Animal-Genome cDNA LVR01_0018_H02


Search to RefSeqBP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= LVR01_0018_H02
         (2320 letters)

Database: RefSeqBP 
           33,508 sequences; 16,112,626 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|XP_876208.1| PREDICTED: similar to WW domain-containing oxid...   339   6e-93
Alignment   gi|XP_876224.1| PREDICTED: similar to WW domain-containing oxid...   269   8e-72
Alignment   gi|NP_899207.1| double substrate-specificity short chain dehydr...   197   4e-50
Alignment   gi|XP_582319.2| PREDICTED: similar to retinol dehydrogenase 14 ...   178   1e-44
Alignment   gi|XP_584642.2| PREDICTED: similar to retinol dehydrogenase 11 ...   158   2e-38
Alignment   gi|XP_870721.1| PREDICTED: similar to Retinol dehydrogenase 11 ...   153   5e-37
Alignment   gi|XP_592820.2| PREDICTED: similar to retinol dehydrogenase 11 ...   152   1e-36
Alignment   gi|XP_582373.2| PREDICTED: similar to Retinol dehydrogenase 11 ...   151   2e-36
Alignment   gi|XP_591168.2| PREDICTED: similar to dehydrogenase/reductase (...   117   3e-26
Alignment   gi|XP_584810.2| PREDICTED: similar to retinol dehydrogenase 13 ...    95   3e-19

>ref|XP_876208.1| PREDICTED: similar to WW domain-containing oxidoreductase isoform 1
            [Bos taurus]
          Length = 745

 Score =  339 bits (869), Expect = 6e-93
 Identities = 164/180 (91%), Positives = 169/180 (93%)
 Frame = +1

Query: 646  HKAKVEAMTLDLAVLRSVQHFAQAFKAKNVLLHVLVCNAAVFALPWSLTKDGLETTFQVN 825
            HKAKVEAMTLDLA+LRSVQHFAQAFKAKNV LHVLVCNAAVF LPW+LTKDGLETTFQVN
Sbjct: 4    HKAKVEAMTLDLALLRSVQHFAQAFKAKNVSLHVLVCNAAVFGLPWTLTKDGLETTFQVN 63

Query: 826  HLGHFYLVQLLQDVLCRSAPARXXXXXXXXHRFTDINDSSGKLDFSRLSPSHSDYWAMLA 1005
            HLGHFYLVQLLQDVLCRSAPAR        HRFTDINDSSGKLDFSRLSPS +DYWAMLA
Sbjct: 64   HLGHFYLVQLLQDVLCRSAPARVVVVSSESHRFTDINDSSGKLDFSRLSPSKNDYWAMLA 123

Query: 1006 YNRSKLCNILFSNELHRRLSPRGVTSNAVHPGNMMFSSLHRGWWVYTLLFTLARPFTKSM 1185
            YNRSKLCNILFSNELHRRLSPRGVTSNAVHPGNMM+S+LHRGWWVYTLLFTLARPFTKSM
Sbjct: 124  YNRSKLCNILFSNELHRRLSPRGVTSNAVHPGNMMYSALHRGWWVYTLLFTLARPFTKSM 183


>ref|XP_876224.1| PREDICTED: similar to WW domain-containing oxidoreductase isoform 3
           [Bos taurus]
          Length = 318

 Score =  269 bits (687), Expect = 8e-72
 Identities = 125/129 (96%), Positives = 126/129 (97%)
 Frame = +1

Query: 154 LDDTDSEDELPPGWEQRTTKDGWVYYANHTEEKTQWEHPKTGKRKRIAGDLPYGWEQETD 333
           LDDTDSEDELPPGWEQRTTKDGWVYYANHTEEKTQWEHPKTGKRKRIAGDLPYGWEQETD
Sbjct: 9   LDDTDSEDELPPGWEQRTTKDGWVYYANHTEEKTQWEHPKTGKRKRIAGDLPYGWEQETD 68

Query: 334 EKGQVFFVDHINKRTTYLDPRLAFTVDENPTKPTTRQRYDSSTTAMEILQGRDFSGKVVV 513
           E GQVFFVDHINKRTTYLDPRLAFTVD+NPTKPTTRQRYD STTAMEILQGRD SGKVVV
Sbjct: 69  ENGQVFFVDHINKRTTYLDPRLAFTVDDNPTKPTTRQRYDGSTTAMEILQGRDLSGKVVV 128

Query: 514 VTGANSGIG 540
           VTGANSGIG
Sbjct: 129 VTGANSGIG 137


>ref|NP_899207.1| double substrate-specificity short chain dehydrogenase/reductase 2
            [Bos taurus]
          Length = 316

 Score =  197 bits (500), Expect = 4e-50
 Identities = 118/282 (41%), Positives = 160/282 (56%)
 Frame = +1

Query: 499  GKVVVVTGANSGIGFEAAKSFALHGAHVILACRNMTRANEAVSRILGEWHKAKVEAMTLD 678
            GKVVV+TGAN+GIG E A+  A  GA V +ACR++ +   A S I  +   ++V    LD
Sbjct: 39   GKVVVITGANTGIGKETARELARRGARVYIACRDVLKGESAASEIQADTKNSQVLVRKLD 98

Query: 679  LAVLRSVQHFAQAFKAKNVLLHVLVCNAAVFALPWSLTKDGLETTFQVNHLGHFYLVQLL 858
            L+  +S++ FA+ F A+   LH+L+ NA V   P+S T DG ET   VNHLGHF L  LL
Sbjct: 99   LSDTKSIRAFAEGFLAEEKQLHILINNAGVMLCPYSKTADGFETHLAVNHLGHFLLTHLL 158

Query: 859  QDVLCRSAPARXXXXXXXXHRFTDINDSSGKLDFSRLSPSHSDYWAMLAYNRSKLCNILF 1038
               L  SAPAR        H         GK+ F  L      Y    AY  SKL N+LF
Sbjct: 159  LGRLKESAPARVVNLSSVAHHL-------GKIRFHDLQ-GDKYYNLGFAYCHSKLANVLF 210

Query: 1039 SNELHRRLSPRGVTSNAVHPGNMMFSSLHRGWWVYTLLFTLARPFTKSMQQGAATTVYCA 1218
            + EL +RL   GVT+ AVHPG ++ S L R  ++  LL+ L  PF K+  +GA T+++CA
Sbjct: 211  TRELAKRLKGTGVTTYAVHPG-IVRSKLVRHSFLLCLLWRLFSPFLKTTWEGAQTSLHCA 269

Query: 1219 AAPELEGLGGMYFNNCCRCMPSTEAQSEETARALWALSERLI 1344
             A  LE L G YF++C +   S  A++ +TA  LW +S  L+
Sbjct: 270  LAEGLEPLSGKYFSDCKKTWVSPRARNNKTAERLWNVSCELL 311


>ref|XP_582319.2| PREDICTED: similar to retinol dehydrogenase 14 (all-trans and 9-cis)
            [Bos taurus]
          Length = 420

 Score =  178 bits (452), Expect = 1e-44
 Identities = 118/314 (37%), Positives = 160/314 (50%), Gaps = 19/314 (6%)
 Frame = +1

Query: 460  TTAMEILQGRD---FSGKVVVVTGANSGIGFEAAKSFALHGAHVILACRNMTRANEAVSR 630
            ++   + QGRD     GK V++TGANSG+G   A      GA VI+ CR+  RA EA  +
Sbjct: 111  SSVQRLHQGRDSGLMRGKTVLITGANSGLGRATAAELLRLGARVIMGCRDRERAEEAAGQ 170

Query: 631  ILGEWHKA-------------KVEAMTLDLAVLRSVQHFAQAFKAKNVLLHVLVCNAAVF 771
            +  E   A             ++    LDLA L SV+ F Q    +   L VL+ NA VF
Sbjct: 171  LRREVCPAGGPDSGPNSGGAGELVVKELDLASLSSVRSFCQEMLQEEPRLDVLINNAGVF 230

Query: 772  ALPWSLTKDGLETTFQVNHLGHFYLVQLLQDVLCRSAPARXXXXXXXXHRFTDINDSSGK 951
              P+  T+DG E  F VNHLGHF L  LL  +L  SAP+R        +++ DIN     
Sbjct: 231  QCPYMKTEDGFEMQFGVNHLGHFLLTNLLLGLLKSSAPSRIVVVSSKLYKYGDIN----- 285

Query: 952  LDFSRLSPSHSDYWAMLAYNRSKLCNILFSNELHRRLSPRGVTSNAVHPG---NMMFSSL 1122
              F  L+ S   Y     Y+RSKL NILF+ EL RRL    VT N +HPG     +   +
Sbjct: 286  --FEDLN-SEQSYNKSFCYSRSKLANILFTRELARRLEGTSVTVNVLHPGIVRTNLGRHI 342

Query: 1123 HRGWWVYTLLFTLARPFTKSMQQGAATTVYCAAAPELEGLGGMYFNNCCRCMPSTEAQSE 1302
            H    V  L   ++  F K+ ++GA T VY A++PE+EG+ G YF +C       +A  E
Sbjct: 343  HIPLLVRPLFNLVSWAFFKTPEEGAQTAVYLASSPEVEGVSGRYFGDCKEEELLPKAMDE 402

Query: 1303 ETARALWALSERLI 1344
              AR LW +SE ++
Sbjct: 403  SVARKLWDISEVMV 416


>ref|XP_584642.2| PREDICTED: similar to retinol dehydrogenase 11 (predicted) [Bos
            taurus]
          Length = 330

 Score =  158 bits (399), Expect = 2e-38
 Identities = 102/285 (35%), Positives = 145/285 (50%), Gaps = 1/285 (0%)
 Frame = +1

Query: 490  DFSGKVVVVTGANSGIGFEAAKSFALHGAHVILACRNMTRANEAVSRILGEWHKAKVEAM 669
            D +GK  VVTGANSGIG   ++  A  GA VILACR+  R  +A++ I       ++   
Sbjct: 46   DLTGKTAVVTGANSGIGKAVSQELAHRGARVILACRSRERGQQALAEIQATSKSNRLLLG 105

Query: 670  TLDLAVLRSVQHFAQAFKAKNVLLHVLVCNAAVFALPWSLTKDGLETTFQVNHLGHFYLV 849
             +DL+ + S++ FAQ    +   +H+LV NAAV   P +LT +GL+ TF  N+ G F L 
Sbjct: 106  EVDLSSMASIRSFAQRLLQECPEIHLLVNNAAVCGFPTTLTPEGLDLTFATNYTGPFLLT 165

Query: 850  QLLQDVLCRSAPARXXXXXXXXHRFTDINDSSGKLDFSRLSPSHSDYWAMLAYNRSKLCN 1029
             LLQ  L R+  AR           +    S G +D   L  +         Y+ SKL  
Sbjct: 166  NLLQGALQRAGSARVV-------NVSSFRQSHGYIDEDHLIGAGRPLTFNQNYDCSKLLL 218

Query: 1030 ILFSNELHRRLSPRGVTSNAVHPGNMMFSSLHRGWWVYTLLFTLARPFTKSMQQGAATTV 1209
              F+ +L +RL   GVT N+V PG +    +    W Y  LF L   F K  +QGA   +
Sbjct: 219  ASFTGKLAQRLQGTGVTVNSVDPGVVYTKIMKHFSWSYRFLFWLLSFFFKDSKQGAVPVL 278

Query: 1210 YCAAAPELEGLGGMYF-NNCCRCMPSTEAQSEETARALWALSERL 1341
            Y + A EL+G+ G +F ++C   +P   AQ    A++LW  S RL
Sbjct: 279  YLSLAKELDGISGKHFSSSCVITLPPEAAQDPHVAQSLWNTSVRL 323


>ref|XP_870721.1| PREDICTED: similar to Retinol dehydrogenase 11 (Retinal reductase 1)
            (RalR1) (Prostate short-chain dehydrogenase/reductase 1)
            (Androgen-regulated short-chain dehydrogenase/reductase
            1) (HCV core-binding protein HCBP12) isoform 2 [Bos
            taurus]
          Length = 314

 Score =  153 bits (387), Expect = 5e-37
 Identities = 103/284 (36%), Positives = 143/284 (50%), Gaps = 6/284 (2%)
 Frame = +1

Query: 499  GKVVVVTGANSGIGFEAAKSFALHGAHVILACRNMTRANEAVSRILGEWHKAKVEAMTLD 678
            GKV VVTGAN+GIG E AK  A  GA V LACR++         I       +V    LD
Sbjct: 15   GKVAVVTGANAGIGKETAKELARRGARVYLACRDVQNGELVAREIQMMTGNQQVLVRKLD 74

Query: 679  LAVLRSVQHFAQAFKAKNVLLHVLVCNAAVFALPWSLTKDGLETTFQVNHLGHFYLVQLL 858
            LA  +S++ FA+ F   +  +H++  +       +  +  G ++     +LGHF L  LL
Sbjct: 75   LADTKSIRAFAKRFLEDHKYIHLINSSPHFLICGFPGSSAGKDSACNTGYLGHFLLTHLL 134

Query: 859  QDVLCRSAPARXXXXXXXXHRFTDINDSSGKLDFSRLSPSHSDYWAMLAYNRSKLCNILF 1038
             + L  SAP+R        H         G++ F  L      Y + LAY  SKL NILF
Sbjct: 135  LEKLEESAPSRVVNVSSLAHLL-------GRIHFHNLQ-GEKFYQSGLAYCHSKLANILF 186

Query: 1039 SNELHRRLSPRGVTSNAVHPGN-----MMFSSLHRG-WWVYTLLFTLARPFTKSMQQGAA 1200
            + EL RRL   GVT  +VHPG      +  S+L R  WW+++        F K+ QQGA 
Sbjct: 187  TQELARRLKGSGVTVYSVHPGTVNSELVRHSALMRWIWWIFSF-------FIKTPQQGAQ 239

Query: 1201 TTVYCAAAPELEGLGGMYFNNCCRCMPSTEAQSEETARALWALS 1332
            T++YCA    LE L G +F++C     S +A++E  AR LW +S
Sbjct: 240  TSLYCALTEGLEVLSGNHFSDCHVAWVSAQARNETVARRLWDVS 283


>ref|XP_592820.2| PREDICTED: similar to retinol dehydrogenase 11 (predicted) [Bos
            taurus]
          Length = 377

 Score =  152 bits (383), Expect = 1e-36
 Identities = 107/284 (37%), Positives = 138/284 (48%), Gaps = 3/284 (1%)
 Frame = +1

Query: 499  GKVVVVTGANSGIGFEAAKSFALHGAHVILACRNMTRANEAVSRILGEWHKAKVEAMTLD 678
            G+  VVTGANSGIG   A   A  GA V+LACR+  R   A   +  E    +V  M LD
Sbjct: 36   GRTAVVTGANSGIGKMTALELARRGARVVLACRSRERGEAAAFDLRQESGNNEVIFMALD 95

Query: 679  LAVLRSVQHFAQAFKAKNVLLHVLVCNAAVFALPWSLTKDGLETTFQVNHLGHFYLVQLL 858
            LA L SV+ FA AF +    L +L+ NA + +     T++      +VNH+G F L  LL
Sbjct: 96   LASLASVRAFATAFLSSEPRLDILIHNAGISSC--GRTREPFNLLLRVNHIGPFLLTHLL 153

Query: 859  QDVLCRSAPARXXXXXXXXHRFTDINDSSGKLDFSRLS-PSHSDYWAMLAYNRSKLCNIL 1035
               L  SAP+R        HR        G+LDF+RL  P       + AY  SKL N+L
Sbjct: 154  LPRLKTSAPSRVVVVSSAAHR-------RGRLDFTRLDHPVVGWQQELRAYANSKLANVL 206

Query: 1036 FSNELHRRLSPRGVTSNAVHPG--NMMFSSLHRGWWVYTLLFTLARPFTKSMQQGAATTV 1209
            F+ EL  +L   GVT  A HPG  N      H   W+  LL  LA    ++ + GA T +
Sbjct: 207  FARELATQLEGTGVTCYAAHPGPVNSELFLRHVPGWLRPLLRPLAWLVLRAPRGGAQTPL 266

Query: 1210 YCAAAPELEGLGGMYFNNCCRCMPSTEAQSEETARALWALSERL 1341
            YCA    +E L G YF NC        A+ +  A  LW  S +L
Sbjct: 267  YCALQEGIEPLSGRYFANCHVEEVPPAARDDRAAHRLWEASRKL 310


>ref|XP_582373.2| PREDICTED: similar to Retinol dehydrogenase 11 (Retinal reductase 1)
            (RalR1) (Prostate short-chain dehydrogenase/reductase 1)
            (Androgen-regulated short-chain dehydrogenase/reductase
            1) (HCV core-binding protein HCBP12) isoform 1 [Bos
            taurus]
          Length = 308

 Score =  151 bits (381), Expect = 2e-36
 Identities = 107/284 (37%), Positives = 145/284 (51%), Gaps = 6/284 (2%)
 Frame = +1

Query: 499  GKVVVVTGANSGIGFEAAKSFALHGAHVILACRNMTRANEAVSRILGEWHKAKVEAMTLD 678
            GKV VVTGAN+GIG E AK  A  GA V LACR++         I       +V    LD
Sbjct: 15   GKVAVVTGANAGIGKETAKELARRGARVYLACRDVQNGELVAREIQMMTGNQQVLVRKLD 74

Query: 679  LAVLRSVQHFAQAFKAKNVLLHVLVCNAAVFALPWSLTKDGLETTFQVNHLGHFYLVQLL 858
            LA  +S++ FA+ F   +  +H++  N+  F  P S    G ++     +LGHF L  LL
Sbjct: 75   LADTKSIRAFAKRFLEDHKYIHLI--NSVGF--PGS--SAGKDSACNTGYLGHFLLTHLL 128

Query: 859  QDVLCRSAPARXXXXXXXXHRFTDINDSSGKLDFSRLSPSHSDYWAMLAYNRSKLCNILF 1038
             + L  SAP+R        H         G++ F  L      Y + LAY  SKL NILF
Sbjct: 129  LEKLEESAPSRVVNVSSLAHLL-------GRIHFHNLQ-GEKFYQSGLAYCHSKLANILF 180

Query: 1039 SNELHRRLSPRGVTSNAVHPGN-----MMFSSLHRG-WWVYTLLFTLARPFTKSMQQGAA 1200
            + EL RRL   GVT  +VHPG      +  S+L R  WW+++        F K+ QQGA 
Sbjct: 181  TQELARRLKGSGVTVYSVHPGTVNSELVRHSALMRWIWWIFSF-------FIKTPQQGAQ 233

Query: 1201 TTVYCAAAPELEGLGGMYFNNCCRCMPSTEAQSEETARALWALS 1332
            T++YCA    LE L G +F++C     S +A++E  AR LW +S
Sbjct: 234  TSLYCALTEGLEVLSGNHFSDCHVAWVSAQARNETVARRLWDVS 277


>ref|XP_591168.2| PREDICTED: similar to dehydrogenase/reductase (SDR family) X-linked
            [Bos taurus]
          Length = 251

 Score =  117 bits (294), Expect = 3e-26
 Identities = 91/247 (36%), Positives = 120/247 (48%), Gaps = 19/247 (7%)
 Frame = +1

Query: 658  VEAMTLDLAVLRSVQHFAQAFKAKNVLLHVLVCNAAVFALPWSLTKDGLETTFQVNHLGH 837
            +E +  DLA +RS++ F Q FK K + LHVLV NA V  +P   T+DG E  F VN+LGH
Sbjct: 5    MEFLYCDLASMRSIREFVQTFKMKKLPLHVLVNNAGVMMVPQRTTEDGFEEHFGVNYLGH 64

Query: 838  FYLVQLLQDVLCRS-AP---ARXXXXXXXXHRFTDINDSSGKLDFSRLSPSHSDYWAMLA 1005
            F L  LL D L  S AP   AR        H   ++N     LD  +   S + Y A  A
Sbjct: 65   FLLTNLLLDTLQESGAPGHSARVVTVSSATHYVGELN-----LDDLQ---SSTYYSAHAA 116

Query: 1006 YNRSKLCNILFSNELHRRLSPRG--VTSNAVHPGNMMFSSLHR-------------GWWV 1140
            Y +SKL  +LF+  L   L+ +G  VT++   PG ++ + L+R             GWWV
Sbjct: 117  YAQSKLALVLFTYHLQALLTAQGMPVTASVADPG-VVDTDLYRYVFWGTRLVKKLLGWWV 175

Query: 1141 YTLLFTLARPFTKSMQQGAATTVYCAAAPELEGLGGMYFNNCCRCMPSTEAQSEETARAL 1320
            +           K+  +GA T+VY A  P LEGLGG Y  N             E  R L
Sbjct: 176  F-----------KTPDEGAWTSVYAAVTPALEGLGGRYLYNEKETRSLEATYDPELQRQL 224

Query: 1321 WALSERL 1341
            WA S +L
Sbjct: 225  WARSCQL 231


>ref|XP_584810.2| PREDICTED: similar to retinol dehydrogenase 13 (all-trans and 9-cis)
            [Bos taurus]
          Length = 223

 Score = 94.7 bits (234), Expect = 3e-19
 Identities = 68/177 (38%), Positives = 90/177 (50%), Gaps = 6/177 (3%)
 Frame = +1

Query: 832  GHFYLVQLLQDVLCRSAPARXXXXXXXXHRFTDINDSSGKLDFSRLSPSHSDYWAMLAYN 1011
            GHF L  LL D L  SAP+R        H        +G +DF  L+     Y    AY 
Sbjct: 37   GHFLLTNLLLDKLKASAPSRIINVSSLAH-------VAGHIDFEDLNWEKRKYDTKAAYC 89

Query: 1012 RSKLCNILFSNELHRRLSPRGVTSNAVHPGNMMFSSLHRGWWVYTLLF---TLARPF--- 1173
            +SKL  ++ + EL RRL   GVT NA+HPG +  + L R   +++  F   TL   F   
Sbjct: 90   QSKLAVVVSTKELSRRLQGTGVTVNALHPG-VARTELGRHTGMHSSAFSSFTLGPIFWLL 148

Query: 1174 TKSMQQGAATTVYCAAAPELEGLGGMYFNNCCRCMPSTEAQSEETARALWALSERLI 1344
             KS +  A  +VY A A ELEG+ G YF+      P+ EA+ EE A+ LWA S RL+
Sbjct: 149  VKSPELAAQPSVYLAVAEELEGVSGKYFDVLKEKPPAPEAEDEEVAKRLWAESVRLV 205


  Database: RefSeqBP
    Posted date:  Aug 1, 2006  7:14 PM
  Number of letters in database: 16,112,626
  Number of sequences in database:  33,508
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 81,487,283
Number of Sequences: 33508
Number of extensions: 2215729
Number of successful extensions: 7794
Number of sequences better than 1.0e-05: 10
Number of HSP's better than  0.0 without gapping: 6098
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7715
length of database: 16,112,626
effective HSP length: 109
effective length of database: 12,460,254
effective search space used: 8261148402
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqCP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= LVR01_0018_H02
         (2320 letters)

Database: RefSeqCP 
           33,732 sequences; 19,266,565 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|XP_852623.1| PREDICTED: similar to WW domain-containing oxid...   667   0.0  
Alignment   gi|XP_547866.2| PREDICTED: similar to retinol dehydrogenase 12 ...   200   4e-51
Alignment   gi|XP_854127.1| PREDICTED: similar to Retinol dehydrogenase 13 ...   192   2e-48
Alignment   gi|XP_854354.1| PREDICTED: similar to Retinol dehydrogenase 11 ...   182   1e-45
Alignment   gi|XP_540096.2| PREDICTED: similar to retinol dehydrogenase 14 ...   179   1e-44
Alignment   gi|XP_533000.2| PREDICTED: similar to Retinol dehydrogenase 12 ...   164   5e-40
Alignment   gi|XP_852222.1| PREDICTED: similar to dehydrogenase/reductase (...   155   2e-37
Alignment   gi|XP_548293.2| PREDICTED: similar to retinol dehydrogenase 11 ...   149   2e-35
Alignment   gi|XP_857582.1| PREDICTED: similar to retinol dehydrogenase 14 ...   144   5e-34
Alignment   gi|XP_852481.1| PREDICTED: similar to WW domain-containing oxid...   115   2e-25

>ref|XP_852623.1| PREDICTED: similar to WW domain-containing oxidoreductase isoform 1
            [Canis familiaris]
          Length = 383

 Score =  667 bits (1721), Expect = 0.0
 Identities = 324/362 (89%), Positives = 333/362 (91%)
 Frame = +1

Query: 154  LDDTDSEDELPPGWEQRTTKDGWVYYANHTEEKTQWEHPKTGKRKRIAGDLPYGWEQETD 333
            LDDTDSEDELPPGWEQRTTKDGWVYYANH EEKTQWEHPKTGKRKRIAGDLPYGWEQETD
Sbjct: 9    LDDTDSEDELPPGWEQRTTKDGWVYYANHAEEKTQWEHPKTGKRKRIAGDLPYGWEQETD 68

Query: 334  EKGQVFFVDHINKRTTYLDPRLAFTVDENPTKPTTRQRYDSSTTAMEILQGRDFSGKVVV 513
            E GQVFFVDHINKRTTYLDPRLAFTVD+NPTKPT+RQRYD  TTAMEILQGRDF+GKVVV
Sbjct: 69   ENGQVFFVDHINKRTTYLDPRLAFTVDDNPTKPTSRQRYDGGTTAMEILQGRDFTGKVVV 128

Query: 514  VTGANSGIGFEAAKSFALHGAHVILACRNMTRANEAVSRILGEWHKAKVEAMTLDLAVLR 693
            VTGANSGIGFE AKSFALHGAHVILACRNMTRANEAVS+ILGEWHKAKVEAMTLDLA+LR
Sbjct: 129  VTGANSGIGFETAKSFALHGAHVILACRNMTRANEAVSQILGEWHKAKVEAMTLDLALLR 188

Query: 694  SVQHFAQAFKAKNVLLHVLVCNAAVFALPWSLTKDGLETTFQVNHLGHFYLVQLLQDVLC 873
            SVQHFAQAFKAKNV LHVLVCNAA FALPWSLTKDGLETTFQVNHLGHFYLVQLLQDVLC
Sbjct: 189  SVQHFAQAFKAKNVSLHVLVCNAAAFALPWSLTKDGLETTFQVNHLGHFYLVQLLQDVLC 248

Query: 874  RSAPARXXXXXXXXHRFTDINDSSGKLDFSRLSPSHSDYWAMLAYNRSKLCNILFSNELH 1053
            RSAPAR        HRFTDINDSSGKLDFSRLSPS SDYWAMLAYNRSKLCNILFSNELH
Sbjct: 249  RSAPARVVVVSSESHRFTDINDSSGKLDFSRLSPSKSDYWAMLAYNRSKLCNILFSNELH 308

Query: 1054 RRLSPRGVTSNAVHPGNMMFSSLHRGWWVYTLLFTLARPFTKSMQQGAATTVYCAAAPEL 1233
            RRLSPRGVTSNAVHPGNMM+SS+HR WWVYTLLFTLARPFTKSM       V C+    L
Sbjct: 309  RRLSPRGVTSNAVHPGNMMYSSIHRNWWVYTLLFTLARPFTKSM-----LLVSCSDGSGL 363

Query: 1234 EG 1239
            +G
Sbjct: 364  DG 365


>ref|XP_547866.2| PREDICTED: similar to retinol dehydrogenase 12 (all-trans and 9-cis)
            [Canis familiaris]
          Length = 303

 Score =  200 bits (509), Expect = 4e-51
 Identities = 118/282 (41%), Positives = 160/282 (56%)
 Frame = +1

Query: 499  GKVVVVTGANSGIGFEAAKSFALHGAHVILACRNMTRANEAVSRILGEWHKAKVEAMTLD 678
            GKVVV+TGAN+GIG E A+  A  GA V +ACR++ +   A S I  +   ++V    LD
Sbjct: 26   GKVVVITGANTGIGKETARELARRGARVYIACRDVLKGESAASEIRADTKNSQVLVRKLD 85

Query: 679  LAVLRSVQHFAQAFKAKNVLLHVLVCNAAVFALPWSLTKDGLETTFQVNHLGHFYLVQLL 858
            L+  +S++ FA+ F A+   LH+L+ NA V   P+S T DG ET   VNHLGHF L  LL
Sbjct: 86   LSDTKSIRAFAEGFLAEEKQLHILINNAGVMMCPYSKTADGFETHLGVNHLGHFLLTHLL 145

Query: 859  QDVLCRSAPARXXXXXXXXHRFTDINDSSGKLDFSRLSPSHSDYWAMLAYNRSKLCNILF 1038
             + L  S PAR        H         GK+ F  L      Y    AY  SKL N+LF
Sbjct: 146  LERLKESTPARVVNLSSVAHHI-------GKIHFHDLQ-GEKRYSRGFAYCHSKLANMLF 197

Query: 1039 SNELHRRLSPRGVTSNAVHPGNMMFSSLHRGWWVYTLLFTLARPFTKSMQQGAATTVYCA 1218
            + EL +RL   GVT+ AVHPG ++ S L R  ++  LL+ +  PF KS ++GA T+++CA
Sbjct: 198  TRELAKRLQGTGVTTYAVHPG-VVSSELVRHSFLLCLLWRIFSPFVKSAREGAQTSLHCA 256

Query: 1219 AAPELEGLGGMYFNNCCRCMPSTEAQSEETARALWALSERLI 1344
             A  LE L G YF++C R   S  A+  +TA  LW +S  L+
Sbjct: 257  LAEGLEPLSGKYFSDCKRAWVSPRARDNKTAERLWNVSCELL 298


>ref|XP_854127.1| PREDICTED: similar to Retinol dehydrogenase 13 [Canis familiaris]
          Length = 334

 Score =  192 bits (487), Expect = 2e-48
 Identities = 123/288 (42%), Positives = 156/288 (54%), Gaps = 6/288 (2%)
 Frame = +1

Query: 499  GKVVVVTGANSGIGFEAAKSFALHGAHVILACRNMTRANEAVSRILGEWHKAKVEAMTLD 678
            GK V+VTGAN+GIG + A   A  G ++ILACR+M +   A   I GE    +V A  LD
Sbjct: 38   GKTVIVTGANTGIGKQTALELARRGGNIILACRDMEKCEAAAKEIRGETLNHRVSAWHLD 97

Query: 679  LAVLRSVQHFAQAFKAKNVLLHVLVCNAAVFALPWSLTKDGLETTFQVNHLGHFYLVQLL 858
            LA L+S++ FA     +   +H+LV NAAV   P   TKDG E  F VNHLGHF L  LL
Sbjct: 98   LASLKSIREFAAKIIEEEEQVHILVNNAAVMRCPHWTTKDGFEMQFGVNHLGHFLLTNLL 157

Query: 859  QDVLCRSAPARXXXXXXXXHRFTDINDSSGKLDFSRLSPSHSDYWAMLAYNRSKLCNILF 1038
             D L  SAP+R        H        +G +DF  L+     Y    AY +SKL  ILF
Sbjct: 158  LDKLKASAPSRIINLSSLAH-------VAGHIDFDDLNWEKRKYDTKAAYCQSKLAVILF 210

Query: 1039 SNELHRRLSPRGVTSNAVHPGNMMFSSLHRGWWVYTLL---FTLARPF---TKSMQQGAA 1200
            + EL RRL   GVT NA+HPG +  + L R   +++     FTL   F    KS Q  A 
Sbjct: 211  TKELSRRLQGTGVTVNALHPG-VARTELGRHTGMHSSAFSSFTLGPIFWLLVKSPQLAAQ 269

Query: 1201 TTVYCAAAPELEGLGGMYFNNCCRCMPSTEAQSEETARALWALSERLI 1344
             + Y A A ELEG+ G YF+      P+ EA+ EE A+ LWA S RL+
Sbjct: 270  PSTYLAVAEELEGVSGKYFDGLKEKAPAPEAEDEEVAQRLWAESARLV 317


>ref|XP_854354.1| PREDICTED: similar to Retinol dehydrogenase 11 (Retinal reductase 1)
            (RalR1) (Prostate short-chain dehydrogenase/reductase 1)
            (Androgen-regulated short-chain dehydrogenase/reductase
            1) (HCV core-binding protein HCBP12) [Canis familiaris]
          Length = 337

 Score =  182 bits (462), Expect = 1e-45
 Identities = 112/284 (39%), Positives = 150/284 (52%), Gaps = 6/284 (2%)
 Frame = +1

Query: 499  GKVVVVTGANSGIGFEAAKSFALHGAHVILACRNMTRANEAVSRILGEWHKAKVEAMTLD 678
            GKV VVTGAN+GIG E AK  A  GA V LACR++ +       I       +V    LD
Sbjct: 60   GKVAVVTGANTGIGKETAKELAQRGARVYLACRDVLKGELVAREIQTMTGNKQVLVRKLD 119

Query: 679  LAVLRSVQHFAQAFKAKNVLLHVLVCNAAVFALPWSLTKDGLETTFQVNHLGHFYLVQLL 858
            LA  +S++ FA+ F A+   LH+L+ NA V   P++ T DG E    VNHLGHF L  LL
Sbjct: 120  LADTKSIRAFAKGFLAEEKHLHILINNAGVMMCPYTKTVDGFEMHMGVNHLGHFLLTHLL 179

Query: 859  QDVLCRSAPARXXXXXXXXHRFTDINDSSGKLDFSRLSPSHSDYWAMLAYNRSKLCNILF 1038
             + L  SAP+R        H         G++ F  L      Y + LAY  SKL NILF
Sbjct: 180  LEKLKESAPSRIVNVSSLAHHL-------GRIHFHDLQ-GEKFYNSGLAYCHSKLANILF 231

Query: 1039 SNELHRRLSPRGVTSNAVHPGNMMFSSLHRG------WWVYTLLFTLARPFTKSMQQGAA 1200
            + EL RRL   G+T+ +VHPG +    +         WW+++        F K+ QQGA 
Sbjct: 232  TQELARRLKGSGITAYSVHPGTVKSELVRHSPFMKWMWWLFSF-------FIKTPQQGAQ 284

Query: 1201 TTVYCAAAPELEGLGGMYFNNCCRCMPSTEAQSEETARALWALS 1332
            T++YCA    LE L G +F++C     S +A++E  AR LW +S
Sbjct: 285  TSLYCAITEGLEVLSGHHFSDCSVAWVSAQARNETIARRLWDVS 328


>ref|XP_540096.2| PREDICTED: similar to retinol dehydrogenase 14 (all-trans and 9-cis)
            isoform 1 [Canis familiaris]
          Length = 336

 Score =  179 bits (453), Expect = 1e-44
 Identities = 114/298 (38%), Positives = 156/298 (52%), Gaps = 16/298 (5%)
 Frame = +1

Query: 499  GKVVVVTGANSGIGFEAAKSFALHGAHVILACRNMTRANEAVSRILGEWHKA-------- 654
            GK V++TGANSG+G   A +    GA VI+ CR+  RA EA  ++  E  +A        
Sbjct: 43   GKTVLITGANSGLGRATAAALLRLGARVIMGCRDRARAEEAAGQLRRELRQAGGREPGSD 102

Query: 655  -----KVEAMTLDLAVLRSVQHFAQAFKAKNVLLHVLVCNAAVFALPWSLTKDGLETTFQ 819
                 ++    LDLA LRSV+ F Q    +   L VL+ NA +F  P+  T+DG E  F 
Sbjct: 103  VGAAGELVVRELDLASLRSVRAFCQEVLQEEPRLDVLINNAGIFQCPYMKTEDGFEMQFG 162

Query: 820  VNHLGHFYLVQLLQDVLCRSAPARXXXXXXXXHRFTDINDSSGKLDFSRLSPSHSDYWAM 999
            VNHLGHF L  LL  +L  SAP+R        +++ DIN       F  L+ S   Y   
Sbjct: 163  VNHLGHFLLTNLLLGLLKNSAPSRIVVVSSKLYKYGDIN-------FEDLN-SEQSYNKS 214

Query: 1000 LAYNRSKLCNILFSNELHRRLSPRGVTSNAVHPG---NMMFSSLHRGWWVYTLLFTLARP 1170
              Y+RSKL NILF+ EL RRL    VT N +HPG     +   +H    V  L   ++  
Sbjct: 215  FCYSRSKLANILFTRELARRLEGTNVTVNVLHPGIVRTNLGRHIHIPLLVRPLFNLVSWA 274

Query: 1171 FTKSMQQGAATTVYCAAAPELEGLGGMYFNNCCRCMPSTEAQSEETARALWALSERLI 1344
            F K+  +GA T+VY A++PE+EG+ G YF +C       +A  E  AR LW +SE ++
Sbjct: 275  FFKTPVEGAQTSVYLASSPEVEGVSGKYFGDCKEEELLPKAMDESVARKLWDISEVMV 332


>ref|XP_533000.2| PREDICTED: similar to Retinol dehydrogenase 12 [Canis familiaris]
          Length = 596

 Score =  164 bits (414), Expect = 5e-40
 Identities = 103/285 (36%), Positives = 151/285 (52%), Gaps = 1/285 (0%)
 Frame = +1

Query: 490  DFSGKVVVVTGANSGIGFEAAKSFALHGAHVILACRNMTRANEAVSRILGEWHKAKVEAM 669
            D +GK  VVTGANSGIG    +  A  GA VILACRN  R  +A++ I        +   
Sbjct: 312  DLTGKTAVVTGANSGIGKAVCQELARRGARVILACRNWERGQKALAEIQVASKGTCLLLG 371

Query: 670  TLDLAVLRSVQHFAQAFKAKNVLLHVLVCNAAVFALPWSLTKDGLETTFQVNHLGHFYLV 849
             +DL+ + S++ FA+    +   +H+LV NAA+   P +LT +GL+ TF  N++G F L 
Sbjct: 372  QVDLSSMASIRSFARWLLQEYPEIHLLVNNAAISGFPKTLTPEGLDLTFATNYVGPFLLT 431

Query: 850  QLLQDVLCRSAPARXXXXXXXXHRFTDINDSSGKLDFSRLSPSHSDYWAMLAYNRSKLCN 1029
             LLQ  L R+  AR        H       + G +D   L+ +      + +Y+ SKL  
Sbjct: 432  NLLQGALQRAGSARVVNVSSFRH-------AHGYVDEKHLTGAGKPLNLIQSYDCSKLLL 484

Query: 1030 ILFSNELHRRLSPRGVTSNAVHPGNMMFSSLHRGWWVYTLLFTLARPFTKSMQQGAATTV 1209
              F+ EL RRL   GVT N+V PG +    +    W+Y  LF L   F K ++QGA   +
Sbjct: 485  TSFTGELARRLQGTGVTVNSVDPGVVYTEIMKPYPWLYRFLFWLFSFFCKDVKQGAIPVL 544

Query: 1210 YCAAAPELEGLGGMYFNNCCR-CMPSTEAQSEETARALWALSERL 1341
            Y + A EL+G+ G YF++ C   +P+  AQ  + A++LW  S +L
Sbjct: 545  YLSLAKELDGVSGKYFSSSCMITLPTEAAQDPQVAQSLWNASVQL 589


>ref|XP_852222.1| PREDICTED: similar to dehydrogenase/reductase (SDR family) X-linked
            [Canis familiaris]
          Length = 387

 Score =  155 bits (392), Expect = 2e-37
 Identities = 112/284 (39%), Positives = 142/284 (50%), Gaps = 7/284 (2%)
 Frame = +1

Query: 502  KVVVVTGANSGIGFEAAKSFALHGAHVILACRNMTRANEAVSRILGEWHKAKVEAMTLDL 681
            +V +VTG   GIG+  AK  A  G HVILA  N + A + V +I  E    KVE +  DL
Sbjct: 96   RVAIVTGGTDGIGYSTAKHLARLGMHVILAGNNDSSAPDVVRKIQEETLNDKVEFLYCDL 155

Query: 682  AVLRSVQHFAQAFKAKNVLLHVLVCNAAVFALPWSLTKDGLETTFQVNHLGHFYLVQLLQ 861
            A LRS++ F Q FK K + LHVLV NA V  +P   T+DG E  F +N+LGHF L  LL 
Sbjct: 156  ASLRSIRQFVQKFKKKKIPLHVLVNNAGVMMVPERTTEDGFEEHFGLNYLGHFLLTNLLL 215

Query: 862  DVLCRS-AP---ARXXXXXXXXHRFTDINDSSGKLDFSRLSPSHSDYWAMLAYNRSKLCN 1029
            D L  S AP   AR        H         G+LD   L  S   Y    AY +SKL  
Sbjct: 216  DTLKESGAPGRCARVVTVSSATHYI-------GELDMDDLQGSRC-YSPHAAYAQSKLAL 267

Query: 1030 ILFSNELHRRLSPRG--VTSNAVHPGNMMFSSLHRGWWVYTLLFTL-ARPFTKSMQQGAA 1200
            +LF+  L R L+ +G  VT+N V PG +  +     +W   L+  L    F K+  +GA 
Sbjct: 268  VLFTYHLQRLLAAQGSPVTANVVDPGVVNTNLYRHVFWGTRLIKKLFGWWFFKTPDEGAW 327

Query: 1201 TTVYCAAAPELEGLGGMYFNNCCRCMPSTEAQSEETARALWALS 1332
            T+VY A  P+LEGLGG Y  N             +    LWA S
Sbjct: 328  TSVYAAVTPDLEGLGGRYLYNEKETKSLAVTYDLDLQTELWARS 371


>ref|XP_548293.2| PREDICTED: similar to retinol dehydrogenase 11 (predicted) [Canis
            familiaris]
          Length = 377

 Score =  149 bits (375), Expect = 2e-35
 Identities = 107/284 (37%), Positives = 136/284 (47%), Gaps = 3/284 (1%)
 Frame = +1

Query: 499  GKVVVVTGANSGIGFEAAKSFALHGAHVILACRNMTRANEAVSRILGEWHKAKVEAMTLD 678
            G+  VVTGANSGIG   A   A  GA V+LACR+  R   A   +  E    +V  M LD
Sbjct: 36   GRTAVVTGANSGIGKMTALELARRGARVVLACRSRERGEAAAFDLRQESGNNEVIFMALD 95

Query: 679  LAVLRSVQHFAQAFKAKNVLLHVLVCNAAVFALPWSLTKDGLETTFQVNHLGHFYLVQLL 858
            LA L SV+ FA AF +    L +L+ NA + +     T        +VNH+G F L  LL
Sbjct: 96   LASLASVRAFATAFLSSEPRLDILIHNAGISSC--GRTHKPFNLLLRVNHIGPFLLTHLL 153

Query: 859  QDVLCRSAPARXXXXXXXXHRFTDINDSSGKLDFSRLS-PSHSDYWAMLAYNRSKLCNIL 1035
               L   AP+R        HR        G+LDF+RL  P       + AY  SKL N+L
Sbjct: 154  LPRLKTCAPSRVVVVSSAAHR-------RGRLDFTRLDRPVVGWQQELRAYADSKLANVL 206

Query: 1036 FSNELHRRLSPRGVTSNAVHPG--NMMFSSLHRGWWVYTLLFTLARPFTKSMQQGAATTV 1209
            F+ EL  +L   GVT  A HPG  N      H   W+  LL  LA    ++ + GA T +
Sbjct: 207  FARELATQLEGTGVTCYAAHPGPVNSELFLRHVPGWLCPLLRPLAWLMLRAPRGGAQTPL 266

Query: 1210 YCAAAPELEGLGGMYFNNCCRCMPSTEAQSEETARALWALSERL 1341
            YCA    +E L G YF NC        A+ +  A  LW  S+RL
Sbjct: 267  YCALQEGIEPLSGRYFANCHVEEVPPAARDDRAAHQLWEASKRL 310


>ref|XP_857582.1| PREDICTED: similar to retinol dehydrogenase 14 (all-trans and 9-cis)
            isoform 4 [Canis familiaris]
          Length = 307

 Score =  144 bits (362), Expect = 5e-34
 Identities = 103/298 (34%), Positives = 141/298 (47%), Gaps = 16/298 (5%)
 Frame = +1

Query: 499  GKVVVVTGANSGIGFEAAKSFALHGAHVILACRNMTRANEAVSRILGEWHKA-------- 654
            GK V++TGANSG+G   A +    GA VI+ CR+  RA EA  ++  E  +A        
Sbjct: 43   GKTVLITGANSGLGRATAAALLRLGARVIMGCRDRARAEEAAGQLRRELRQAGGREPGSD 102

Query: 655  -----KVEAMTLDLAVLRSVQHFAQAFKAKNVLLHVLVCNAAVFALPWSLTKDGLETTFQ 819
                 ++    LDLA LRSV+ F Q                                 F 
Sbjct: 103  VGAAGELVVRELDLASLRSVRAFCQEV-----------------------------LQFG 133

Query: 820  VNHLGHFYLVQLLQDVLCRSAPARXXXXXXXXHRFTDINDSSGKLDFSRLSPSHSDYWAM 999
            VNHLGHF L  LL  +L  SAP+R        +++ DIN       F  L+ S   Y   
Sbjct: 134  VNHLGHFLLTNLLLGLLKNSAPSRIVVVSSKLYKYGDIN-------FEDLN-SEQSYNKS 185

Query: 1000 LAYNRSKLCNILFSNELHRRLSPRGVTSNAVHPGNMMFS---SLHRGWWVYTLLFTLARP 1170
              Y+RSKL NILF+ EL RRL    VT N +HPG +  +    +H    V  L   ++  
Sbjct: 186  FCYSRSKLANILFTRELARRLEGTNVTVNVLHPGIVRTNLGRHIHIPLLVRPLFNLVSWA 245

Query: 1171 FTKSMQQGAATTVYCAAAPELEGLGGMYFNNCCRCMPSTEAQSEETARALWALSERLI 1344
            F K+  +GA T+VY A++PE+EG+ G YF +C       +A  E  AR LW +SE ++
Sbjct: 246  FFKTPVEGAQTSVYLASSPEVEGVSGKYFGDCKEEELLPKAMDESVARKLWDISEVMV 303


>ref|XP_852481.1| PREDICTED: similar to WW domain-containing oxidoreductase isoform 4
            [Canis familiaris]
          Length = 449

 Score =  115 bits (288), Expect = 2e-25
 Identities = 54/55 (98%), Positives = 54/55 (98%)
 Frame = +1

Query: 1186 QQGAATTVYCAAAPELEGLGGMYFNNCCRCMPSTEAQSEETARALWALSERLIQE 1350
            QQGAATTVYCAAAPELEGLGGMYFNNCCRCMPS EAQSEETARALWALSERLIQE
Sbjct: 388  QQGAATTVYCAAAPELEGLGGMYFNNCCRCMPSAEAQSEETARALWALSERLIQE 442


  Database: RefSeqCP
    Posted date:  Aug 1, 2006  9:25 PM
  Number of letters in database: 19,266,565
  Number of sequences in database:  33,732
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 95,638,805
Number of Sequences: 33732
Number of extensions: 2589165
Number of successful extensions: 8590
Number of sequences better than 1.0e-05: 10
Number of HSP's better than  0.0 without gapping: 6546
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 8468
length of database: 19,266,565
effective HSP length: 111
effective length of database: 15,522,313
effective search space used: 10260248893
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqSP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= LVR01_0018_H02
         (2320 letters)

Database: RefSeqSP 
           1040 sequences; 434,620 total letters

Searching...done

 ***** No hits found ******

  Database: RefSeqSP
    Posted date:  Aug 1, 2006  7:14 PM
  Number of letters in database: 434,620
  Number of sequences in database:  1040
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,183,038
Number of Sequences: 1040
Number of extensions: 57366
Number of successful extensions: 188
Number of sequences better than 1.0e-05: 0
Number of HSP's better than  0.0 without gapping: 156
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 187
length of database: 434,620
effective HSP length: 84
effective length of database: 347,260
effective search space used: 238914880
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqHP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= LVR01_0018_H02
         (2320 letters)

Database: RefSeqHP 
           39,411 sequences; 17,774,539 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_057457.1| WW domain-containing oxidoreductase isoform 1 [...   765   0.0  
Alignment   gi|NP_570607.1| WW domain-containing oxidoreductase isoform 2 [...   330   4e-90
Alignment   gi|NP_689656.1| retinol dehydrogenase 12 (all-trans and 9-cis) ...   199   7e-51
Alignment   gi|NP_057110.2| androgen-regulated short-chain dehydrogenase/re...   185   2e-46
Alignment   gi|NP_065956.1| retinol dehydrogenase 14 (all-trans and 9-cis) ...   177   3e-44
Alignment   gi|NP_660160.1| dehydrogenase/reductase (SDR family) X-linked [...   152   2e-36
Alignment   gi|NP_612421.1| retinol dehydrogenase 13 (all-trans and 9-cis) ...   141   3e-33
Alignment   gi|NP_653284.1| hypothetical protein LOC147015 [Homo sapiens]        129   1e-29
Alignment   gi|XP_371503.3| PREDICTED: similar to short-chain dehydrogenase...    84   7e-16
Alignment   gi|XP_947127.1| PREDICTED: similar to short-chain dehydrogenase...    84   7e-16

>ref|NP_057457.1| WW domain-containing oxidoreductase isoform 1 [Homo sapiens]
          Length = 414

 Score =  765 bits (1975), Expect = 0.0
 Identities = 366/399 (91%), Positives = 378/399 (94%)
 Frame = +1

Query: 154  LDDTDSEDELPPGWEQRTTKDGWVYYANHTEEKTQWEHPKTGKRKRIAGDLPYGWEQETD 333
            LDDTDSEDELPPGWE+RTTKDGWVYYANHTEEKTQWEHPKTGKRKR+AGDLPYGWEQETD
Sbjct: 9    LDDTDSEDELPPGWEERTTKDGWVYYANHTEEKTQWEHPKTGKRKRVAGDLPYGWEQETD 68

Query: 334  EKGQVFFVDHINKRTTYLDPRLAFTVDENPTKPTTRQRYDSSTTAMEILQGRDFSGKVVV 513
            E GQVFFVDHINKRTTYLDPRLAFTVD+NPTKPTTRQRYD STTAMEILQGRDF+GKVVV
Sbjct: 69   ENGQVFFVDHINKRTTYLDPRLAFTVDDNPTKPTTRQRYDGSTTAMEILQGRDFTGKVVV 128

Query: 514  VTGANSGIGFEAAKSFALHGAHVILACRNMTRANEAVSRILGEWHKAKVEAMTLDLAVLR 693
            VTGANSGIGFE AKSFALHGAHVILACRNM RA+EAVSRIL EWHKAKVEAMTLDLA+LR
Sbjct: 129  VTGANSGIGFETAKSFALHGAHVILACRNMARASEAVSRILEEWHKAKVEAMTLDLALLR 188

Query: 694  SVQHFAQAFKAKNVLLHVLVCNAAVFALPWSLTKDGLETTFQVNHLGHFYLVQLLQDVLC 873
            SVQHFA+AFKAKNV LHVLVCNAA FALPWSLTKDGLETTFQVNHLGHFYLVQLLQDVLC
Sbjct: 189  SVQHFAEAFKAKNVPLHVLVCNAATFALPWSLTKDGLETTFQVNHLGHFYLVQLLQDVLC 248

Query: 874  RSAPARXXXXXXXXHRFTDINDSSGKLDFSRLSPSHSDYWAMLAYNRSKLCNILFSNELH 1053
            RSAPAR        HRFTDINDS GKLDFSRLSP+ +DYWAMLAYNRSKLCNILFSNELH
Sbjct: 249  RSAPARVIVVSSESHRFTDINDSLGKLDFSRLSPTKNDYWAMLAYNRSKLCNILFSNELH 308

Query: 1054 RRLSPRGVTSNAVHPGNMMFSSLHRGWWVYTLLFTLARPFTKSMQQGAATTVYCAAAPEL 1233
            RRLSPRGVTSNAVHPGNMM+S++HR WWVYTLLFTLARPFTKSMQQGAATTVYCAA PEL
Sbjct: 309  RRLSPRGVTSNAVHPGNMMYSNIHRSWWVYTLLFTLARPFTKSMQQGAATTVYCAAVPEL 368

Query: 1234 EGLGGMYFNNCCRCMPSTEAQSEETARALWALSERLIQE 1350
            EGLGGMYFNNCCRCMPS EAQSEETAR LWALSERLIQE
Sbjct: 369  EGLGGMYFNNCCRCMPSPEAQSEETARTLWALSERLIQE 407


>ref|NP_570607.1| WW domain-containing oxidoreductase isoform 2 [Homo sapiens]
          Length = 189

 Score =  330 bits (845), Expect = 4e-90
 Identities = 154/164 (93%), Positives = 159/164 (96%)
 Frame = +1

Query: 154 LDDTDSEDELPPGWEQRTTKDGWVYYANHTEEKTQWEHPKTGKRKRIAGDLPYGWEQETD 333
           LDDTDSEDELPPGWE+RTTKDGWVYYANHTEEKTQWEHPKTGKRKR+AGDLPYGWEQETD
Sbjct: 9   LDDTDSEDELPPGWEERTTKDGWVYYANHTEEKTQWEHPKTGKRKRVAGDLPYGWEQETD 68

Query: 334 EKGQVFFVDHINKRTTYLDPRLAFTVDENPTKPTTRQRYDSSTTAMEILQGRDFSGKVVV 513
           E GQVFFVDHINKRTTYLDPRLAFTVD+NPTKPTTRQRYD STTAMEILQGRDF+GKVVV
Sbjct: 69  ENGQVFFVDHINKRTTYLDPRLAFTVDDNPTKPTTRQRYDGSTTAMEILQGRDFTGKVVV 128

Query: 514 VTGANSGIGFEAAKSFALHGAHVILACRNMTRANEAVSRILGEW 645
           VTGANSGIGFE AKSFALHGAHVILACRNM RA+EAVSRIL EW
Sbjct: 129 VTGANSGIGFETAKSFALHGAHVILACRNMARASEAVSRILEEW 172


>ref|NP_689656.1| retinol dehydrogenase 12 (all-trans and 9-cis) [Homo sapiens]
          Length = 316

 Score =  199 bits (507), Expect = 7e-51
 Identities = 120/282 (42%), Positives = 162/282 (57%)
 Frame = +1

Query: 499  GKVVVVTGANSGIGFEAAKSFALHGAHVILACRNMTRANEAVSRILGEWHKAKVEAMTLD 678
            GKVVV+TGAN+GIG E A+  A  GA V +ACR++ +   A S I  +   ++V    LD
Sbjct: 39   GKVVVITGANTGIGKETARELASRGARVYIACRDVLKGESAASEIRVDTKNSQVLVRKLD 98

Query: 679  LAVLRSVQHFAQAFKAKNVLLHVLVCNAAVFALPWSLTKDGLETTFQVNHLGHFYLVQLL 858
            L+  +S++ FA+ F A+   LH+L+ NA V   P+S T DG ET   VNHLGHF L  LL
Sbjct: 99   LSDTKSIRAFAEGFLAEEKQLHILINNAGVMMCPYSKTADGFETHLGVNHLGHFLLTYLL 158

Query: 859  QDVLCRSAPARXXXXXXXXHRFTDINDSSGKLDFSRLSPSHSDYWAMLAYNRSKLCNILF 1038
             + L  SAPAR        H         GK+ F  L  S   Y    AY  SKL N+LF
Sbjct: 159  LEQLKVSAPARVVNVSSVAHHI-------GKIPFHDLQ-SEKRYSRGFAYCHSKLANVLF 210

Query: 1039 SNELHRRLSPRGVTSNAVHPGNMMFSSLHRGWWVYTLLFTLARPFTKSMQQGAATTVYCA 1218
            + EL +RL   GVT+ AVHPG ++ S L R   +  LL+ L  PF K+ ++GA T+++CA
Sbjct: 211  TRELAKRLQGTGVTTYAVHPG-VVRSELVRHSSLLCLLWRLFSPFVKTAREGAQTSLHCA 269

Query: 1219 AAPELEGLGGMYFNNCCRCMPSTEAQSEETARALWALSERLI 1344
             A  LE L G YF++C R   S  A++ +TA  LW +S  L+
Sbjct: 270  LAEGLEPLSGKYFSDCKRTWVSPRARNNKTAERLWNVSCELL 311


>ref|NP_057110.2| androgen-regulated short-chain dehydrogenase/reductase 1 [Homo
            sapiens]
          Length = 318

 Score =  185 bits (469), Expect = 2e-46
 Identities = 115/284 (40%), Positives = 151/284 (53%), Gaps = 6/284 (2%)
 Frame = +1

Query: 499  GKVVVVTGANSGIGFEAAKSFALHGAHVILACRNMTRANEAVSRILGEWHKAKVEAMTLD 678
            GKVVVVTGAN+GIG E AK  A  GA V LACR++ +       I       +V    LD
Sbjct: 41   GKVVVVTGANTGIGKETAKELAQRGARVYLACRDVEKGELVAKEIQTTTGNQQVLVRKLD 100

Query: 679  LAVLRSVQHFAQAFKAKNVLLHVLVCNAAVFALPWSLTKDGLETTFQVNHLGHFYLVQLL 858
            L+  +S++ FA+ F A+   LHVL+ NA V   P+S T DG E    VNHLGHF L  LL
Sbjct: 101  LSDTKSIRAFAKGFLAEEKHLHVLINNAGVMMCPYSKTADGFEMHIGVNHLGHFLLTHLL 160

Query: 859  QDVLCRSAPARXXXXXXXXHRFTDINDSSGKLDFSRLSPSHSDYWAMLAYNRSKLCNILF 1038
             + L  SAP+R        H         G++ F  L      Y A LAY  SKL NILF
Sbjct: 161  LEKLKESAPSRIVNVSSLAHHL-------GRIHFHNLQ-GEKFYNAGLAYCHSKLANILF 212

Query: 1039 SNELHRRLSPRGVTSNAVHPGNMMFSSLHRG------WWVYTLLFTLARPFTKSMQQGAA 1200
            + EL RRL   GVT+ +VHPG +    +         WW+++        F K+ QQGA 
Sbjct: 213  TQELARRLKGSGVTTYSVHPGTVQSELVRHSSFMRWMWWLFSF-------FIKTPQQGAQ 265

Query: 1201 TTVYCAAAPELEGLGGMYFNNCCRCMPSTEAQSEETARALWALS 1332
            T+++CA    LE L G +F++C     S +A++E  AR LW +S
Sbjct: 266  TSLHCALTEGLEILSGNHFSDCHVAWVSVQARNETIARRLWDVS 309


>ref|NP_065956.1| retinol dehydrogenase 14 (all-trans and 9-cis) [Homo sapiens]
          Length = 336

 Score =  177 bits (450), Expect = 3e-44
 Identities = 113/298 (37%), Positives = 155/298 (52%), Gaps = 16/298 (5%)
 Frame = +1

Query: 499  GKVVVVTGANSGIGFEAAKSFALHGAHVILACRNMTRANEAVSRILGEWHKA-------- 654
            GK V++TGANSG+G   A      GA VI+ CR+  RA EA  ++  E  +A        
Sbjct: 43   GKTVLITGANSGLGRATAAELLRLGARVIMGCRDRARAEEAAGQLRRELRQAAECGPEPG 102

Query: 655  -----KVEAMTLDLAVLRSVQHFAQAFKAKNVLLHVLVCNAAVFALPWSLTKDGLETTFQ 819
                 ++    LDLA LRSV+ F Q    +   L VL+ NA +F  P+  T+DG E  F 
Sbjct: 103  VSGVGELIVRELDLASLRSVRAFCQEMLQEEPRLDVLINNAGIFQCPYMKTEDGFEMQFG 162

Query: 820  VNHLGHFYLVQLLQDVLCRSAPARXXXXXXXXHRFTDINDSSGKLDFSRLSPSHSDYWAM 999
            VNHLGHF L  LL  +L  SAP+R        +++ DIN       F  L+ S   Y   
Sbjct: 163  VNHLGHFLLTNLLLGLLKSSAPSRIVVVSSKLYKYGDIN-------FDDLN-SEQSYNKS 214

Query: 1000 LAYNRSKLCNILFSNELHRRLSPRGVTSNAVHPG---NMMFSSLHRGWWVYTLLFTLARP 1170
              Y+RSKL NILF+ EL RRL    VT N +HPG     +   +H    V  L   ++  
Sbjct: 215  FCYSRSKLANILFTRELARRLEGTNVTVNVLHPGIVRTNLGRHIHIPLLVKPLFNLVSWA 274

Query: 1171 FTKSMQQGAATTVYCAAAPELEGLGGMYFNNCCRCMPSTEAQSEETARALWALSERLI 1344
            F K+  +GA T++Y A++PE+EG+ G YF +C       +A  E  AR LW +SE ++
Sbjct: 275  FFKTPVEGAQTSIYLASSPEVEGVSGRYFGDCKEEELLPKAMDESVARKLWDISEVMV 332


>ref|NP_660160.1| dehydrogenase/reductase (SDR family) X-linked [Homo sapiens]
          Length = 330

 Score =  152 bits (383), Expect = 2e-36
 Identities = 102/284 (35%), Positives = 143/284 (50%), Gaps = 7/284 (2%)
 Frame = +1

Query: 502  KVVVVTGANSGIGFEAAKSFALHGAHVILACRNMTRANEAVSRILGEWHKAKVEAMTLDL 681
            +V +VTG   GIG+  AK  A  G HVI+A  N ++A + VS+I  E    KVE +  DL
Sbjct: 44   RVAIVTGGTDGIGYSTAKHLARLGMHVIIAGNNDSKAKQVVSKIKEETLNDKVEFLYCDL 103

Query: 682  AVLRSVQHFAQAFKAKNVLLHVLVCNAAVFALPWSLTKDGLETTFQVNHLGHFYLVQLLQ 861
            A + S++ F Q FK K + LHVL+ NA V  +P   T+DG E  F +N+LGHF L  LL 
Sbjct: 104  ASMTSIRQFVQKFKMKKIPLHVLINNAGVMMVPQRKTRDGFEEHFGLNYLGHFLLTNLLL 163

Query: 862  DVLCRSA----PARXXXXXXXXHRFTDINDSSGKLDFSRLSPSHSDYWAMLAYNRSKLCN 1029
            D L  S      AR        H   ++N     +D  + S  +S +    AY +SKL  
Sbjct: 164  DTLKESGSPGHSARVVTVSSATHYVAELN-----MDDLQSSACYSPH---AAYAQSKLAL 215

Query: 1030 ILFSNELHRRLSPRG--VTSNAVHPGNMMFSSLHRGWWVYTLL-FTLARPFTKSMQQGAA 1200
            +LF+  L R L+  G  VT+N V PG +        +W   L    L     K+  +GA 
Sbjct: 216  VLFTYHLQRLLAAEGSHVTANVVDPGVVNTDLYKHVFWATRLAKKLLGWLLFKTPDEGAW 275

Query: 1201 TTVYCAAAPELEGLGGMYFNNCCRCMPSTEAQSEETARALWALS 1332
            T++Y A  PELEG+GG Y  N           +++  + LW+ S
Sbjct: 276  TSIYAAVTPELEGVGGRYLYNEKETKSLHVTYNQKLQQQLWSKS 319


>ref|NP_612421.1| retinol dehydrogenase 13 (all-trans and 9-cis) [Homo sapiens]
          Length = 260

 Score =  141 bits (355), Expect = 3e-33
 Identities = 94/253 (37%), Positives = 123/253 (48%), Gaps = 5/253 (1%)
 Frame = +1

Query: 601  MTRANEAVSRILGEWHKAKVEAMTLDLAVLRSVQHFAQAFKAKNVLLHVLVCNAAVFALP 780
            M +   A   I GE     V A  LDLA L+S++ FA     +   + +L+ NA V   P
Sbjct: 1    MEKCEAAAKDIRGETLNHHVNARHLDLASLKSIREFAAKIIEEEERVDILINNAGVMRCP 60

Query: 781  WSLTKDGLETTFQVNHLGHFYLVQLLQDVLCRSAPARXXXXXXXXHRFTDINDSSGKLDF 960
               T+DG E  F VNHLGHF L  LL D L  SAP+R        H        +G +DF
Sbjct: 61   HWTTEDGFEMQFGVNHLGHFLLTNLLLDKLKASAPSRIINLSSLAH-------VAGHIDF 113

Query: 961  SRLSPSHSDYWAMLAYNRSKLCNILFSNELHRRLSPRGVTSNAVHPGNM-----MFSSLH 1125
              L+     Y    AY +SKL  +LF+ EL RRL   GVT NA+HPG         + +H
Sbjct: 114  DDLNWQTRKYNTKAAYCQSKLAIVLFTKELSRRLQGSGVTVNALHPGVARTELGRHTGIH 173

Query: 1126 RGWWVYTLLFTLARPFTKSMQQGAATTVYCAAAPELEGLGGMYFNNCCRCMPSTEAQSEE 1305
               +  T L  +     KS +  A  + Y A A EL  + G YF+   +  P+ EA+ EE
Sbjct: 174  GSTFSSTTLGPIFWLLVKSPELAAQPSTYLAVAEELADVSGKYFDGLKQKAPAPEAEDEE 233

Query: 1306 TARALWALSERLI 1344
             AR LWA S RL+
Sbjct: 234  VARRLWAESARLV 246


>ref|NP_653284.1| hypothetical protein LOC147015 [Homo sapiens]
          Length = 327

 Score =  129 bits (324), Expect = 1e-29
 Identities = 94/267 (35%), Positives = 124/267 (46%), Gaps = 3/267 (1%)
 Frame = +1

Query: 550  AKSFALHGAHVILACRNMTRANEAVSRILGEWHKAKVEAMTLDLAVLRSVQHFAQAFKAK 729
            A   A  GA V+LACR+  R   A   +  E    +V  M LDLA L SV+ FA AF + 
Sbjct: 3    ALELARRGARVVLACRSQERGEAAAFDLRQESGNNEVIFMALDLASLASVRAFATAFLSS 62

Query: 730  NVLLHVLVCNAAVFALPWSLTKDGLETTFQVNHLGHFYLVQLLQDVLCRSAPARXXXXXX 909
               L +L+ NA + +     T++      +VNH+G F L  LL   L   AP+R      
Sbjct: 63   EPRLDILIHNAGISSC--GRTREAFNLLLRVNHIGPFLLTHLLLPCLKACAPSRVVVVAS 120

Query: 910  XXHRFTDINDSSGKLDFSRLS-PSHSDYWAMLAYNRSKLCNILFSNELHRRLSPRGVTSN 1086
              H         G+LDF RL  P       + AY  +KL N+LF+ EL  +L   GVT  
Sbjct: 121  AAH-------CRGRLDFKRLDRPVVGWRQELRAYADTKLANVLFARELANQLEATGVTCY 173

Query: 1087 AVHPG--NMMFSSLHRGWWVYTLLFTLARPFTKSMQQGAATTVYCAAAPELEGLGGMYFN 1260
            A HPG  N      H   W+  LL  LA    ++ + GA T +YCA    +E L G YF 
Sbjct: 174  AAHPGPVNSELFLRHVPGWLRPLLRPLAWLVLRAPRGGAQTPLYCALQEGIEPLSGRYFA 233

Query: 1261 NCCRCMPSTEAQSEETARALWALSERL 1341
            NC        A+ +  A  LW  S+RL
Sbjct: 234  NCHVEEVPPAARDDRAAHRLWEASKRL 260


>ref|XP_371503.3| PREDICTED: similar to short-chain dehydrogenase/reductase 1 [Homo
           sapiens]
          Length = 891

 Score = 83.6 bits (205), Expect = 7e-16
 Identities = 47/125 (37%), Positives = 74/125 (59%), Gaps = 1/125 (0%)
 Frame = +1

Query: 490 DFSGKVVVVTGANSGIGFEAAKSFALHGAHVILACRNMTRANEAVSRILGEWHKAKVEAM 669
           D +GK+ +VTGANSGIG   ++  A  GA VIL C++     +A++ I    +  ++   
Sbjct: 599 DLTGKIAIVTGANSGIGKVVSQDLARCGAQVILTCQSRECGQQALAEIQAASNSNRLLLG 658

Query: 670 TLDLAVLRSVQHFAQAFKAKNVLLHVLVCNAAVFA-LPWSLTKDGLETTFQVNHLGHFYL 846
            +DL+ + S++ FA+    +N  +H+LV NA V   +P +LT  GL+ TF  N++G F L
Sbjct: 659 EVDLSSMTSIRSFARRLLQENPEIHLLVNNAGVSGMIPKTLTPGGLDLTFVTNYVGPFLL 718

Query: 847 VQLLQ 861
             LLQ
Sbjct: 719 TNLLQ 723


>ref|XP_947127.1| PREDICTED: similar to short-chain dehydrogenase/reductase 1 [Homo
           sapiens]
          Length = 916

 Score = 83.6 bits (205), Expect = 7e-16
 Identities = 47/125 (37%), Positives = 74/125 (59%), Gaps = 1/125 (0%)
 Frame = +1

Query: 490 DFSGKVVVVTGANSGIGFEAAKSFALHGAHVILACRNMTRANEAVSRILGEWHKAKVEAM 669
           D +GK+ +VTGANSGIG   ++  A  GA VIL C++     +A++ I    +  ++   
Sbjct: 624 DLTGKIAIVTGANSGIGKVVSQDLARCGAQVILTCQSRECGQQALAEIQAASNSNRLLLG 683

Query: 670 TLDLAVLRSVQHFAQAFKAKNVLLHVLVCNAAVFA-LPWSLTKDGLETTFQVNHLGHFYL 846
            +DL+ + S++ FA+    +N  +H+LV NA V   +P +LT  GL+ TF  N++G F L
Sbjct: 684 EVDLSSMTSIRSFARRLLQENPEIHLLVNNAGVSGMIPKTLTPGGLDLTFVTNYVGPFLL 743

Query: 847 VQLLQ 861
             LLQ
Sbjct: 744 TNLLQ 748


  Database: RefSeqHP
    Posted date:  Aug 2, 2006 12:57 AM
  Number of letters in database: 17,774,539
  Number of sequences in database:  39,411
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 92,564,602
Number of Sequences: 39411
Number of extensions: 2590806
Number of successful extensions: 9093
Number of sequences better than 1.0e-05: 10
Number of HSP's better than  0.0 without gapping: 6968
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 8988
length of database: 17,774,539
effective HSP length: 110
effective length of database: 13,439,329
effective search space used: 8896835798
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqMP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= LVR01_0018_H02
         (2320 letters)

Database: RefSeqMP 
           45,328 sequences; 21,768,885 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_062519.2| WW-domain oxidoreductase [Mus musculus]              751   0.0  
Alignment   gi|NP_084293.1| retinol dehydrogenase 12 [Mus musculus]              211   4e-54
Alignment   gi|NP_067532.2| short-chain dehydrogenase/reductase 1 [Mus musc...   185   2e-46
Alignment   gi|NP_780581.1| retinol dehydrogenase 13 (all-trans and 9-cis) ...   181   3e-45
Alignment   gi|NP_076186.1| alcohol dehydrogenase PAN2 [Mus musculus]            174   3e-43
Alignment   gi|NP_001028498.1| dehydrogenase/reductase (SDR family) X chrom...   150   4e-36
Alignment   gi|NP_899109.1| hypothetical protein LOC70451 [Mus musculus]         122   1e-27
Alignment   gi|XP_981434.1| PREDICTED: similar to Itchy E3 ubiquitin protei...    76   1e-13
Alignment   gi|XP_912147.2| PREDICTED: similar to Itchy E3 ubiquitin protei...    76   1e-13
Alignment   gi|XP_907619.1| PREDICTED: itchy isoform 6 [Mus musculus]             76   1e-13

>ref|NP_062519.2| WW-domain oxidoreductase [Mus musculus]
          Length = 414

 Score =  751 bits (1938), Expect = 0.0
 Identities = 359/399 (89%), Positives = 374/399 (93%)
 Frame = +1

Query: 154  LDDTDSEDELPPGWEQRTTKDGWVYYANHTEEKTQWEHPKTGKRKRIAGDLPYGWEQETD 333
            LDDTDSEDELPPGWE+RTTKDGWVYYANHTEEKTQWEHPKTGKRKR+AGDLPYGWEQETD
Sbjct: 9    LDDTDSEDELPPGWEERTTKDGWVYYANHTEEKTQWEHPKTGKRKRVAGDLPYGWEQETD 68

Query: 334  EKGQVFFVDHINKRTTYLDPRLAFTVDENPTKPTTRQRYDSSTTAMEILQGRDFSGKVVV 513
            E GQVFFVDHINKRTTYLDPRLAFTVD+NPTKPTTRQRYD STTAMEILQGRDF+GKVV+
Sbjct: 69   ENGQVFFVDHINKRTTYLDPRLAFTVDDNPTKPTTRQRYDGSTTAMEILQGRDFTGKVVL 128

Query: 514  VTGANSGIGFEAAKSFALHGAHVILACRNMTRANEAVSRILGEWHKAKVEAMTLDLAVLR 693
            VTGANSGIGFE AKSFALHGAHVILACRN++RA+EAVSRIL EWHKAKVEAMTLDLAVLR
Sbjct: 129  VTGANSGIGFETAKSFALHGAHVILACRNLSRASEAVSRILEEWHKAKVEAMTLDLAVLR 188

Query: 694  SVQHFAQAFKAKNVLLHVLVCNAAVFALPWSLTKDGLETTFQVNHLGHFYLVQLLQDVLC 873
            SVQHFA+AFKAKNV LHVLVCNA  FALPW LTKDGLETTFQVNHLGHFYLVQLLQDVLC
Sbjct: 189  SVQHFAEAFKAKNVSLHVLVCNAGTFALPWGLTKDGLETTFQVNHLGHFYLVQLLQDVLC 248

Query: 874  RSAPARXXXXXXXXHRFTDINDSSGKLDFSRLSPSHSDYWAMLAYNRSKLCNILFSNELH 1053
            RS+PAR        HRFTDINDSSGKLD SRLSP  SDYWAMLAYNRSKLCNILFSNELH
Sbjct: 249  RSSPARVIVVSSESHRFTDINDSSGKLDLSRLSPPRSDYWAMLAYNRSKLCNILFSNELH 308

Query: 1054 RRLSPRGVTSNAVHPGNMMFSSLHRGWWVYTLLFTLARPFTKSMQQGAATTVYCAAAPEL 1233
            RRLSPRGVTSNAVHPGNMM+S++HR  WVY LLFTLARPFTKSMQQGAATTVYCA APEL
Sbjct: 309  RRLSPRGVTSNAVHPGNMMYSAIHRNSWVYKLLFTLARPFTKSMQQGAATTVYCAVAPEL 368

Query: 1234 EGLGGMYFNNCCRCMPSTEAQSEETARALWALSERLIQE 1350
            EGLGGMYFNNCCRC+PS EAQSEETARALW LSERLIQ+
Sbjct: 369  EGLGGMYFNNCCRCLPSEEAQSEETARALWELSERLIQD 407


>ref|NP_084293.1| retinol dehydrogenase 12 [Mus musculus]
          Length = 316

 Score =  211 bits (536), Expect = 4e-54
 Identities = 121/282 (42%), Positives = 166/282 (58%)
 Frame = +1

Query: 499  GKVVVVTGANSGIGFEAAKSFALHGAHVILACRNMTRANEAVSRILGEWHKAKVEAMTLD 678
            GKVVV+TGAN+GIG E A+  A  GA V +ACR++ +   A S I  +   ++V    LD
Sbjct: 39   GKVVVITGANTGIGKETARELARRGARVYIACRDVLKGESAASEIRADTKNSQVLVRKLD 98

Query: 679  LAVLRSVQHFAQAFKAKNVLLHVLVCNAAVFALPWSLTKDGLETTFQVNHLGHFYLVQLL 858
            L+  +S++ FA+ F A+   LH+L+ NA V   P+S T DG ET F VNHLGHF L  LL
Sbjct: 99   LSDTKSIRAFAERFLAEEKKLHILINNAGVMMCPYSKTTDGFETHFGVNHLGHFLLTYLL 158

Query: 859  QDVLCRSAPARXXXXXXXXHRFTDINDSSGKLDFSRLSPSHSDYWAMLAYNRSKLCNILF 1038
             + L  SAPAR        H         GK+ F  L      Y +  AY  SKL N+LF
Sbjct: 159  LERLKESAPARVVNLSSIAHLI-------GKIRFHDLQ-GQKRYCSAFAYGHSKLANLLF 210

Query: 1039 SNELHRRLSPRGVTSNAVHPGNMMFSSLHRGWWVYTLLFTLARPFTKSMQQGAATTVYCA 1218
            + EL +RL   GVT+ AVHPG ++ S + R  ++  LL+ L  PF KS  QGA T+++CA
Sbjct: 211  TRELAKRLQGTGVTAYAVHPG-VVLSEITRNSYLLCLLWRLFSPFFKSTSQGAQTSLHCA 269

Query: 1219 AAPELEGLGGMYFNNCCRCMPSTEAQSEETARALWALSERLI 1344
             A +LE L G YF++C R   S+ A++++TA  LW +S  L+
Sbjct: 270  LAEDLEPLSGKYFSDCKRMWVSSRARNKKTAERLWNVSCELL 311


>ref|NP_067532.2| short-chain dehydrogenase/reductase 1 [Mus musculus]
          Length = 316

 Score =  185 bits (470), Expect = 2e-46
 Identities = 116/283 (40%), Positives = 155/283 (54%), Gaps = 5/283 (1%)
 Frame = +1

Query: 499  GKVVVVTGANSGIGFEAAKSFALHGAHVILACRNMTRANEAVSRILGEWHKAKVEAMTLD 678
            GKV +VTGAN+GIG E AK  A  GA V LACR++ +   A   I      ++V    LD
Sbjct: 38   GKVAIVTGANTGIGKETAKDLAQRGARVYLACRDVDKGELAAREIQAVTGNSQVFVRKLD 97

Query: 679  LAVLRSVQHFAQAFKAKNVLLHVLVCNAAVFALPWSLTKDGLETTFQVNHLGHFYLVQLL 858
            LA  +S++ FA+ F A+   LH+L+ NA V   P+S T DG E    VNHLGHF L  LL
Sbjct: 98   LADTKSIRAFAKDFLAEEKHLHLLINNAGVMMCPYSKTADGFEMHIGVNHLGHFLLTHLL 157

Query: 859  QDVLCRSAPARXXXXXXXXHRFTDINDSSGKLDFSRLSPSHSDYWAMLAYNRSKLCNILF 1038
             + L  SAP+R        H         G++ F  L      Y A LAY  SKL NILF
Sbjct: 158  LEKLKESAPSRIVNLSSLGHHL-------GRIHFHNLQ-GEKFYSAGLAYCHSKLANILF 209

Query: 1039 SNELHRRLSPRGVTSNAVHPGNM-----MFSSLHRGWWVYTLLFTLARPFTKSMQQGAAT 1203
            + EL +RL   GVT+ +VHPG +      +SS+ R  W++ L F     F K+ Q+GA T
Sbjct: 210  TKELAKRLKGSGVTTYSVHPGTVHSELTRYSSIMR--WLWQLFFV----FIKTPQEGAQT 263

Query: 1204 TVYCAAAPELEGLGGMYFNNCCRCMPSTEAQSEETARALWALS 1332
            ++YCA    LE L G +F++C     S + ++E  AR LW +S
Sbjct: 264  SLYCALTEGLESLSGSHFSDCQLAWVSYQGRNEIIARRLWDVS 306


>ref|NP_780581.1| retinol dehydrogenase 13 (all-trans and 9-cis) [Mus musculus]
          Length = 334

 Score =  181 bits (459), Expect = 3e-45
 Identities = 118/288 (40%), Positives = 153/288 (53%), Gaps = 6/288 (2%)
 Frame = +1

Query: 499  GKVVVVTGANSGIGFEAAKSFALHGAHVILACRNMTRANEAVSRILGEWHKAKVEAMTLD 678
            GK V+VTGAN+GIG + A   A  G +VILACR+M +   A   I GE    +V A  LD
Sbjct: 38   GKTVIVTGANTGIGKQTALELAKRGGNVILACRDMEKCEVAAKDIRGETLNPRVRAERLD 97

Query: 679  LAVLRSVQHFAQAFKAKNVLLHVLVCNAAVFALPWSLTKDGLETTFQVNHLGHFYLVQLL 858
            LA L+S++ FA+    +   + +LV NAAV   P   T+DG E  F VN+LGHF L  LL
Sbjct: 98   LASLKSIREFARKVIKEEERVDILVNNAAVMRCPHWTTEDGFEMQFGVNYLGHFLLTNLL 157

Query: 859  QDVLCRSAPARXXXXXXXXHRFTDINDSSGKLDFSRLSPSHSDYWAMLAYNRSKLCNILF 1038
             D L  SAP+R        H        +G +DF  L+     Y    AY +SKL  +LF
Sbjct: 158  LDKLKASAPSRIINLSSLAH-------VAGHIDFEDLNWQMKKYDTKAAYCQSKLAVVLF 210

Query: 1039 SNELHRRLSPRGVTSNAVHPGNMMFSSLHRGWWVYTLLFT--LARPF----TKSMQQGAA 1200
            + EL  RL   GVT NA+HPG +  + L R   ++   F+  +  PF     KS Q  A 
Sbjct: 211  TKELSHRLQGSGVTVNALHPG-VARTELGRHTGMHNSAFSGFMLGPFFWLLFKSPQLAAQ 269

Query: 1201 TTVYCAAAPELEGLGGMYFNNCCRCMPSTEAQSEETARALWALSERLI 1344
             + Y A A ELE + G YF+      PS EA+ EE AR LW  S RL+
Sbjct: 270  PSTYLAVAEELENVSGKYFDGLREKAPSPEAEDEEVARRLWTESARLV 317


>ref|NP_076186.1| alcohol dehydrogenase PAN2 [Mus musculus]
          Length = 334

 Score =  174 bits (442), Expect = 3e-43
 Identities = 114/296 (38%), Positives = 160/296 (54%), Gaps = 14/296 (4%)
 Frame = +1

Query: 499  GKVVVVTGANSGIGFEAAKSFALHGAHVILACRNMTRANEAVSRILGEWHKA-------- 654
            GK V++TGANSG+G   A      GA VI+ CR+  RA EA  ++  E  +A        
Sbjct: 44   GKTVLITGANSGLGRATAAELLRLGARVIMGCRDRARAEEAAGQLRQELCQAGGAGPDGT 103

Query: 655  --KVEAMTLDLAVLRSVQHFAQAFKAKNVLLHVLVCNAAVFALPWSLTKDGLETTFQVNH 828
              ++    LDLA LRSV+ F Q    +   L VL+ NA VF  P++ T+DG E  F VNH
Sbjct: 104  DGQLVVKELDLASLRSVRAFCQELLQEEPRLDVLINNAGVFHCPYTKTEDGFEMQFGVNH 163

Query: 829  LGHFYLVQLLQDVLCRSAPARXXXXXXXXHRFTDINDSSGKLDFSRLSPSHSDYWAMLAY 1008
            LGHF L  LL  +L  SAP+R        +++       G+++F  L+ S   Y     Y
Sbjct: 164  LGHFLLTNLLLGLLKSSAPSRIVVVSSKLYKY-------GEINFEDLN-SEQSYNKSFCY 215

Query: 1009 NRSKLCNILFSNELHRRLSPRGVTSNAVHPGNMMFSSLHRGWWVYTL---LFTLAR-PFT 1176
            +RSKL NILF+ EL RRL    VT N +HPG ++ ++L R   +  L   LF L    F 
Sbjct: 216  SRSKLANILFTRELARRLEGTNVTVNVLHPG-IVRTNLGRHIHIPLLARPLFNLVSWAFF 274

Query: 1177 KSMQQGAATTVYCAAAPELEGLGGMYFNNCCRCMPSTEAQSEETARALWALSERLI 1344
            K+  +GA T++Y A +P++EG+ G YF +C       +A  E  AR LW +SE ++
Sbjct: 275  KTPLEGAQTSIYLACSPDVEGVSGRYFGDCKEEELLPKAMDESVARKLWDISEVMV 330


>ref|NP_001028498.1| dehydrogenase/reductase (SDR family) X chromosome [Mus musculus]
          Length = 335

 Score =  150 bits (380), Expect = 4e-36
 Identities = 111/288 (38%), Positives = 146/288 (50%), Gaps = 7/288 (2%)
 Frame = +1

Query: 499  GKVVVVTGANSGIGFEAAKSFALHGAHVILACRNMTRANEAVSRILGEWHKAKVEAMTLD 678
            G+V +VTGA +GIG   A+  A  G  V++A  +  R  E VS I  E    +   + LD
Sbjct: 43   GRVAIVTGATAGIGRSTARQLARLGMCVVVAGNDEHRGQEVVSSIRAEMGSDRAHFLPLD 102

Query: 679  LAVLRSVQHFAQAFKAKNVLLHVLVCNAAVFALPWSLTKDGLETTFQVNHLGHFYLVQLL 858
            LA L SV+ FA+ F+A  + LH+LV NA V   P + T+DG E    VN LGHF L  LL
Sbjct: 103  LASLASVRGFARDFQALGLPLHLLVNNAGVMLEPRAETEDGFERHLGVNFLGHFLLTLLL 162

Query: 859  QDVLCRSAPARXXXXXXXXHRFTDINDSS---GKLDFSRLSPSHSDYWAMLAYNRSKLCN 1029
               L      R         R   +  ++   G +D + L   H+ Y    AY +SKL  
Sbjct: 163  LPAL------RASGAEGRGSRVVTVGSATHYVGTVDMADLHGRHA-YSPYAAYAQSKLAL 215

Query: 1030 ILFSNELHRRLSPRG--VTSNAVHPGNMMFSSL--HRGWWVYTLLFTLARPFTKSMQQGA 1197
             LF+ +L R L  RG  VTSN   PG ++ + L  H GW + T    L     KS ++GA
Sbjct: 216  ALFALQLQRILDARGDPVTSNMADPG-VVDTELYRHAGWVLRTAKRFLGWLVFKSPEEGA 274

Query: 1198 ATTVYCAAAPELEGLGGMYFNNCCRCMPSTEAQSEETARALWALSERL 1341
             T VY AAAPELEG+GG Y  +     P   A+ +E  R LWA   RL
Sbjct: 275  WTLVYAAAAPELEGVGGRYLRDEAEAEPLGTARDQELQRRLWAEGLRL 322


>ref|NP_899109.1| hypothetical protein LOC70451 [Mus musculus]
          Length = 260

 Score =  122 bits (307), Expect = 1e-27
 Identities = 87/216 (40%), Positives = 109/216 (50%), Gaps = 4/216 (1%)
 Frame = +1

Query: 499  GKVVVVTGANSGIGFEAAKSFALHGAHVILACRNMTRANEAVSRILGEWHKAKVEAMTLD 678
            G+ VVVTGANSGIG   A   A  GA V+LACR+  R   A   +  E    +V  M LD
Sbjct: 36   GRTVVVTGANSGIGKMTALELARRGARVVLACRSRERGEAAAFDLRQESGNNEVIFMALD 95

Query: 679  LAVLRSVQHFAQAFKAKNVLLHVLVCNAAVFALPWSLTKDGLETTFQVNHLGHFYLVQLL 858
            LA L SVQ FA AF +    L VL+ NA + +     T++      +VNH+G F L  LL
Sbjct: 96   LASLASVQAFATAFLSSEPRLDVLIHNAGISSC--GRTRETFNLLLRVNHVGPFLLTHLL 153

Query: 859  QDVLCRSAPARXXXXXXXXHRFTDINDSSGKLDFSRLS-PSHSDYWAMLAYNRSKLCNIL 1035
               L   AP+R        HR        G+LDF+RL  P       + AY  SKL N+L
Sbjct: 154  LPRLRSCAPSRVVIVSSAAHR-------RGRLDFTRLDCPVVGWQQELRAYADSKLANVL 206

Query: 1036 FSNELHRRLSPRGVTSNAVHPG---NMMFSSLHRGW 1134
            F+ EL  +L   GVT  A HPG   + +F    RGW
Sbjct: 207  FARELATQLEGTGVTCYAAHPGPVNSELFLRHLRGW 242


>ref|XP_981434.1| PREDICTED: similar to Itchy E3 ubiquitin protein ligase [Mus
           musculus]
          Length = 881

 Score = 76.3 bits (186), Expect = 1e-13
 Identities = 33/80 (41%), Positives = 48/80 (60%)
 Frame = +1

Query: 160 DTDSEDELPPGWEQRTTKDGWVYYANHTEEKTQWEHPKTGKRKRIAGDLPYGWEQETDEK 339
           +T S+  LPPGWEQR  + G VYY +H E++T W+ P+          LP GWE+  D  
Sbjct: 299 NTVSQAPLPPGWEQRVDQHGRVYYVDHVEKRTTWDRPE---------PLPPGWERRVDNM 349

Query: 340 GQVFFVDHINKRTTYLDPRL 399
           G++++VDH  + TT+  P L
Sbjct: 350 GRIYYVDHFTRTTTWQRPTL 369



 Score = 74.3 bits (181), Expect = 5e-13
 Identities = 35/80 (43%), Positives = 47/80 (58%)
 Frame = +1

Query: 181 LPPGWEQRTTKDGWVYYANHTEEKTQWEHPKTGKRKRIAGDLPYGWEQETDEKGQVFFVD 360
           LPPGWE+RT  +G VY+ NH    TQWE P++ + +     LP GWE      G  +FVD
Sbjct: 418 LPPGWEKRTDSNGRVYFVNHNTRITQWEDPRS-QGQLNEKPLPEGWEMRFTVDGIPYFVD 476

Query: 361 HINKRTTYLDPRLAFTVDEN 420
           H  + TTY+DPR   +  +N
Sbjct: 477 HNRRATTYIDPRTGKSALDN 496


>ref|XP_912147.2| PREDICTED: similar to Itchy E3 ubiquitin protein ligase isoform 9
           [Mus musculus]
          Length = 914

 Score = 76.3 bits (186), Expect = 1e-13
 Identities = 33/80 (41%), Positives = 48/80 (60%)
 Frame = +1

Query: 160 DTDSEDELPPGWEQRTTKDGWVYYANHTEEKTQWEHPKTGKRKRIAGDLPYGWEQETDEK 339
           +T S+  LPPGWEQR  + G VYY +H E++T W+ P+          LP GWE+  D  
Sbjct: 332 NTVSQAPLPPGWEQRVDQHGRVYYVDHVEKRTTWDRPE---------PLPPGWERRVDNM 382

Query: 340 GQVFFVDHINKRTTYLDPRL 399
           G++++VDH  + TT+  P L
Sbjct: 383 GRIYYVDHFTRTTTWQRPTL 402



 Score = 74.3 bits (181), Expect = 5e-13
 Identities = 35/80 (43%), Positives = 47/80 (58%)
 Frame = +1

Query: 181 LPPGWEQRTTKDGWVYYANHTEEKTQWEHPKTGKRKRIAGDLPYGWEQETDEKGQVFFVD 360
           LPPGWE+RT  +G VY+ NH    TQWE P++ + +     LP GWE      G  +FVD
Sbjct: 451 LPPGWEKRTDSNGRVYFVNHNTRITQWEDPRS-QGQLNEKPLPEGWEMRFTVDGIPYFVD 509

Query: 361 HINKRTTYLDPRLAFTVDEN 420
           H  + TTY+DPR   +  +N
Sbjct: 510 HNRRATTYIDPRTGKSALDN 529


>ref|XP_907619.1| PREDICTED: itchy isoform 6 [Mus musculus]
          Length = 525

 Score = 76.3 bits (186), Expect = 1e-13
 Identities = 33/80 (41%), Positives = 48/80 (60%)
 Frame = +1

Query: 160 DTDSEDELPPGWEQRTTKDGWVYYANHTEEKTQWEHPKTGKRKRIAGDLPYGWEQETDEK 339
           +T S+  LPPGWEQR  + G VYY +H E++T W+ P+          LP GWE+  D  
Sbjct: 282 NTVSQAPLPPGWEQRVDQHGRVYYVDHVEKRTTWDRPE---------PLPPGWERRVDNM 332

Query: 340 GQVFFVDHINKRTTYLDPRL 399
           G++++VDH  + TT+  P L
Sbjct: 333 GRIYYVDHFTRTTTWQRPTL 352



 Score = 74.3 bits (181), Expect = 5e-13
 Identities = 35/80 (43%), Positives = 47/80 (58%)
 Frame = +1

Query: 181 LPPGWEQRTTKDGWVYYANHTEEKTQWEHPKTGKRKRIAGDLPYGWEQETDEKGQVFFVD 360
           LPPGWE+RT  +G VY+ NH    TQWE P++ + +     LP GWE      G  +FVD
Sbjct: 401 LPPGWEKRTDSNGRVYFVNHNTRITQWEDPRS-QGQLNEKPLPEGWEMRFTVDGIPYFVD 459

Query: 361 HINKRTTYLDPRLAFTVDEN 420
           H  + TTY+DPR   +  +N
Sbjct: 460 HNRRATTYIDPRTGKSALDN 479


  Database: RefSeqMP
    Posted date:  Aug 2, 2006 12:58 AM
  Number of letters in database: 21,768,885
  Number of sequences in database:  45,328
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 109,522,074
Number of Sequences: 45328
Number of extensions: 2955969
Number of successful extensions: 10491
Number of sequences better than 1.0e-05: 10
Number of HSP's better than  0.0 without gapping: 7936
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 10361
length of database: 21,768,885
effective HSP length: 111
effective length of database: 16,737,477
effective search space used: 11063472297
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)