Search to RefSeqCP_Rel49
BLASTX 2.2.24 [Aug-08-2010]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= 20110601C-013189
(905 letters)
Database: RefSeq49_CP.fasta
33,336 sequences; 18,874,504 total letters
Searching..................................................done
***** No hits found ******
Database: RefSeq49_CP.fasta
Posted date: Oct 17, 2011 1:42 PM
Number of letters in database: 18,874,504
Number of sequences in database: 33,336
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 33336
Number of Hits to DB: 36,329,015
Number of extensions: 1024831
Number of successful extensions: 5048
Number of sequences better than 1.0e-05: 0
Number of HSP's gapped: 5024
Number of HSP's successfully gapped: 0
Length of query: 301
Length of database: 18,874,504
Length adjustment: 102
Effective length of query: 199
Effective length of database: 15,474,232
Effective search space: 3079372168
Effective search space used: 3079372168
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 34 (17.7 bits)
Animal-Genome cDNA 20110601C-013189
Search to RefSeqBP_Rel49
BLASTX 2.2.24 [Aug-08-2010]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= 20110601C-013189
(905 letters)
Database: RefSeq49_BP.fasta
33,088 sequences; 17,681,374 total letters
Searching..................................................done
***** No hits found ******
Database: RefSeq49_BP.fasta
Posted date: Oct 17, 2011 1:42 PM
Number of letters in database: 17,681,374
Number of sequences in database: 33,088
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 33088
Number of Hits to DB: 34,870,056
Number of extensions: 996826
Number of successful extensions: 5016
Number of sequences better than 1.0e-05: 0
Number of HSP's gapped: 4998
Number of HSP's successfully gapped: 0
Length of query: 301
Length of database: 17,681,374
Length adjustment: 102
Effective length of query: 199
Effective length of database: 14,306,398
Effective search space: 2846973202
Effective search space used: 2846973202
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 34 (17.7 bits)
Search to RefSeqSP_Rel49
BLASTX 2.2.24 [Aug-08-2010]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= 20110601C-013189
(905 letters)
Database: RefSeq49_SP.fasta
24,897 sequences; 11,343,932 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
Alignment gi|XP_003361127.1| PREDICTED: hypothetical protein LOC100626595... 199 2e-51
>ref|XP_003361127.1| PREDICTED: hypothetical protein LOC100626595 [Sus scrofa].
Length = 217
Score = 199 bits (505), Expect = 2e-51
Identities = 95/95 (100%), Positives = 95/95 (100%)
Frame = +1
Query: 331 PWRVLGSGHLGAQAAGAERQRLSPHWPPPGQCGASQAVHSRSAGPPEEGSLSPASQKHEV 510
PWRVLGSGHLGAQAAGAERQRLSPHWPPPGQCGASQAVHSRSAGPPEEGSLSPASQKHEV
Sbjct: 110 PWRVLGSGHLGAQAAGAERQRLSPHWPPPGQCGASQAVHSRSAGPPEEGSLSPASQKHEV 169
Query: 511 ILLFRQLSATSEQGESDCQVLIYLVYSPLSIHACL 615
ILLFRQLSATSEQGESDCQVLIYLVYSPLSIHACL
Sbjct: 170 ILLFRQLSATSEQGESDCQVLIYLVYSPLSIHACL 204
Database: RefSeq49_SP.fasta
Posted date: Oct 17, 2011 1:42 PM
Number of letters in database: 11,343,932
Number of sequences in database: 24,897
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 24897
Number of Hits to DB: 22,525,878
Number of extensions: 643804
Number of successful extensions: 3285
Number of sequences better than 1.0e-05: 1
Number of HSP's gapped: 3274
Number of HSP's successfully gapped: 1
Length of query: 301
Length of database: 11,343,932
Length adjustment: 98
Effective length of query: 203
Effective length of database: 8,904,026
Effective search space: 1807517278
Effective search space used: 1807517278
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 33 (17.3 bits)
Search to RefSeqMP_Rel49
BLASTX 2.2.24 [Aug-08-2010]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= 20110601C-013189
(905 letters)
Database: RefSeq49_MP.fasta
30,036 sequences; 15,617,559 total letters
Searching..................................................done
***** No hits found ******
Database: RefSeq49_MP.fasta
Posted date: Oct 17, 2011 1:42 PM
Number of letters in database: 15,617,559
Number of sequences in database: 30,036
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 30036
Number of Hits to DB: 29,923,216
Number of extensions: 823649
Number of successful extensions: 4048
Number of sequences better than 1.0e-05: 0
Number of HSP's gapped: 4029
Number of HSP's successfully gapped: 0
Length of query: 301
Length of database: 15,617,559
Length adjustment: 101
Effective length of query: 200
Effective length of database: 12,583,923
Effective search space: 2516784600
Effective search space used: 2516784600
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 34 (17.7 bits)
Search to RefSeqHP_Rel49
BLASTX 2.2.24 [Aug-08-2010]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= 20110601C-013189
(905 letters)
Database: RefSeq49_HP.fasta
32,964 sequences; 18,297,164 total letters
Searching..................................................done
***** No hits found ******
Database: RefSeq49_HP.fasta
Posted date: Oct 17, 2011 1:42 PM
Number of letters in database: 18,297,164
Number of sequences in database: 32,964
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 32964
Number of Hits to DB: 35,487,516
Number of extensions: 991073
Number of successful extensions: 4248
Number of sequences better than 1.0e-05: 0
Number of HSP's gapped: 4214
Number of HSP's successfully gapped: 0
Length of query: 301
Length of database: 18,297,164
Length adjustment: 102
Effective length of query: 199
Effective length of database: 14,934,836
Effective search space: 2972032364
Effective search space used: 2972032364
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 34 (17.7 bits)
Search to Sscrofa10_2
BLASTN 2.2.24 [Aug-08-2010]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= 20110601C-013189
(905 letters)
Database: Sscrofa_10.2.fasta
4582 sequences; 2,808,509,378 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
Sscrofa_Chr04 985 0.0
gb|GL893574.2| Sus scrofa unplaced genomic scaffold ChrUScaf1459 761 0.0
>Sscrofa_Chr04
|| Length = 143465943
Score = 985 bits (497), Expect = 0.0
Identities = 497/497 (100%)
Strand = Plus / Plus
Query: 1 accgctgcaccgcctcggcgcttgtcattctccgcggcgccgaggcgagtgccgactgcg 60
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 60465108 accgctgcaccgcctcggcgcttgtcattctccgcggcgccgaggcgagtgccgactgcg 60465167
Query: 61 gtgcctgtccgccagcttgttcgctcgctcgcccgccggcgcgcgggctgtgtgacggat 120
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 60465168 gtgcctgtccgccagcttgttcgctcgctcgcccgccggcgcgcgggctgtgtgacggat 60465227
Query: 121 cgctggggaacgggctggcagctctaccccctgcaacagctcttcggttttttccttgac 180
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 60465228 cgctggggaacgggctggcagctctaccccctgcaacagctcttcggttttttccttgac 60465287
Query: 181 cgccttccttgttgagtcgcgattccctgggagcaggagacacgcaccaggggctcggag 240
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 60465288 cgccttccttgttgagtcgcgattccctgggagcaggagacacgcaccaggggctcggag 60465347
Query: 241 cgccgcactccagggctggggcagctgcagcgctcgggactgcgcggccgggtgcagcct 300
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 60465348 cgccgcactccagggctggggcagctgcagcgctcgggactgcgcggccgggtgcagcct 60465407
Query: 301 ctgtcgctgtcgccgccgccgcgcggtgcgccttggcgagtgttgggctccgggcatctc 360
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 60465408 ctgtcgctgtcgccgccgccgcgcggtgcgccttggcgagtgttgggctccgggcatctc 60465467
Query: 361 ggagcccaggcagctggtgcagagcgccagcgcctctccccgcactggccgccgccgggg 420
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 60465468 ggagcccaggcagctggtgcagagcgccagcgcctctccccgcactggccgccgccgggg 60465527
Query: 421 cagtgcggagccagccaggctgtgcacagccggagcgcgggtccccccgaagaaggctcc 480
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 60465528 cagtgcggagccagccaggctgtgcacagccggagcgcgggtccccccgaagaaggctcc 60465587
Query: 481 ctatcgcctgcgtccca 497
|||||||||||||||||
Sbjct: 60465588 ctatcgcctgcgtccca 60465604
Score = 793 bits (400), Expect = 0.0
Identities = 406/408 (99%)
Strand = Plus / Plus
Query: 498 aaaacacgaagtcattctcttatttcgacagctgagtgcaacttcggaacagggagagag 557
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 60520480 aaaacacgaagtcattctcttatttcgacagctgagtgcaacttcggaacagggagagag 60520539
Query: 558 tgattgccaggtactcatttatctggtttattcgccattgtctatccatgcttgccttta 617
||| |||||||||||||||||||||||||||||||||||||||||||| |||||||||||
Sbjct: 60520540 tgactgccaggtactcatttatctggtttattcgccattgtctatccacgcttgccttta 60520599
Query: 618 gttgagcctcgtacggttcatcagggtatatctggggactctgagttgtaggactgcaga 677
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 60520600 gttgagcctcgtacggttcatcagggtatatctggggactctgagttgtaggactgcaga 60520659
Query: 678 cccacagtttggaagctgaataatctcaagagtattagctaatccagtttggaatttagc 737
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 60520660 cccacagtttggaagctgaataatctcaagagtattagctaatccagtttggaatttagc 60520719
Query: 738 accatggggtttctgccatggcaaccaagacaccacccaccagtcatgattcctacaaca 797
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 60520720 accatggggtttctgccatggcaaccaagacaccacccaccagtcatgattcctacaaca 60520779
Query: 798 tgctgcttccctttggtcagtgatagacgcaagcctgagtctacccggtaatgtctatgt 857
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 60520780 tgctgcttccctttggtcagtgatagacgcaagcctgagtctacccggtaatgtctatgt 60520839
Query: 858 gaaattaggccaaatgcttaccctctcctcagctctttcttcattttt 905
||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 60520840 gaaattaggccaaatgcttaccctctcctcagctctttcttcattttt 60520887
>gb|GL893574.2| Sus scrofa unplaced genomic scaffold ChrUScaf1459
Length = 178836
Score = 761 bits (384), Expect = 0.0
Identities = 402/408 (98%), Gaps = 4/408 (0%)
Strand = Plus / Plus
Query: 498 aaaacacgaagtcattctcttatttcgacagctgagtgcaacttcggaacagggagagag 557
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 116290 aaaacacgaagtcattctcttatttcgacagctgagtgcaacttcggaacagggagagag 116349
Query: 558 tgattgccaggtactcatttatctggtttattcgccattgtctatccatgcttgccttta 617
||| |||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 116350 tgactgccaggtactcatttatctggtttattcgccattgtctatccatgcttgcct--- 116406
Query: 618 gttgagcctcgtacggttcatcagggtatatctggggactctgagttgtaggactgcaga 677
|| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 116407 -ttnagcctcgtacggttcatcagggtatatctggggactctgagttgtaggactgcaga 116465
Query: 678 cccacagtttggaagctgaataatctcaagagtattagctaatccagtttggaatttagc 737
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 116466 cccacagtttggaagctgaataatctcaagagtattagctaatccagtttggaatttagc 116525
Query: 738 accatggggtttctgccatggcaaccaagacaccacccaccagtcatgattcctacaaca 797
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 116526 accatggggtttctgccatggcaaccaagacaccacccaccagtcatgattcctacaaca 116585
Query: 798 tgctgcttccctttggtcagtgatagacgcaagcctgagtctacccggtaatgtctatgt 857
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 116586 tgctgcttccctttggtcagtgatagacgcaagcctgagtctacccggtaatgtctatgt 116645
Query: 858 gaaattaggccaaatgcttaccctctcctcagctctttcttcattttt 905
||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 116646 gaaattaggccaaatgcttaccctctcctcagctctttcttcattttt 116693
Score = 335 bits (169), Expect = 2e-89
Identities = 169/169 (100%)
Strand = Plus / Plus
Query: 329 cgccttggcgagtgttgggctccgggcatctcggagcccaggcagctggtgcagagcgcc 388
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 73790 cgccttggcgagtgttgggctccgggcatctcggagcccaggcagctggtgcagagcgcc 73849
Query: 389 agcgcctctccccgcactggccgccgccggggcagtgcggagccagccaggctgtgcaca 448
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 73850 agcgcctctccccgcactggccgccgccggggcagtgcggagccagccaggctgtgcaca 73909
Query: 449 gccggagcgcgggtccccccgaagaaggctccctatcgcctgcgtccca 497
|||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 73910 gccggagcgcgggtccccccgaagaaggctccctatcgcctgcgtccca 73958
Database: Sscrofa_10.2.fasta
Posted date: Nov 16, 2011 10:34 AM
Number of letters in database: 2,808,509,378
Number of sequences in database: 4582
Lambda K H
1.37 0.711 1.31
Gapped
Lambda K H
1.37 0.711 1.31
Matrix: blastn matrix:1 -3
Gap Penalties: Existence: 5, Extension: 2
Number of Sequences: 4582
Number of Hits to DB: 20,698,575
Number of extensions: 137
Number of successful extensions: 137
Number of sequences better than 1.0e-05: 2
Number of HSP's gapped: 136
Number of HSP's successfully gapped: 4
Length of query: 905
Length of database: 2,808,509,378
Length adjustment: 21
Effective length of query: 884
Effective length of database: 2,808,413,156
Effective search space: 2482637229904
Effective search space used: 2482637229904
X1: 11 (21.8 bits)
X2: 15 (29.7 bits)
X3: 50 (99.1 bits)
S1: 18 (36.2 bits)
S2: 29 (58.0 bits)