Animal-Genome cDNA LNG01_0056_E06


Search to RefSeqBP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= LNG01_0056_E06
         (1142 letters)

Database: RefSeqBP 
           33,508 sequences; 16,112,626 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_776702.1| clathrin, light polypeptide B (light chain B) [...   356   2e-98
Alignment   gi|NP_776447.1| clathrin, light polypeptide (Lca) [Bos taurus]       218   7e-57

>ref|NP_776702.1| clathrin, light polypeptide B (light chain B) [Bos taurus]
          Length = 210

 Score =  356 bits (914), Expect = 2e-98
 Identities = 180/210 (85%), Positives = 182/210 (86%)
 Frame = +1

Query: 217 MADDXXXXXXXXXXXXXXXXXXXXXXFLAQQESEIAGIENDEGFGAPAGSQAALAQPGPA 396
           MADD                      FLAQQESEIAGIENDEGFGAPAGSQ  LAQPGPA
Sbjct: 1   MADDFGFFSSSESGAPEAAEEDPAAAFLAQQESEIAGIENDEGFGAPAGSQGGLAQPGPA 60

Query: 397 SGGPEDMGTTVNGDVFQDANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAAS 576
           SG  EDMG TVNGDVFQ+ANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAAS
Sbjct: 61  SGASEDMGATVNGDVFQEANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAAS 120

Query: 577 KVTEQEWREKAKKDLEEWDQRQSEQVEKNKINNRASEEAFVKESKEETPGTEWEKVAQLC 756
           KV EQEWREKAKKDLEEW+QRQSEQVEKNKINNRASEEAFVKESKEETPGTEWEKVAQLC
Sbjct: 121 KVMEQEWREKAKKDLEEWNQRQSEQVEKNKINNRASEEAFVKESKEETPGTEWEKVAQLC 180

Query: 757 DFNPKSSKQCKDVSRLRSVLMSLKQTPLSR 846
           DFNPKSSKQCKDVSRLRSVLMSLKQTPLSR
Sbjct: 181 DFNPKSSKQCKDVSRLRSVLMSLKQTPLSR 210


>ref|NP_776447.1| clathrin, light polypeptide (Lca) [Bos taurus]
          Length = 243

 Score =  218 bits (555), Expect = 7e-57
 Identities = 115/212 (54%), Positives = 137/212 (64%), Gaps = 30/212 (14%)
 Frame = +1

Query: 295 FLAQQESEIAGIENDEGFGAPAGSQAALAQPGPASGGPEDMGTTVNGDVFQDANGPADGY 474
           FLAQQESEIAGIENDE F    G        G   G P+ +    NGD +Q++NGP D Y
Sbjct: 30  FLAQQESEIAGIENDEAFAILDGGAPGSQPHGEPPGIPDAVDGVTNGDYYQESNGPTDSY 89

Query: 475 AAIAQADRLTQEPESIRKWREEQRKRLQELDAASKVTEQEWREKAKKDLEEWDQRQSEQV 654
           AAI+Q DRL  EPESIRKWREEQ +RL+ LDA S+  E EW+EKA K+L+EW  RQ EQ+
Sbjct: 90  AAISQVDRLQSEPESIRKWREEQTERLEALDANSRKQEAEWKEKAIKELDEWYARQDEQL 149

Query: 655 EKNKINNR------------------------------ASEEAFVKESKEETPGTEWEKV 744
           +K K NNR                              A+EEAFV + +E +PGTEWE+V
Sbjct: 150 QKTKANNRVADEAFYKQPFADVIGYVTNINHPCYSLEQAAEEAFVNDIEESSPGTEWERV 209

Query: 745 AQLCDFNPKSSKQCKDVSRLRSVLMSLKQTPL 840
           A+LCDFNPKSSKQ KDVSR+RSVL+SLKQ PL
Sbjct: 210 ARLCDFNPKSSKQAKDVSRMRSVLISLKQAPL 241


  Database: RefSeqBP
    Posted date:  Aug 1, 2006  7:14 PM
  Number of letters in database: 16,112,626
  Number of sequences in database:  33,508
  
Lambda     K      H
   0.317    0.131    0.400 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 38,314,420
Number of Sequences: 33508
Number of extensions: 1053012
Number of successful extensions: 7448
Number of sequences better than 1.0e-05: 2
Number of HSP's better than  0.0 without gapping: 5141
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7337
length of database: 16,112,626
effective HSP length: 103
effective length of database: 12,661,302
effective search space used: 3507180654
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqCP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= LNG01_0056_E06
         (1142 letters)

Database: RefSeqCP 
           33,732 sequences; 19,266,565 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|XP_866115.1| PREDICTED: similar to clathrin, light polypepti...   357   9e-99
Alignment   gi|XP_546220.2| PREDICTED: similar to Clathrin light chain B (L...   346   2e-95
Alignment   gi|XP_866083.1| PREDICTED: similar to clathrin, light polypepti...   346   2e-95
Alignment   gi|XP_866050.1| PREDICTED: similar to clathrin, light polypepti...   336   3e-92
Alignment   gi|XP_866066.1| PREDICTED: similar to clathrin, light polypepti...   324   9e-89
Alignment   gi|XP_866787.1| PREDICTED: similar to clathrin, light polypepti...   233   3e-61
Alignment   gi|XP_866825.1| PREDICTED: similar to Clathrin light chain A (L...   223   4e-58
Alignment   gi|XP_866761.1| PREDICTED: similar to Clathrin light chain A (L...   222   6e-58
Alignment   gi|XP_531996.2| PREDICTED: similar to Clathrin light chain A (L...   217   1e-56
Alignment   gi|XP_866835.1| PREDICTED: similar to clathrin, light polypepti...   192   7e-49

>ref|XP_866115.1| PREDICTED: similar to clathrin, light polypeptide isoform a isoform
           5 [Canis familiaris]
          Length = 211

 Score =  357 bits (917), Expect = 9e-99
 Identities = 182/211 (86%), Positives = 185/211 (87%), Gaps = 1/211 (0%)
 Frame = +1

Query: 217 MADDXXXXXXXXXXXXXXXXXXXXXXFLAQQESEIAGIENDEGFGAPAGSQAALAQPGPA 396
           MADD                      FLAQQESEIAGIENDEGFGAPAGS AALAQPGPA
Sbjct: 1   MADDFGFFSSSESGAPEAAEEDPAAAFLAQQESEIAGIENDEGFGAPAGSHAALAQPGPA 60

Query: 397 SG-GPEDMGTTVNGDVFQDANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAA 573
            G G EDMGTT+NGDVFQ+ANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAA
Sbjct: 61  GGAGSEDMGTTINGDVFQEANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAA 120

Query: 574 SKVTEQEWREKAKKDLEEWDQRQSEQVEKNKINNRASEEAFVKESKEETPGTEWEKVAQL 753
           SKVTEQEWREKAKKDLEEW+QRQSEQVEKNKINNRASEEAFVKESKEETPGTEWEKVAQL
Sbjct: 121 SKVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNRASEEAFVKESKEETPGTEWEKVAQL 180

Query: 754 CDFNPKSSKQCKDVSRLRSVLMSLKQTPLSR 846
           CDFNPKSSKQCKDVSRLRSVLMSLKQTPLSR
Sbjct: 181 CDFNPKSSKQCKDVSRLRSVLMSLKQTPLSR 211


>ref|XP_546220.2| PREDICTED: similar to Clathrin light chain B (Lcb) isoform 1 [Canis
           familiaris]
          Length = 229

 Score =  346 bits (888), Expect = 2e-95
 Identities = 182/229 (79%), Positives = 185/229 (80%), Gaps = 19/229 (8%)
 Frame = +1

Query: 217 MADDXXXXXXXXXXXXXXXXXXXXXXFLAQQESEIAGIENDEGFGAPAGSQAALAQPGPA 396
           MADD                      FLAQQESEIAGIENDEGFGAPAGS AALAQPGPA
Sbjct: 1   MADDFGFFSSSESGAPEAAEEDPAAAFLAQQESEIAGIENDEGFGAPAGSHAALAQPGPA 60

Query: 397 SG-GPEDMGTTVNGDVFQDANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAA 573
            G G EDMGTT+NGDVFQ+ANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAA
Sbjct: 61  GGAGSEDMGTTINGDVFQEANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAA 120

Query: 574 SKVTEQEWREKAKKDLEEWDQRQSEQVEKNKINNR------------------ASEEAFV 699
           SKVTEQEWREKAKKDLEEW+QRQSEQVEKNKINNR                  ASEEAFV
Sbjct: 121 SKVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNRIADKAFYQQPDADIIGYVASEEAFV 180

Query: 700 KESKEETPGTEWEKVAQLCDFNPKSSKQCKDVSRLRSVLMSLKQTPLSR 846
           KESKEETPGTEWEKVAQLCDFNPKSSKQCKDVSRLRSVLMSLKQTPLSR
Sbjct: 181 KESKEETPGTEWEKVAQLCDFNPKSSKQCKDVSRLRSVLMSLKQTPLSR 229


>ref|XP_866083.1| PREDICTED: similar to clathrin, light polypeptide isoform a isoform
           4 [Canis familiaris]
          Length = 213

 Score =  346 bits (888), Expect = 2e-95
 Identities = 177/213 (83%), Positives = 182/213 (85%), Gaps = 3/213 (1%)
 Frame = +1

Query: 217 MADDXXXXXXXXXXXXXXXXXXXXXXFLAQQESEIAGIENDEGFGAPAGSQAALAQPG-- 390
           MADD                      FLAQQESEIAGIENDEGFGAPAGS AALA     
Sbjct: 1   MADDFGFFSSSESGAPEAAEEDPAAAFLAQQESEIAGIENDEGFGAPAGSHAALAHASAC 60

Query: 391 -PASGGPEDMGTTVNGDVFQDANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELD 567
            P++ G EDMGTT+NGDVFQ+ANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELD
Sbjct: 61  PPSTAGSEDMGTTINGDVFQEANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELD 120

Query: 568 AASKVTEQEWREKAKKDLEEWDQRQSEQVEKNKINNRASEEAFVKESKEETPGTEWEKVA 747
           AASKVTEQEWREKAKKDLEEW+QRQSEQVEKNKINNRASEEAFVKESKEETPGTEWEKVA
Sbjct: 121 AASKVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNRASEEAFVKESKEETPGTEWEKVA 180

Query: 748 QLCDFNPKSSKQCKDVSRLRSVLMSLKQTPLSR 846
           QLCDFNPKSSKQCKDVSRLRSVLMSLKQTPLSR
Sbjct: 181 QLCDFNPKSSKQCKDVSRLRSVLMSLKQTPLSR 213


>ref|XP_866050.1| PREDICTED: similar to clathrin, light polypeptide isoform a isoform
           2 [Canis familiaris]
          Length = 208

 Score =  336 bits (861), Expect = 3e-92
 Identities = 172/210 (81%), Positives = 177/210 (84%)
 Frame = +1

Query: 217 MADDXXXXXXXXXXXXXXXXXXXXXXFLAQQESEIAGIENDEGFGAPAGSQAALAQPGPA 396
           MADD                      FLAQQESEIAGIENDEGFGAPAG+     + GP 
Sbjct: 1   MADDFGFFSSSESGAPEAAEEDPAAAFLAQQESEIAGIENDEGFGAPAGNSGE--EEGPR 58

Query: 397 SGGPEDMGTTVNGDVFQDANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAAS 576
            G   DMGTT+NGDVFQ+ANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAAS
Sbjct: 59  YGPLGDMGTTINGDVFQEANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAAS 118

Query: 577 KVTEQEWREKAKKDLEEWDQRQSEQVEKNKINNRASEEAFVKESKEETPGTEWEKVAQLC 756
           KVTEQEWREKAKKDLEEW+QRQSEQVEKNKINNRASEEAFVKESKEETPGTEWEKVAQLC
Sbjct: 119 KVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNRASEEAFVKESKEETPGTEWEKVAQLC 178

Query: 757 DFNPKSSKQCKDVSRLRSVLMSLKQTPLSR 846
           DFNPKSSKQCKDVSRLRSVLMSLKQTPLSR
Sbjct: 179 DFNPKSSKQCKDVSRLRSVLMSLKQTPLSR 208


>ref|XP_866066.1| PREDICTED: similar to clathrin, light polypeptide isoform a isoform
           3 [Canis familiaris]
          Length = 207

 Score =  324 bits (831), Expect = 9e-89
 Identities = 168/210 (80%), Positives = 172/210 (81%)
 Frame = +1

Query: 217 MADDXXXXXXXXXXXXXXXXXXXXXXFLAQQESEIAGIENDEGFGAPAGSQAALAQPGPA 396
           MADD                      FLAQQESEIAGIENDEGFG   G          +
Sbjct: 1   MADDFGFFSSSESGAPEAAEEDPAAAFLAQQESEIAGIENDEGFGLSNGYCHVFVL---S 57

Query: 397 SGGPEDMGTTVNGDVFQDANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAAS 576
             G EDMGTT+NGDVFQ+ANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAAS
Sbjct: 58  LAGSEDMGTTINGDVFQEANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAAS 117

Query: 577 KVTEQEWREKAKKDLEEWDQRQSEQVEKNKINNRASEEAFVKESKEETPGTEWEKVAQLC 756
           KVTEQEWREKAKKDLEEW+QRQSEQVEKNKINNRASEEAFVKESKEETPGTEWEKVAQLC
Sbjct: 118 KVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNRASEEAFVKESKEETPGTEWEKVAQLC 177

Query: 757 DFNPKSSKQCKDVSRLRSVLMSLKQTPLSR 846
           DFNPKSSKQCKDVSRLRSVLMSLKQTPLSR
Sbjct: 178 DFNPKSSKQCKDVSRLRSVLMSLKQTPLSR 207


>ref|XP_866787.1| PREDICTED: similar to clathrin, light polypeptide A isoform a
           isoform 3 [Canis familiaris]
          Length = 218

 Score =  233 bits (594), Expect = 3e-61
 Identities = 115/182 (63%), Positives = 137/182 (75%)
 Frame = +1

Query: 295 FLAQQESEIAGIENDEGFGAPAGSQAALAQPGPASGGPEDMGTTVNGDVFQDANGPADGY 474
           FLAQQESEIAGIENDE F    G        G   G P+ +   +NG+ +Q++NGP D Y
Sbjct: 35  FLAQQESEIAGIENDEAFAILDGGAPGPQPHGEPPGVPDAVDGVMNGEYYQESNGPTDSY 94

Query: 475 AAIAQADRLTQEPESIRKWREEQRKRLQELDAASKVTEQEWREKAKKDLEEWDQRQSEQV 654
           AAI+Q DRL  EPESIRKWREEQ +RL+ LDA S+  E EW+EKA K+LEEW  RQ EQ+
Sbjct: 95  AAISQVDRLQSEPESIRKWREEQTERLEALDANSRKQEAEWKEKAIKELEEWYARQDEQL 154

Query: 655 EKNKINNRASEEAFVKESKEETPGTEWEKVAQLCDFNPKSSKQCKDVSRLRSVLMSLKQT 834
           +K K NNRA+EEAFV +  E +PGTEWE+VA+LCDFNPKSSKQ KDVSR+RSVL+SLKQ 
Sbjct: 155 QKTKANNRAAEEAFVNDIDESSPGTEWERVARLCDFNPKSSKQAKDVSRMRSVLISLKQA 214

Query: 835 PL 840
           PL
Sbjct: 215 PL 216


>ref|XP_866825.1| PREDICTED: similar to Clathrin light chain A (Lca) isoform 6 [Canis
           familiaris]
          Length = 230

 Score =  223 bits (567), Expect = 4e-58
 Identities = 114/194 (58%), Positives = 137/194 (70%), Gaps = 12/194 (6%)
 Frame = +1

Query: 295 FLAQQESEIAGIENDEGFGAPAGSQAALAQPGPASGGPEDMGTTVNGDVFQDANGPADGY 474
           FLAQQESEIAGIENDE F    G        G   G P+ +   +NG+ +Q++NGP D Y
Sbjct: 35  FLAQQESEIAGIENDEAFAILDGGAPGPQPHGEPPGVPDAVDGVMNGEYYQESNGPTDSY 94

Query: 475 AAIAQADRLTQEPESIRKWREEQRKRLQELDAASKVTEQEWREKAKKDLEEWDQRQSEQV 654
           AAI+Q DRL  EPESIRKWREEQ +RL+ LDA S+  E EW+EKA K+LEEW  RQ EQ+
Sbjct: 95  AAISQVDRLQSEPESIRKWREEQTERLEALDANSRKQEAEWKEKAIKELEEWYARQDEQL 154

Query: 655 EKNKINN------------RASEEAFVKESKEETPGTEWEKVAQLCDFNPKSSKQCKDVS 798
           +K K NN            +A+EEAFV +  E +PGTEWE+VA+LCDFNPKSSKQ KDVS
Sbjct: 155 QKTKANNSTNINHPCYSLEQAAEEAFVNDIDESSPGTEWERVARLCDFNPKSSKQAKDVS 214

Query: 799 RLRSVLMSLKQTPL 840
           R+RSVL+SLKQ PL
Sbjct: 215 RMRSVLISLKQAPL 228


>ref|XP_866761.1| PREDICTED: similar to Clathrin light chain A (Lca) isoform 2 [Canis
           familiaris]
          Length = 236

 Score =  222 bits (565), Expect = 6e-58
 Identities = 115/200 (57%), Positives = 137/200 (68%), Gaps = 18/200 (9%)
 Frame = +1

Query: 295 FLAQQESEIAGIENDEGFGAPAGSQAALAQPGPASGGPEDMGTTVNGDVFQDANGPADGY 474
           FLAQQESEIAGIENDE F    G        G   G P+ +   +NG+ +Q++NGP D Y
Sbjct: 35  FLAQQESEIAGIENDEAFAILDGGAPGPQPHGEPPGVPDAVDGVMNGEYYQESNGPTDSY 94

Query: 475 AAIAQADRLTQEPESIRKWREEQRKRLQELDAASKVTEQEWREKAKKDLEEWDQRQSEQV 654
           AAI+Q DRL  EPESIRKWREEQ +RL+ LDA S+  E EW+EKA K+LEEW  RQ EQ+
Sbjct: 95  AAISQVDRLQSEPESIRKWREEQTERLEALDANSRKQEAEWKEKAIKELEEWYARQDEQL 154

Query: 655 EKNKINNR------------------ASEEAFVKESKEETPGTEWEKVAQLCDFNPKSSK 780
           +K K NNR                  A+EEAFV +  E +PGTEWE+VA+LCDFNPKSSK
Sbjct: 155 QKTKANNRVADEAFYKQPFADVIGYVAAEEAFVNDIDESSPGTEWERVARLCDFNPKSSK 214

Query: 781 QCKDVSRLRSVLMSLKQTPL 840
           Q KDVSR+RSVL+SLKQ PL
Sbjct: 215 QAKDVSRMRSVLISLKQAPL 234


>ref|XP_531996.2| PREDICTED: similar to Clathrin light chain A (Lca) isoform 1 [Canis
           familiaris]
          Length = 248

 Score =  217 bits (553), Expect = 1e-56
 Identities = 115/212 (54%), Positives = 137/212 (64%), Gaps = 30/212 (14%)
 Frame = +1

Query: 295 FLAQQESEIAGIENDEGFGAPAGSQAALAQPGPASGGPEDMGTTVNGDVFQDANGPADGY 474
           FLAQQESEIAGIENDE F    G        G   G P+ +   +NG+ +Q++NGP D Y
Sbjct: 35  FLAQQESEIAGIENDEAFAILDGGAPGPQPHGEPPGVPDAVDGVMNGEYYQESNGPTDSY 94

Query: 475 AAIAQADRLTQEPESIRKWREEQRKRLQELDAASKVTEQEWREKAKKDLEEWDQRQSEQV 654
           AAI+Q DRL  EPESIRKWREEQ +RL+ LDA S+  E EW+EKA K+LEEW  RQ EQ+
Sbjct: 95  AAISQVDRLQSEPESIRKWREEQTERLEALDANSRKQEAEWKEKAIKELEEWYARQDEQL 154

Query: 655 EKNKINNR------------------------------ASEEAFVKESKEETPGTEWEKV 744
           +K K NNR                              A+EEAFV +  E +PGTEWE+V
Sbjct: 155 QKTKANNRVADEAFYKQPFADVIGYVTNINHPCYSLEQAAEEAFVNDIDESSPGTEWERV 214

Query: 745 AQLCDFNPKSSKQCKDVSRLRSVLMSLKQTPL 840
           A+LCDFNPKSSKQ KDVSR+RSVL+SLKQ PL
Sbjct: 215 ARLCDFNPKSSKQAKDVSRMRSVLISLKQAPL 246


>ref|XP_866835.1| PREDICTED: similar to clathrin, light polypeptide A isoform a
           isoform 7 [Canis familiaris]
          Length = 139

 Score =  192 bits (487), Expect = 7e-49
 Identities = 91/132 (68%), Positives = 109/132 (82%)
 Frame = +1

Query: 445 QDANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAASKVTEQEWREKAKKDLE 624
           +++NGP D YAAI+Q DRL  EPESIRKWREEQ +RL+ LDA S+  E EW+EKA K+LE
Sbjct: 6   RESNGPTDSYAAISQVDRLQSEPESIRKWREEQTERLEALDANSRKQEAEWKEKAIKELE 65

Query: 625 EWDQRQSEQVEKNKINNRASEEAFVKESKEETPGTEWEKVAQLCDFNPKSSKQCKDVSRL 804
           EW  RQ EQ++K K NNRA+EEAFV +  E +PGTEWE+VA+LCDFNPKSSKQ KDVSR+
Sbjct: 66  EWYARQDEQLQKTKANNRAAEEAFVNDIDESSPGTEWERVARLCDFNPKSSKQAKDVSRM 125

Query: 805 RSVLMSLKQTPL 840
           RSVL+SLKQ PL
Sbjct: 126 RSVLISLKQAPL 137


  Database: RefSeqCP
    Posted date:  Aug 1, 2006  9:25 PM
  Number of letters in database: 19,266,565
  Number of sequences in database:  33,732
  
Lambda     K      H
   0.317    0.131    0.400 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 44,957,624
Number of Sequences: 33732
Number of extensions: 1241517
Number of successful extensions: 9488
Number of sequences better than 1.0e-05: 10
Number of HSP's better than  0.0 without gapping: 6252
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 9206
length of database: 19,266,565
effective HSP length: 105
effective length of database: 15,724,705
effective search space used: 4324293875
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqSP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= LNG01_0056_E06
         (1142 letters)

Database: RefSeqSP 
           1040 sequences; 434,620 total letters

Searching...done

 ***** No hits found ******

  Database: RefSeqSP
    Posted date:  Aug 1, 2006  7:14 PM
  Number of letters in database: 434,620
  Number of sequences in database:  1040
  
Lambda     K      H
   0.317    0.131    0.400 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 983,115
Number of Sequences: 1040
Number of extensions: 25345
Number of successful extensions: 174
Number of sequences better than 1.0e-05: 0
Number of HSP's better than  0.0 without gapping: 115
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 161
length of database: 434,620
effective HSP length: 78
effective length of database: 353,500
effective search space used: 106757000
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqHP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= LNG01_0056_E06
         (1142 letters)

Database: RefSeqHP 
           39,411 sequences; 17,774,539 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_001825.1| clathrin, light polypeptide isoform a [Homo sap...   355   4e-98
Alignment   gi|NP_009028.1| clathrin, light polypeptide isoform b [Homo sap...   344   9e-95
Alignment   gi|NP_001824.1| clathrin, light polypeptide A isoform a [Homo s...   236   2e-62
Alignment   gi|NP_009027.1| clathrin, light polypeptide A isoform b [Homo s...   221   1e-57

>ref|NP_001825.1| clathrin, light polypeptide isoform a [Homo sapiens]
          Length = 211

 Score =  355 bits (911), Expect = 4e-98
 Identities = 182/211 (86%), Positives = 184/211 (87%), Gaps = 1/211 (0%)
 Frame = +1

Query: 217 MADDXXXXXXXXXXXXXXXXXXXXXXFLAQQESEIAGIENDEGFGAPAGSQAALAQPGPA 396
           MADD                      FLAQQESEIAGIENDEGFGAPAGS AA AQPGP 
Sbjct: 1   MADDFGFFSSSESGAPEAAEEDPAAAFLAQQESEIAGIENDEGFGAPAGSHAAPAQPGPT 60

Query: 397 SG-GPEDMGTTVNGDVFQDANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAA 573
           SG G EDMGTTVNGDVFQ+ANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAA
Sbjct: 61  SGAGSEDMGTTVNGDVFQEANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAA 120

Query: 574 SKVTEQEWREKAKKDLEEWDQRQSEQVEKNKINNRASEEAFVKESKEETPGTEWEKVAQL 753
           SKVTEQEWREKAKKDLEEW+QRQSEQVEKNKINNRASEEAFVKESKEETPGTEWEKVAQL
Sbjct: 121 SKVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNRASEEAFVKESKEETPGTEWEKVAQL 180

Query: 754 CDFNPKSSKQCKDVSRLRSVLMSLKQTPLSR 846
           CDFNPKSSKQCKDVSRLRSVLMSLKQTPLSR
Sbjct: 181 CDFNPKSSKQCKDVSRLRSVLMSLKQTPLSR 211


>ref|NP_009028.1| clathrin, light polypeptide isoform b [Homo sapiens]
          Length = 229

 Score =  344 bits (882), Expect = 9e-95
 Identities = 182/229 (79%), Positives = 184/229 (80%), Gaps = 19/229 (8%)
 Frame = +1

Query: 217 MADDXXXXXXXXXXXXXXXXXXXXXXFLAQQESEIAGIENDEGFGAPAGSQAALAQPGPA 396
           MADD                      FLAQQESEIAGIENDEGFGAPAGS AA AQPGP 
Sbjct: 1   MADDFGFFSSSESGAPEAAEEDPAAAFLAQQESEIAGIENDEGFGAPAGSHAAPAQPGPT 60

Query: 397 SG-GPEDMGTTVNGDVFQDANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAA 573
           SG G EDMGTTVNGDVFQ+ANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAA
Sbjct: 61  SGAGSEDMGTTVNGDVFQEANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAA 120

Query: 574 SKVTEQEWREKAKKDLEEWDQRQSEQVEKNKINNR------------------ASEEAFV 699
           SKVTEQEWREKAKKDLEEW+QRQSEQVEKNKINNR                  ASEEAFV
Sbjct: 121 SKVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNRIADKAFYQQPDADIIGYVASEEAFV 180

Query: 700 KESKEETPGTEWEKVAQLCDFNPKSSKQCKDVSRLRSVLMSLKQTPLSR 846
           KESKEETPGTEWEKVAQLCDFNPKSSKQCKDVSRLRSVLMSLKQTPLSR
Sbjct: 181 KESKEETPGTEWEKVAQLCDFNPKSSKQCKDVSRLRSVLMSLKQTPLSR 229


>ref|NP_001824.1| clathrin, light polypeptide A isoform a [Homo sapiens]
          Length = 218

 Score =  236 bits (603), Expect = 2e-62
 Identities = 116/182 (63%), Positives = 138/182 (75%)
 Frame = +1

Query: 295 FLAQQESEIAGIENDEGFGAPAGSQAALAQPGPASGGPEDMGTTVNGDVFQDANGPADGY 474
           FLAQQESEIAGIENDE F    G        G   GGP+ +   +NG+ +Q++NGP D Y
Sbjct: 35  FLAQQESEIAGIENDEAFAILDGGAPGPQPHGEPPGGPDAVDGVMNGEYYQESNGPTDSY 94

Query: 475 AAIAQADRLTQEPESIRKWREEQRKRLQELDAASKVTEQEWREKAKKDLEEWDQRQSEQV 654
           AAI+Q DRL  EPESIRKWREEQ +RL+ LDA S+  E EW+EKA K+LEEW  RQ EQ+
Sbjct: 95  AAISQVDRLQSEPESIRKWREEQMERLEALDANSRKQEAEWKEKAIKELEEWYARQDEQL 154

Query: 655 EKNKINNRASEEAFVKESKEETPGTEWEKVAQLCDFNPKSSKQCKDVSRLRSVLMSLKQT 834
           +K K NNRA+EEAFV +  E +PGTEWE+VA+LCDFNPKSSKQ KDVSR+RSVL+SLKQ 
Sbjct: 155 QKTKANNRAAEEAFVNDIDESSPGTEWERVARLCDFNPKSSKQAKDVSRMRSVLISLKQA 214

Query: 835 PL 840
           PL
Sbjct: 215 PL 216


>ref|NP_009027.1| clathrin, light polypeptide A isoform b [Homo sapiens]
          Length = 248

 Score =  221 bits (562), Expect = 1e-57
 Identities = 116/212 (54%), Positives = 138/212 (65%), Gaps = 30/212 (14%)
 Frame = +1

Query: 295 FLAQQESEIAGIENDEGFGAPAGSQAALAQPGPASGGPEDMGTTVNGDVFQDANGPADGY 474
           FLAQQESEIAGIENDE F    G        G   GGP+ +   +NG+ +Q++NGP D Y
Sbjct: 35  FLAQQESEIAGIENDEAFAILDGGAPGPQPHGEPPGGPDAVDGVMNGEYYQESNGPTDSY 94

Query: 475 AAIAQADRLTQEPESIRKWREEQRKRLQELDAASKVTEQEWREKAKKDLEEWDQRQSEQV 654
           AAI+Q DRL  EPESIRKWREEQ +RL+ LDA S+  E EW+EKA K+LEEW  RQ EQ+
Sbjct: 95  AAISQVDRLQSEPESIRKWREEQMERLEALDANSRKQEAEWKEKAIKELEEWYARQDEQL 154

Query: 655 EKNKINNR------------------------------ASEEAFVKESKEETPGTEWEKV 744
           +K K NNR                              A+EEAFV +  E +PGTEWE+V
Sbjct: 155 QKTKANNRVADEAFYKQPFADVIGYVTNINHPCYSLEQAAEEAFVNDIDESSPGTEWERV 214

Query: 745 AQLCDFNPKSSKQCKDVSRLRSVLMSLKQTPL 840
           A+LCDFNPKSSKQ KDVSR+RSVL+SLKQ PL
Sbjct: 215 ARLCDFNPKSSKQAKDVSRMRSVLISLKQAPL 246


  Database: RefSeqHP
    Posted date:  Aug 2, 2006 12:57 AM
  Number of letters in database: 17,774,539
  Number of sequences in database:  39,411
  
Lambda     K      H
   0.317    0.131    0.400 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 43,993,490
Number of Sequences: 39411
Number of extensions: 1267822
Number of successful extensions: 9639
Number of sequences better than 1.0e-05: 4
Number of HSP's better than  0.0 without gapping: 6025
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 9405
length of database: 17,774,539
effective HSP length: 104
effective length of database: 13,675,795
effective search space used: 3774519420
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqMP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= LNG01_0056_E06
         (1142 letters)

Database: RefSeqMP 
           45,328 sequences; 21,768,885 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_083146.1| clathrin, light polypeptide (Lcb) [Mus musculus]     344   1e-94
Alignment   gi|NP_058040.1| clathrin, light polypeptide (Lca) [Mus musculus]     218   9e-57

>ref|NP_083146.1| clathrin, light polypeptide (Lcb) [Mus musculus]
          Length = 211

 Score =  344 bits (882), Expect = 1e-94
 Identities = 177/211 (83%), Positives = 181/211 (85%), Gaps = 1/211 (0%)
 Frame = +1

Query: 217 MADDXXXXXXXXXXXXXXXXXXXXXXFLAQQESEIAGIENDEGFGAPAGSQAALAQPGPA 396
           MA+D                      FLAQQESEIAGIEND GFGAPA SQ A AQPG A
Sbjct: 1   MAEDFGFFSSSESGAPEAAEEDPAAAFLAQQESEIAGIENDPGFGAPAASQVASAQPGLA 60

Query: 397 SG-GPEDMGTTVNGDVFQDANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAA 573
           SG G EDM TTVNGDVFQ+ANGPADGYAAIAQADRLTQEPESIRKWREEQ+KRLQELDAA
Sbjct: 61  SGAGSEDMSTTVNGDVFQEANGPADGYAAIAQADRLTQEPESIRKWREEQKKRLQELDAA 120

Query: 574 SKVTEQEWREKAKKDLEEWDQRQSEQVEKNKINNRASEEAFVKESKEETPGTEWEKVAQL 753
           SKVTEQEWREKAKKDLEEW+QRQSEQVEKNKINNRASEEAFVKESKEETPGTEWEKVAQL
Sbjct: 121 SKVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNRASEEAFVKESKEETPGTEWEKVAQL 180

Query: 754 CDFNPKSSKQCKDVSRLRSVLMSLKQTPLSR 846
           CDFNPKSSKQCKDVSRLRSVLMSLKQTPLSR
Sbjct: 181 CDFNPKSSKQCKDVSRLRSVLMSLKQTPLSR 211


>ref|NP_058040.1| clathrin, light polypeptide (Lca) [Mus musculus]
          Length = 235

 Score =  218 bits (555), Expect = 9e-57
 Identities = 114/200 (57%), Positives = 137/200 (68%), Gaps = 18/200 (9%)
 Frame = +1

Query: 295 FLAQQESEIAGIENDEGFGAPAGSQAALAQPGPASGGPEDMGTTVNGDVFQDANGPADGY 474
           FLA +ESEIAGIENDE F    G     A    A GGP+ +   +NG+ +Q++NGP D Y
Sbjct: 35  FLAHEESEIAGIENDEAFAILDGGAPGRATRR-AGGGPDAVDGVMNGEYYQESNGPTDSY 93

Query: 475 AAIAQADRLTQEPESIRKWREEQRKRLQELDAASKVTEQEWREKAKKDLEEWDQRQSEQV 654
           AAI++ DRL  EPESIRKWREEQ +RL+ LDA S+  E EW+EKA K+LEEW  RQ EQ+
Sbjct: 94  AAISEVDRLQSEPESIRKWREEQTERLEALDANSRKQEAEWKEKAIKELEEWYARQDEQL 153

Query: 655 EKNKINNRASEEAFVKES------------------KEETPGTEWEKVAQLCDFNPKSSK 780
           +K K NNRA+EEAF K+                    E +PGTEWE+VA LCDFNPKSSK
Sbjct: 154 QKTKANNRAAEEAFYKQPFADVIGYVAAEEAFVNDIDESSPGTEWERVAPLCDFNPKSSK 213

Query: 781 QCKDVSRLRSVLMSLKQTPL 840
           Q KDVSR+RSVL+SLKQ PL
Sbjct: 214 QAKDVSRMRSVLISLKQAPL 233


  Database: RefSeqMP
    Posted date:  Aug 2, 2006 12:58 AM
  Number of letters in database: 21,768,885
  Number of sequences in database:  45,328
  
Lambda     K      H
   0.317    0.131    0.400 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 50,909,606
Number of Sequences: 45328
Number of extensions: 1380125
Number of successful extensions: 11425
Number of sequences better than 1.0e-05: 2
Number of HSP's better than  0.0 without gapping: 6633
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 10184
length of database: 21,768,885
effective HSP length: 105
effective length of database: 17,009,445
effective search space used: 4677597375
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)