgac 264392353

                                                                             
Query: 281       agagacccagtgagattggagtagggccatgcggggcacccaacagcccagacaaggcag 340
                 |||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||
Sbjct: 264392354 agagacccagtgagattggagtagggccatgcggggcacccaacagcctagacaaggcag 264392413

                                                                             
Query: 341       cagtcagggcctcagaccagcaccttcttagaagatcacagggagagtggcctgaggagc 400
                 ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 264392414 cagtcagggcctcagaccagcaccttcttagaagatcacagggagagtggcctgaggagc 264392473

                                                                             
Query: 401       gagggtacctgccatcaccgagagccccggcttcagacagggagctgaggctccaagact 460
                 ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 264392474 gagggtacctgccatcaccgagagccccggcttcagacagggagctgaggctccaagact 264392533

                                                                             
Query: 461       cgtcccaggttgctcagtgggtcagcggccacgcagggccatggaaacggctgtgattgg 520
                 ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 264392534 cgtcccaggttgctcagtgggtcagcggccacgcagggccatggaaacggctgtgattgg 264392593

                                                                             
Query: 521       agtggtggccgtgctgtttgtggtcaccgtggccatcacctgcgtcctctgttgcttcag 580
                 ||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||||
Sbjct: 264392594 agtggtggccgtgctgtttgtggtcactgtggccatcacctgcgtcctctgttgcttcag 264392653

                                                                             
Query: 581       ctgtgactcgagggcccgggatcctcagaggggcccaggccacagcttcacggtggccac 640
                 ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 264392654 ctgtgactcgagggcccgggatcctcagaggggcccaggccacagcttcacggtggccac 264392713

                                                                             
Query: 641       gtttcgccaggaggcttctctcttcacggggccaggttgccatatccaaccagtggcggg 700
                 ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 264392714 gtttcgccaggaggcttctctcttcacggggccaggttgccatatccaaccagtggcggg 264392773

                                                                             
Query: 701       tgcccgggacttctggaccttcatgtgagacctgccagctctcggcctttgctctgctgg 760
                 ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 264392774 tgcccgggacttctggaccttcatgtgagacctgccagctctcggcctttgctctgctgg 264392833

                                                                             
Query: 761       tggtcagacttgtttatgccccagcaagccttctctggtgacccactcctccaacgctgg 820
                 ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 264392834 tggtcagacttgtttatgccccagcaagccttctctggtgacccactcctccaacgctgg 264392893

                                                                             
Query: 821       ctttcccgtccttccctgcctgtgtccagtaaaccctgtcccatgtcctgcagcctggga 880
                 ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 264392894 ctttcccgtccttccctgcctgtgtccagtaaaccctgtcccatgtcctgcagcctggga 264392953

                                                                             
Query: 881       gatccatggtgataggaccaggtaggagtcagctctgacctccaggagctcagctggatc 940
                 ||||||||||||||||||||||| |||||||||||||||||||| |||||||||||||||
Sbjct: 264392954 gatccatggtgataggaccaggtgggagtcagctctgacctccaagagctcagctggatc 264393013

                                                                             
Query: 941       ctaaccacaggatggggcttaggagaggtccagagggtgagtgactgagtgttggatggc 1000
                 ||||||||||||||||||||||||||||||||||||||| ||||||| ||||||||||||
Sbjct: 264393014 ctaaccacaggatggggcttaggagaggtccagagggtgcgtgactgtgtgttggatggc 264393073

                                                                             
Query: 1001      atggtggaccaggtcttctgatctacacagtgaactgaaatctcaccggactttattgtg 1060
                 ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 264393074 atggtggaccaggtcttctgatctacacagtgaactgaaatctcaccggactttattgtg 264393133

                          
Query: 1061      aagagtgtt 1069
                 |||||||||
Sbjct: 264393134 aagagtgtt 264393142



 Score =  319 bits (161), Expect = 2e-84
 Identities = 161/161 (100%)
 Strand = Plus / Plus

                                                                             
Query: 1         gttcaggaagtgttctcagccacactcagacctcacagagcctcgtcccaggcaggaccg 60
                 ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 264391580 gttcaggaagtgttctcagccacactcagacctcacagagcctcgtcccaggcaggaccg 264391639

                                                                             
Query: 61        aggctgcagcacccagggatgagcgtgatgtggcctggccccgggggtggctgccaggtc 120
                 ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 264391640 aggctgcagcacccagggatgagcgtgatgtggcctggccccgggggtggctgccaggtc 264391699

                                                          
Query: 121       aggaggccatggcactgtgttcagccaacagggagcccagg 161
                 |||||||||||||||||||||||||||||||||||||||||
Sbjct: 264391700 aggaggccatggcactgtgttcagccaacagggagcccagg 264391740


  Database: Sscrofa_10.2.fasta
    Posted date:  Nov 16, 2011 10:34 AM
  Number of letters in database: 2,808,509,378
  Number of sequences in database:  4582
  
Lambda     K      H
    1.37    0.711     1.31 

Gapped
Lambda     K      H
    1.37    0.711     1.31 


Matrix: blastn matrix:1 -3
Gap Penalties: Existence: 5, Extension: 2
Number of Sequences: 4582
Number of Hits to DB: 31,057,322
Number of extensions: 274
Number of successful extensions: 274
Number of sequences better than 1.0e-05: 1
Number of HSP's gapped: 274
Number of HSP's successfully gapped: 2
Length of query: 1176
Length of database: 2,808,509,378
Length adjustment: 21
Effective length of query: 1155
Effective length of database: 2,808,413,156
Effective search space: 3243717195180
Effective search space used: 3243717195180
X1: 11 (21.8 bits)
X2: 15 (29.7 bits)
X3: 50 (99.1 bits)
S1: 18 (36.2 bits)
S2: 30 (60.0 bits)