Search to RefSeqBP_Rel49

BLASTX 2.2.24 [Aug-08-2010]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20110601C-014076
         (1181 letters)

Database: RefSeq49_BP.fasta 
           33,088 sequences; 17,681,374 total letters

Searching..................................................done

 ***** No hits found ******


  Database: RefSeq49_BP.fasta
    Posted date:  Oct 17, 2011  1:42 PM
  Number of letters in database: 17,681,374
  Number of sequences in database:  33,088
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 33088
Number of Hits to DB: 39,384,341
Number of extensions: 1129887
Number of successful extensions: 2911
Number of sequences better than 1.0e-05: 0
Number of HSP's gapped: 2907
Number of HSP's successfully gapped: 0
Length of query: 393
Length of database: 17,681,374
Length adjustment: 104
Effective length of query: 289
Effective length of database: 14,240,222
Effective search space: 4115424158
Effective search space used: 4115424158
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 35 (18.1 bits)
Animal-Genome cDNA 20110601C-014076

Animal-Genome cDNA 20110601C-014076


Search to RefSeqCP_Rel49

BLASTX 2.2.24 [Aug-08-2010]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20110601C-014076
         (1181 letters)

Database: RefSeq49_CP.fasta 
           33,336 sequences; 18,874,504 total letters

Searching..................................................done

 ***** No hits found ******


  Database: RefSeq49_CP.fasta
    Posted date:  Oct 17, 2011  1:42 PM
  Number of letters in database: 18,874,504
  Number of sequences in database:  33,336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 33336
Number of Hits to DB: 40,030,987
Number of extensions: 957444
Number of successful extensions: 2828
Number of sequences better than 1.0e-05: 0
Number of HSP's gapped: 2824
Number of HSP's successfully gapped: 0
Length of query: 393
Length of database: 18,874,504
Length adjustment: 105
Effective length of query: 288
Effective length of database: 15,374,224
Effective search space: 4427776512
Effective search space used: 4427776512
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 35 (18.1 bits)

Search to RefSeqSP_Rel49

BLASTX 2.2.24 [Aug-08-2010]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20110601C-014076
         (1181 letters)

Database: RefSeq49_SP.fasta 
           24,897 sequences; 11,343,932 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|XP_003128506.1| PREDICTED: hypothetical protein LOC100513602...   179   3e-45

>ref|XP_003128506.1| PREDICTED: hypothetical protein LOC100513602 [Sus scrofa].
          Length = 197

 Score =  179 bits (453), Expect = 3e-45
 Identities = 89/113 (78%), Positives = 89/113 (78%)
 Frame = +1

Query: 7   GRACEVSRYLQLALRIFPSFSSSDPHAELHEAGEVAREGDDALGTLSACLVTVQEEMQRC 186
           GRACEVSRYLQLALRIFPSFSSSDPHAELHEAGEVAREGDDALGTLSACLVTVQEEMQRC
Sbjct: 85  GRACEVSRYLQLALRIFPSFSSSDPHAELHEAGEVAREGDDALGTLSACLVTVQEEMQRC 144

Query: 187 LFSPFDGELVTGXXXXXXXXXXXXXXXXXXXXXXXXWYLHHSSCPIPDPRSED 345
           LFSPFDGELVTG                        WYLHHSSCPIPDPRSED
Sbjct: 145 LFSPFDGELVTGHMEVPKQGAELELKLLAFTTATARWYLHHSSCPIPDPRSED 197


  Database: RefSeq49_SP.fasta
    Posted date:  Oct 17, 2011  1:42 PM
  Number of letters in database: 11,343,932
  Number of sequences in database:  24,897
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 24897
Number of Hits to DB: 27,374,216
Number of extensions: 1046356
Number of successful extensions: 1790
Number of sequences better than 1.0e-05: 1
Number of HSP's gapped: 1789
Number of HSP's successfully gapped: 1
Length of query: 393
Length of database: 11,343,932
Length adjustment: 101
Effective length of query: 292
Effective length of database: 8,829,335
Effective search space: 2578165820
Effective search space used: 2578165820
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 34 (17.7 bits)

Search to RefSeqMP_Rel49

BLASTX 2.2.24 [Aug-08-2010]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20110601C-014076
         (1181 letters)

Database: RefSeq49_MP.fasta 
           30,036 sequences; 15,617,559 total letters

Searching..................................................done

 ***** No hits found ******


  Database: RefSeq49_MP.fasta
    Posted date:  Oct 17, 2011  1:42 PM
  Number of letters in database: 15,617,559
  Number of sequences in database:  30,036
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 30036
Number of Hits to DB: 33,014,244
Number of extensions: 769778
Number of successful extensions: 2304
Number of sequences better than 1.0e-05: 0
Number of HSP's gapped: 2300
Number of HSP's successfully gapped: 0
Length of query: 393
Length of database: 15,617,559
Length adjustment: 103
Effective length of query: 290
Effective length of database: 12,523,851
Effective search space: 3631916790
Effective search space used: 3631916790
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 35 (18.1 bits)

Search to RefSeqHP_Rel49

BLASTX 2.2.24 [Aug-08-2010]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20110601C-014076
         (1181 letters)

Database: RefSeq49_HP.fasta 
           32,964 sequences; 18,297,164 total letters

Searching..................................................done

 ***** No hits found ******


  Database: RefSeq49_HP.fasta
    Posted date:  Oct 17, 2011  1:42 PM
  Number of letters in database: 18,297,164
  Number of sequences in database:  32,964
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 32964
Number of Hits to DB: 39,069,572
Number of extensions: 917694
Number of successful extensions: 2631
Number of sequences better than 1.0e-05: 0
Number of HSP's gapped: 2628
Number of HSP's successfully gapped: 0
Length of query: 393
Length of database: 18,297,164
Length adjustment: 105
Effective length of query: 288
Effective length of database: 14,835,944
Effective search space: 4272751872
Effective search space used: 4272751872
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 35 (18.1 bits)

Search to Sscrofa10_2

BLASTN 2.2.24 [Aug-08-2010]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 20110601C-014076
         (1181 letters)

Database: Sscrofa_10.2.fasta 
           4582 sequences; 2,808,509,378 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Sscrofa_Chr07                                                         615   e-173
Sscrofa_Chr04                                                          66   5e-08

>Sscrofa_Chr07 
||          Length = 134764511

 Score =  615 bits (310), Expect = e-173
 Identities = 310/310 (100%)
 Strand = Plus / Plus

                                                                            
Query: 295      tggtatctacaccacagttcatgccccatcccggacccgcggagcgaggattaatagact 354
                ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 57464549 tggtatctacaccacagttcatgccccatcccggacccgcggagcgaggattaatagact 57464608

                                                                            
Query: 355      ttagatggagggcatgtaccaagaagagagcaaagaccaacgataacttttagtaccaga 414
                ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 57464609 ttagatggagggcatgtaccaagaagagagcaaagaccaacgataacttttagtaccaga 57464668

                                                                            
Query: 415      aatttgttttccaaacacctgctcttctcaccttcctgggatttgtcttcctccgctttg 474
                ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 57464669 aatttgttttccaaacacctgctcttctcaccttcctgggatttgtcttcctccgctttg 57464728

                                                                            
Query: 475      aagtcctgacccctaccccttcttagctcagggccctctactggatagagacctgggctc 534
                ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 57464729 aagtcctgacccctaccccttcttagctcagggccctctactggatagagacctgggctc 57464788

                                                                            
Query: 535      tgctcattctggggctgctgcagctgagagatcctggaccctgggatagatgccggcaga 594
                ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 57464789 tgctcattctggggctgctgcagctgagagatcctggaccctgggatagatgccggcaga 57464848

                          
Query: 595      agttaagaat 604
                ||||||||||
Sbjct: 57464849 agttaagaat 57464858



 Score =  430 bits (217), Expect = e-118
 Identities = 217/217 (100%)
 Strand = Plus / Plus

                                                                            
Query: 6        ggggcgggcctgtgaggtctcgcggtatcttcagctcgccctgaggatttttcccagctt 65
                ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 57441141 ggggcgggcctgtgaggtctcgcggtatcttcagctcgccctgaggatttttcccagctt 57441200

                                                                            
Query: 66       ttccagctctgatcctcacgcggagctccacgaagctggtgaggtggcacgtgaaggtga 125
                ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 57441201 ttccagctctgatcctcacgcggagctccacgaagctggtgaggtggcacgtgaaggtga 57441260

                                                                            
Query: 126      tgatgccctcggcacgctttcagcctgcctggtgactgtgcaggaagagatgcagcgctg 185
                ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 57441261 tgatgccctcggcacgctttcagcctgcctggtgactgtgcaggaagagatgcagcgctg 57441320

                                                     
Query: 186      tctcttcagcccctttgacggggagctggtgacgggt 222
                |||||||||||||||||||||||||||||||||||||
Sbjct: 57441321 tctcttcagcccctttgacggggagctggtgacgggt 57441357



 Score =  394 bits (199), Expect = e-107
 Identities = 216/222 (97%)
 Strand = Plus / Plus

                                                                            
Query: 960      ttaccaggaagagagtgaatatcaaagaacttttgtatcagaaacttatccgcatggcat 1019
                ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 57474257 ttaccaggaagagagtgaatatcaaagaacttttgtatcagaaacttatccgcatggcat 57474316

                                                                            
Query: 1020     tatcagacacctgctcttcttacctttctggggcttgtctcctccactttgaagtcctga 1079
                ||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||
Sbjct: 57474317 tatcagacacctgctcttcttacttttctggggcttgtctcctccactttgaagtcctga 57474376

                                                                            
Query: 1080     cccctaccccccttctccttagctcangatggcatgtaagccctcatggcctgactgtct 1139
                |||||||||||||||||||||||||| |||||||||||||||   |||||||||||||||
Sbjct: 57474377 cccctaccccccttctccttagctcaggatggcatgtaagcctcaatggcctgactgtct 57474436

                                                          
Query: 1140     tggggtcccatgtctttggggctcctgtacatatgaaatttg 1181
                ||||||| ||||||||||||||||||||||||||||||||||
Sbjct: 57474437 tggggtctcatgtctttggggctcctgtacatatgaaatttg 57474478



 Score =  383 bits (193), Expect = e-103
 Identities = 193/193 (100%)
 Strand = Plus / Plus

                                                                            
Query: 656      agaaatgcctctgattaaagacctgattacttgtgcaatagagacctaactttggggccc 715
                ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 57473953 agaaatgcctctgattaaagacctgattacttgtgcaatagagacctaactttggggccc 57474012

                                                                            
Query: 716      acctacatctccacctcctgaaaatgtgtttaacctgttttcaggactaagagactgatt 775
                ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 57474013 acctacatctccacctcctgaaaatgtgtttaacctgttttcaggactaagagactgatt 57474072

                                                                            
Query: 776      cagcgagatggaaaaatcttccaactcaacttctggatggtgaaacttcttggggatgcc 835
                ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 57474073 cagcgagatggaaaaatcttccaactcaacttctggatggtgaaacttcttggggatgcc 57474132

                             
Query: 836      tcggggcaggatc 848
                |||||||||||||
Sbjct: 57474133 tcggggcaggatc 57474145



 Score = 73.8 bits (37), Expect = 2e-10
 Identities = 59/65 (90%), Gaps = 1/65 (1%)
 Strand = Plus / Plus

                                                                            
Query: 1026     acacctgctcttcttacctttctggggcttgtct-cctccactttgaagtcctgacccct 1084
                |||||||||||||| ||||| |||||  |||||| ||||| |||||||||||||||||||
Sbjct: 57464683 acacctgctcttctcaccttcctgggatttgtcttcctccgctttgaagtcctgacccct 57464742

                     
Query: 1085     acccc 1089
                |||||
Sbjct: 57464743 acccc 57464747



 Score = 65.9 bits (33), Expect = 5e-08
 Identities = 58/65 (89%), Gaps = 1/65 (1%)
 Strand = Plus / Plus

                                                                            
Query: 429      acacctgctcttctcaccttcctgggatttgtcttcctccgctttgaagtcctgacccct 488
                |||||||||||||| || || |||||  |||||| ||||| |||||||||||||||||||
Sbjct: 57474323 acacctgctcttcttacttttctggggcttgtct-cctccactttgaagtcctgacccct 57474381

                     
Query: 489      acccc 493
                |||||
Sbjct: 57474382 acccc 57474386


>Sscrofa_Chr04 
||          Length = 143465943

 Score = 65.9 bits (33), Expect = 5e-08
 Identities = 57/65 (87%)
 Strand = Plus / Plus

                                                                             
Query: 416       atttgttttccaaacacctgctcttctcaccttcctgggatttgtcttcctccgctttga 475
                 |||||||| |||||||  ||||||||||| ||||||| || | |||||||||| ||||||
Sbjct: 106083295 atttgtttaccaaacatatgctcttctcatcttcctgtgaatggtcttcctcccctttga 106083354

                      
Query: 476       agtcc 480
                 |||||
Sbjct: 106083355 agtcc 106083359


  Database: Sscrofa_10.2.fasta
    Posted date:  Nov 16, 2011 10:34 AM
  Number of letters in database: 2,808,509,378
  Number of sequences in database:  4582
  
Lambda     K      H
    1.37    0.711     1.31 

Gapped
Lambda     K      H
    1.37    0.711     1.31 


Matrix: blastn matrix:1 -3
Gap Penalties: Existence: 5, Extension: 2
Number of Sequences: 4582
Number of Hits to DB: 28,796,406
Number of extensions: 674
Number of successful extensions: 674
Number of sequences better than 1.0e-05: 2
Number of HSP's gapped: 673
Number of HSP's successfully gapped: 7
Length of query: 1181
Length of database: 2,808,509,378
Length adjustment: 21
Effective length of query: 1160
Effective length of database: 2,808,413,156
Effective search space: 3257759260960
Effective search space used: 3257759260960
X1: 11 (21.8 bits)
X2: 15 (29.7 bits)
X3: 50 (99.1 bits)
S1: 18 (36.2 bits)
S2: 30 (60.0 bits)