Search to RefSeqCP_Rel49

BLASTX 2.2.24 [Aug-08-2010]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20110601C-013189
         (905 letters)

Database: RefSeq49_CP.fasta 
           33,336 sequences; 18,874,504 total letters

Searching..................................................done

 ***** No hits found ******


  Database: RefSeq49_CP.fasta
    Posted date:  Oct 17, 2011  1:42 PM
  Number of letters in database: 18,874,504
  Number of sequences in database:  33,336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 33336
Number of Hits to DB: 36,329,015
Number of extensions: 1024831
Number of successful extensions: 5048
Number of sequences better than 1.0e-05: 0
Number of HSP's gapped: 5024
Number of HSP's successfully gapped: 0
Length of query: 301
Length of database: 18,874,504
Length adjustment: 102
Effective length of query: 199
Effective length of database: 15,474,232
Effective search space: 3079372168
Effective search space used: 3079372168
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 34 (17.7 bits)
Animal-Genome cDNA 20110601C-013189

Animal-Genome cDNA 20110601C-013189


Search to RefSeqBP_Rel49

BLASTX 2.2.24 [Aug-08-2010]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20110601C-013189
         (905 letters)

Database: RefSeq49_BP.fasta 
           33,088 sequences; 17,681,374 total letters

Searching..................................................done

 ***** No hits found ******


  Database: RefSeq49_BP.fasta
    Posted date:  Oct 17, 2011  1:42 PM
  Number of letters in database: 17,681,374
  Number of sequences in database:  33,088
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 33088
Number of Hits to DB: 34,870,056
Number of extensions: 996826
Number of successful extensions: 5016
Number of sequences better than 1.0e-05: 0
Number of HSP's gapped: 4998
Number of HSP's successfully gapped: 0
Length of query: 301
Length of database: 17,681,374
Length adjustment: 102
Effective length of query: 199
Effective length of database: 14,306,398
Effective search space: 2846973202
Effective search space used: 2846973202
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 34 (17.7 bits)

Search to RefSeqSP_Rel49

BLASTX 2.2.24 [Aug-08-2010]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20110601C-013189
         (905 letters)

Database: RefSeq49_SP.fasta 
           24,897 sequences; 11,343,932 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|XP_003361127.1| PREDICTED: hypothetical protein LOC100626595...   199   2e-51

>ref|XP_003361127.1| PREDICTED: hypothetical protein LOC100626595 [Sus scrofa].
          Length = 217

 Score =  199 bits (505), Expect = 2e-51
 Identities = 95/95 (100%), Positives = 95/95 (100%)
 Frame = +1

Query: 331 PWRVLGSGHLGAQAAGAERQRLSPHWPPPGQCGASQAVHSRSAGPPEEGSLSPASQKHEV 510
           PWRVLGSGHLGAQAAGAERQRLSPHWPPPGQCGASQAVHSRSAGPPEEGSLSPASQKHEV
Sbjct: 110 PWRVLGSGHLGAQAAGAERQRLSPHWPPPGQCGASQAVHSRSAGPPEEGSLSPASQKHEV 169

Query: 511 ILLFRQLSATSEQGESDCQVLIYLVYSPLSIHACL 615
           ILLFRQLSATSEQGESDCQVLIYLVYSPLSIHACL
Sbjct: 170 ILLFRQLSATSEQGESDCQVLIYLVYSPLSIHACL 204


  Database: RefSeq49_SP.fasta
    Posted date:  Oct 17, 2011  1:42 PM
  Number of letters in database: 11,343,932
  Number of sequences in database:  24,897
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 24897
Number of Hits to DB: 22,525,878
Number of extensions: 643804
Number of successful extensions: 3285
Number of sequences better than 1.0e-05: 1
Number of HSP's gapped: 3274
Number of HSP's successfully gapped: 1
Length of query: 301
Length of database: 11,343,932
Length adjustment: 98
Effective length of query: 203
Effective length of database: 8,904,026
Effective search space: 1807517278
Effective search space used: 1807517278
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 33 (17.3 bits)

Search to RefSeqMP_Rel49

BLASTX 2.2.24 [Aug-08-2010]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20110601C-013189
         (905 letters)

Database: RefSeq49_MP.fasta 
           30,036 sequences; 15,617,559 total letters

Searching..................................................done

 ***** No hits found ******


  Database: RefSeq49_MP.fasta
    Posted date:  Oct 17, 2011  1:42 PM
  Number of letters in database: 15,617,559
  Number of sequences in database:  30,036
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 30036
Number of Hits to DB: 29,923,216
Number of extensions: 823649
Number of successful extensions: 4048
Number of sequences better than 1.0e-05: 0
Number of HSP's gapped: 4029
Number of HSP's successfully gapped: 0
Length of query: 301
Length of database: 15,617,559
Length adjustment: 101
Effective length of query: 200
Effective length of database: 12,583,923
Effective search space: 2516784600
Effective search space used: 2516784600
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 34 (17.7 bits)

Search to RefSeqHP_Rel49

BLASTX 2.2.24 [Aug-08-2010]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20110601C-013189
         (905 letters)

Database: RefSeq49_HP.fasta 
           32,964 sequences; 18,297,164 total letters

Searching..................................................done

 ***** No hits found ******


  Database: RefSeq49_HP.fasta
    Posted date:  Oct 17, 2011  1:42 PM
  Number of letters in database: 18,297,164
  Number of sequences in database:  32,964
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 32964
Number of Hits to DB: 35,487,516
Number of extensions: 991073
Number of successful extensions: 4248
Number of sequences better than 1.0e-05: 0
Number of HSP's gapped: 4214
Number of HSP's successfully gapped: 0
Length of query: 301
Length of database: 18,297,164
Length adjustment: 102
Effective length of query: 199
Effective length of database: 14,934,836
Effective search space: 2972032364
Effective search space used: 2972032364
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 34 (17.7 bits)

Search to Sscrofa10_2

BLASTN 2.2.24 [Aug-08-2010]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20110601C-013189
         (905 letters)

Database: Sscrofa_10.2.fasta 
           4582 sequences; 2,808,509,378 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Sscrofa_Chr04                                                         985   0.0  
gb|GL893574.2| Sus scrofa unplaced genomic scaffold ChrUScaf1459      761   0.0  

>Sscrofa_Chr04 
||          Length = 143465943

 Score =  985 bits (497), Expect = 0.0
 Identities = 497/497 (100%)
 Strand = Plus / Plus

                                                                            
Query: 1        accgctgcaccgcctcggcgcttgtcattctccgcggcgccgaggcgagtgccgactgcg 60
                ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 60465108 accgctgcaccgcctcggcgcttgtcattctccgcggcgccgaggcgagtgccgactgcg 60465167

                                                                            
Query: 61       gtgcctgtccgccagcttgttcgctcgctcgcccgccggcgcgcgggctgtgtgacggat 120
                ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 60465168 gtgcctgtccgccagcttgttcgctcgctcgcccgccggcgcgcgggctgtgtgacggat 60465227

                                                                            
Query: 121      cgctggggaacgggctggcagctctaccccctgcaacagctcttcggttttttccttgac 180
                ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 60465228 cgctggggaacgggctggcagctctaccccctgcaacagctcttcggttttttccttgac 60465287

                                                                            
Query: 181      cgccttccttgttgagtcgcgattccctgggagcaggagacacgcaccaggggctcggag 240
                ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 60465288 cgccttccttgttgagtcgcgattccctgggagcaggagacacgcaccaggggctcggag 60465347

                                                                            
Query: 241      cgccgcactccagggctggggcagctgcagcgctcgggactgcgcggccgggtgcagcct 300
                ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 60465348 cgccgcactccagggctggggcagctgcagcgctcgggactgcgcggccgggtgcagcct 60465407

                                                                            
Query: 301      ctgtcgctgtcgccgccgccgcgcggtgcgccttggcgagtgttgggctccgggcatctc 360
                ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 60465408 ctgtcgctgtcgccgccgccgcgcggtgcgccttggcgagtgttgggctccgggcatctc 60465467

                                                                            
Query: 361      ggagcccaggcagctggtgcagagcgccagcgcctctccccgcactggccgccgccgggg 420
                ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 60465468 ggagcccaggcagctggtgcagagcgccagcgcctctccccgcactggccgccgccgggg 60465527

                                                                            
Query: 421      cagtgcggagccagccaggctgtgcacagccggagcgcgggtccccccgaagaaggctcc 480
                ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 60465528 cagtgcggagccagccaggctgtgcacagccggagcgcgggtccccccgaagaaggctcc 60465587

                                 
Query: 481      ctatcgcctgcgtccca 497
                |||||||||||||||||
Sbjct: 60465588 ctatcgcctgcgtccca 60465604



 Score =  793 bits (400), Expect = 0.0
 Identities = 406/408 (99%)
 Strand = Plus / Plus

                                                                            
Query: 498      aaaacacgaagtcattctcttatttcgacagctgagtgcaacttcggaacagggagagag 557
                ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 60520480 aaaacacgaagtcattctcttatttcgacagctgagtgcaacttcggaacagggagagag 60520539

                                                                            
Query: 558      tgattgccaggtactcatttatctggtttattcgccattgtctatccatgcttgccttta 617
                ||| |||||||||||||||||||||||||||||||||||||||||||| |||||||||||
Sbjct: 60520540 tgactgccaggtactcatttatctggtttattcgccattgtctatccacgcttgccttta 60520599

                                                                            
Query: 618      gttgagcctcgtacggttcatcagggtatatctggggactctgagttgtaggactgcaga 677
                ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 60520600 gttgagcctcgtacggttcatcagggtatatctggggactctgagttgtaggactgcaga 60520659

                                                                            
Query: 678      cccacagtttggaagctgaataatctcaagagtattagctaatccagtttggaatttagc 737
                ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 60520660 cccacagtttggaagctgaataatctcaagagtattagctaatccagtttggaatttagc 60520719

                                                                            
Query: 738      accatggggtttctgccatggcaaccaagacaccacccaccagtcatgattcctacaaca 797
                ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 60520720 accatggggtttctgccatggcaaccaagacaccacccaccagtcatgattcctacaaca 60520779

                                                                            
Query: 798      tgctgcttccctttggtcagtgatagacgcaagcctgagtctacccggtaatgtctatgt 857
                ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 60520780 tgctgcttccctttggtcagtgatagacgcaagcctgagtctacccggtaatgtctatgt 60520839

                                                                
Query: 858      gaaattaggccaaatgcttaccctctcctcagctctttcttcattttt 905
                ||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 60520840 gaaattaggccaaatgcttaccctctcctcagctctttcttcattttt 60520887


>gb|GL893574.2| Sus scrofa unplaced genomic scaffold ChrUScaf1459
          Length = 178836

 Score =  761 bits (384), Expect = 0.0
 Identities = 402/408 (98%), Gaps = 4/408 (0%)
 Strand = Plus / Plus

                                                                          
Query: 498    aaaacacgaagtcattctcttatttcgacagctgagtgcaacttcggaacagggagagag 557
              ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 116290 aaaacacgaagtcattctcttatttcgacagctgagtgcaacttcggaacagggagagag 116349

                                                                          
Query: 558    tgattgccaggtactcatttatctggtttattcgccattgtctatccatgcttgccttta 617
              ||| |||||||||||||||||||||||||||||||||||||||||||||||||||||   
Sbjct: 116350 tgactgccaggtactcatttatctggtttattcgccattgtctatccatgcttgcct--- 116406

                                                                          
Query: 618    gttgagcctcgtacggttcatcagggtatatctggggactctgagttgtaggactgcaga 677
               || ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 116407 -ttnagcctcgtacggttcatcagggtatatctggggactctgagttgtaggactgcaga 116465

                                                                          
Query: 678    cccacagtttggaagctgaataatctcaagagtattagctaatccagtttggaatttagc 737
              ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 116466 cccacagtttggaagctgaataatctcaagagtattagctaatccagtttggaatttagc 116525

                                                                          
Query: 738    accatggggtttctgccatggcaaccaagacaccacccaccagtcatgattcctacaaca 797
              ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 116526 accatggggtttctgccatggcaaccaagacaccacccaccagtcatgattcctacaaca 116585

                                                                          
Query: 798    tgctgcttccctttggtcagtgatagacgcaagcctgagtctacccggtaatgtctatgt 857
              ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 116586 tgctgcttccctttggtcagtgatagacgcaagcctgagtctacccggtaatgtctatgt 116645

                                                              
Query: 858    gaaattaggccaaatgcttaccctctcctcagctctttcttcattttt 905
              ||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 116646 gaaattaggccaaatgcttaccctctcctcagctctttcttcattttt 116693



 Score =  335 bits (169), Expect = 2e-89
 Identities = 169/169 (100%)
 Strand = Plus / Plus

                                                                         
Query: 329   cgccttggcgagtgttgggctccgggcatctcggagcccaggcagctggtgcagagcgcc 388
             ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 73790 cgccttggcgagtgttgggctccgggcatctcggagcccaggcagctggtgcagagcgcc 73849

                                                                         
Query: 389   agcgcctctccccgcactggccgccgccggggcagtgcggagccagccaggctgtgcaca 448
             ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 73850 agcgcctctccccgcactggccgccgccggggcagtgcggagccagccaggctgtgcaca 73909

                                                              
Query: 449   gccggagcgcgggtccccccgaagaaggctccctatcgcctgcgtccca 497
             |||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 73910 gccggagcgcgggtccccccgaagaaggctccctatcgcctgcgtccca 73958


  Database: Sscrofa_10.2.fasta
    Posted date:  Nov 16, 2011 10:34 AM
  Number of letters in database: 2,808,509,378
  Number of sequences in database:  4582
  
Lambda     K      H
    1.37    0.711     1.31 

Gapped
Lambda     K      H
    1.37    0.711     1.31 


Matrix: blastn matrix:1 -3
Gap Penalties: Existence: 5, Extension: 2
Number of Sequences: 4582
Number of Hits to DB: 20,698,575
Number of extensions: 137
Number of successful extensions: 137
Number of sequences better than 1.0e-05: 2
Number of HSP's gapped: 136
Number of HSP's successfully gapped: 4
Length of query: 905
Length of database: 2,808,509,378
Length adjustment: 21
Effective length of query: 884
Effective length of database: 2,808,413,156
Effective search space: 2482637229904
Effective search space used: 2482637229904
X1: 11 (21.8 bits)
X2: 15 (29.7 bits)
X3: 50 (99.1 bits)
S1: 18 (36.2 bits)
S2: 29 (58.0 bits)