Animal-Genome cDNA LVRM1_0083_F07


Search to RefSeqBP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= LVRM1_0083_F07
         (1160 letters)

Database: RefSeqBP 
           33,508 sequences; 16,112,626 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_776702.1| clathrin, light polypeptide B (light chain B) [...   355   3e-98
Alignment   gi|NP_776447.1| clathrin, light polypeptide (Lca) [Bos taurus]       215   5e-56

>ref|NP_776702.1| clathrin, light polypeptide B (light chain B) [Bos taurus]
          Length = 210

 Score =  355 bits (912), Expect = 3e-98
 Identities = 182/211 (86%), Positives = 183/211 (86%)
 Frame = +3

Query: 219 MADDXXXXXXXXXXXXXXXXXXXXXXFLAQQESEIAGIENDEGFGAPAGSQAALAQPGPA 398
           MADD                      FLAQQESEIAGIENDEGFGAPAGSQ  LAQPGPA
Sbjct: 1   MADDFGFFSSSESGAPEAAEEDPAAAFLAQQESEIAGIENDEGFGAPAGSQGGLAQPGPA 60

Query: 399 SGAGPEDMGTTVNGDVFQDANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAA 578
           SGA  EDMG TVNGDVFQ+ANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAA
Sbjct: 61  SGAS-EDMGATVNGDVFQEANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAA 119

Query: 579 SKVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNRASEEAFVKESKEETPGTEWEKVAQL 758
           SKV EQEWREKAKKDLEEWNQRQSEQVEKNKINNRASEEAFVKESKEETPGTEWEKVAQL
Sbjct: 120 SKVMEQEWREKAKKDLEEWNQRQSEQVEKNKINNRASEEAFVKESKEETPGTEWEKVAQL 179

Query: 759 CDFNPKSSKQCKDVSRLRSVLMSLKQTPLSR 851
           CDFNPKSSKQCKDVSRLRSVLMSLKQTPLSR
Sbjct: 180 CDFNPKSSKQCKDVSRLRSVLMSLKQTPLSR 210


>ref|NP_776447.1| clathrin, light polypeptide (Lca) [Bos taurus]
          Length = 243

 Score =  215 bits (548), Expect = 5e-56
 Identities = 120/218 (55%), Positives = 142/218 (65%), Gaps = 35/218 (16%)
 Frame = +3

Query: 297 FLAQQESEIAGIENDEGF-----GAPAGSQAALAQPGPASGAGPEDMGTTVNGDVFQDAN 461
           FLAQQESEIAGIENDE F     GAP GSQ     PG      P+ +    NGD +Q++N
Sbjct: 30  FLAQQESEIAGIENDEAFAILDGGAP-GSQPHGEPPGI-----PDAVDGVTNGDYYQESN 83

Query: 462 GPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAASKVTEQEWREKAKKDLEEWNQ 641
           GP D YAAI+Q DRL  EPESIRKWREEQ +RL+ LDA S+  E EW+EKA K+L+EW  
Sbjct: 84  GPTDSYAAISQVDRLQSEPESIRKWREEQTERLEALDANSRKQEAEWKEKAIKELDEWYA 143

Query: 642 RQSEQVEKNKINNR------------------------------ASEEAFVKESKEETPG 731
           RQ EQ++K K NNR                              A+EEAFV + +E +PG
Sbjct: 144 RQDEQLQKTKANNRVADEAFYKQPFADVIGYVTNINHPCYSLEQAAEEAFVNDIEESSPG 203

Query: 732 TEWEKVAQLCDFNPKSSKQCKDVSRLRSVLMSLKQTPL 845
           TEWE+VA+LCDFNPKSSKQ KDVSR+RSVL+SLKQ PL
Sbjct: 204 TEWERVARLCDFNPKSSKQAKDVSRMRSVLISLKQAPL 241


  Database: RefSeqBP
    Posted date:  Aug 1, 2006  7:14 PM
  Number of letters in database: 16,112,626
  Number of sequences in database:  33,508
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 38,196,462
Number of Sequences: 33508
Number of extensions: 1048212
Number of successful extensions: 7912
Number of sequences better than 1.0e-05: 2
Number of HSP's better than  0.0 without gapping: 5216
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7790
length of database: 16,112,626
effective HSP length: 103
effective length of database: 12,661,302
effective search space used: 3583148466
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqCP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= LVRM1_0083_F07
         (1160 letters)

Database: RefSeqCP 
           33,732 sequences; 19,266,565 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|XP_866115.1| PREDICTED: similar to clathrin, light polypepti...   365   e-101
Alignment   gi|XP_546220.2| PREDICTED: similar to Clathrin light chain B (L...   354   8e-98
Alignment   gi|XP_866083.1| PREDICTED: similar to clathrin, light polypepti...   350   2e-96
Alignment   gi|XP_866050.1| PREDICTED: similar to clathrin, light polypepti...   333   1e-91
Alignment   gi|XP_866066.1| PREDICTED: similar to clathrin, light polypepti...   328   6e-90
Alignment   gi|XP_866787.1| PREDICTED: similar to clathrin, light polypepti...   230   2e-60
Alignment   gi|XP_866825.1| PREDICTED: similar to Clathrin light chain A (L...   219   3e-57
Alignment   gi|XP_866761.1| PREDICTED: similar to Clathrin light chain A (L...   219   5e-57
Alignment   gi|XP_531996.2| PREDICTED: similar to Clathrin light chain A (L...   214   1e-55
Alignment   gi|XP_866835.1| PREDICTED: similar to clathrin, light polypepti...   192   5e-49

>ref|XP_866115.1| PREDICTED: similar to clathrin, light polypeptide isoform a isoform
           5 [Canis familiaris]
          Length = 211

 Score =  365 bits (938), Expect = e-101
 Identities = 184/211 (87%), Positives = 186/211 (88%)
 Frame = +3

Query: 219 MADDXXXXXXXXXXXXXXXXXXXXXXFLAQQESEIAGIENDEGFGAPAGSQAALAQPGPA 398
           MADD                      FLAQQESEIAGIENDEGFGAPAGS AALAQPGPA
Sbjct: 1   MADDFGFFSSSESGAPEAAEEDPAAAFLAQQESEIAGIENDEGFGAPAGSHAALAQPGPA 60

Query: 399 SGAGPEDMGTTVNGDVFQDANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAA 578
            GAG EDMGTT+NGDVFQ+ANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAA
Sbjct: 61  GGAGSEDMGTTINGDVFQEANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAA 120

Query: 579 SKVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNRASEEAFVKESKEETPGTEWEKVAQL 758
           SKVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNRASEEAFVKESKEETPGTEWEKVAQL
Sbjct: 121 SKVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNRASEEAFVKESKEETPGTEWEKVAQL 180

Query: 759 CDFNPKSSKQCKDVSRLRSVLMSLKQTPLSR 851
           CDFNPKSSKQCKDVSRLRSVLMSLKQTPLSR
Sbjct: 181 CDFNPKSSKQCKDVSRLRSVLMSLKQTPLSR 211


>ref|XP_546220.2| PREDICTED: similar to Clathrin light chain B (Lcb) isoform 1 [Canis
           familiaris]
          Length = 229

 Score =  354 bits (909), Expect = 8e-98
 Identities = 184/229 (80%), Positives = 186/229 (81%), Gaps = 18/229 (7%)
 Frame = +3

Query: 219 MADDXXXXXXXXXXXXXXXXXXXXXXFLAQQESEIAGIENDEGFGAPAGSQAALAQPGPA 398
           MADD                      FLAQQESEIAGIENDEGFGAPAGS AALAQPGPA
Sbjct: 1   MADDFGFFSSSESGAPEAAEEDPAAAFLAQQESEIAGIENDEGFGAPAGSHAALAQPGPA 60

Query: 399 SGAGPEDMGTTVNGDVFQDANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAA 578
            GAG EDMGTT+NGDVFQ+ANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAA
Sbjct: 61  GGAGSEDMGTTINGDVFQEANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAA 120

Query: 579 SKVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNR------------------ASEEAFV 704
           SKVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNR                  ASEEAFV
Sbjct: 121 SKVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNRIADKAFYQQPDADIIGYVASEEAFV 180

Query: 705 KESKEETPGTEWEKVAQLCDFNPKSSKQCKDVSRLRSVLMSLKQTPLSR 851
           KESKEETPGTEWEKVAQLCDFNPKSSKQCKDVSRLRSVLMSLKQTPLSR
Sbjct: 181 KESKEETPGTEWEKVAQLCDFNPKSSKQCKDVSRLRSVLMSLKQTPLSR 229


>ref|XP_866083.1| PREDICTED: similar to clathrin, light polypeptide isoform a isoform
           4 [Canis familiaris]
          Length = 213

 Score =  350 bits (897), Expect = 2e-96
 Identities = 180/213 (84%), Positives = 182/213 (85%), Gaps = 2/213 (0%)
 Frame = +3

Query: 219 MADDXXXXXXXXXXXXXXXXXXXXXXFLAQQESEIAGIENDEGFGAPAGSQAALAQPG-- 392
           MADD                      FLAQQESEIAGIENDEGFGAPAGS AALA     
Sbjct: 1   MADDFGFFSSSESGAPEAAEEDPAAAFLAQQESEIAGIENDEGFGAPAGSHAALAHASAC 60

Query: 393 PASGAGPEDMGTTVNGDVFQDANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELD 572
           P S AG EDMGTT+NGDVFQ+ANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELD
Sbjct: 61  PPSTAGSEDMGTTINGDVFQEANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELD 120

Query: 573 AASKVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNRASEEAFVKESKEETPGTEWEKVA 752
           AASKVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNRASEEAFVKESKEETPGTEWEKVA
Sbjct: 121 AASKVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNRASEEAFVKESKEETPGTEWEKVA 180

Query: 753 QLCDFNPKSSKQCKDVSRLRSVLMSLKQTPLSR 851
           QLCDFNPKSSKQCKDVSRLRSVLMSLKQTPLSR
Sbjct: 181 QLCDFNPKSSKQCKDVSRLRSVLMSLKQTPLSR 213


>ref|XP_866050.1| PREDICTED: similar to clathrin, light polypeptide isoform a isoform
           2 [Canis familiaris]
          Length = 208

 Score =  333 bits (855), Expect = 1e-91
 Identities = 173/211 (81%), Positives = 177/211 (83%)
 Frame = +3

Query: 219 MADDXXXXXXXXXXXXXXXXXXXXXXFLAQQESEIAGIENDEGFGAPAGSQAALAQPGPA 398
           MADD                      FLAQQESEIAGIENDEGFGAPAG+     + GP 
Sbjct: 1   MADDFGFFSSSESGAPEAAEEDPAAAFLAQQESEIAGIENDEGFGAPAGNSGE--EEGPR 58

Query: 399 SGAGPEDMGTTVNGDVFQDANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAA 578
            G    DMGTT+NGDVFQ+ANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAA
Sbjct: 59  YGP-LGDMGTTINGDVFQEANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAA 117

Query: 579 SKVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNRASEEAFVKESKEETPGTEWEKVAQL 758
           SKVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNRASEEAFVKESKEETPGTEWEKVAQL
Sbjct: 118 SKVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNRASEEAFVKESKEETPGTEWEKVAQL 177

Query: 759 CDFNPKSSKQCKDVSRLRSVLMSLKQTPLSR 851
           CDFNPKSSKQCKDVSRLRSVLMSLKQTPLSR
Sbjct: 178 CDFNPKSSKQCKDVSRLRSVLMSLKQTPLSR 208


>ref|XP_866066.1| PREDICTED: similar to clathrin, light polypeptide isoform a isoform
           3 [Canis familiaris]
          Length = 207

 Score =  328 bits (841), Expect = 6e-90
 Identities = 171/211 (81%), Positives = 173/211 (81%)
 Frame = +3

Query: 219 MADDXXXXXXXXXXXXXXXXXXXXXXFLAQQESEIAGIENDEGFGAPAGSQAALAQPGPA 398
           MADD                      FLAQQESEIAGIENDEGFG   G           
Sbjct: 1   MADDFGFFSSSESGAPEAAEEDPAAAFLAQQESEIAGIENDEGFGLSNGYCHVFV----L 56

Query: 399 SGAGPEDMGTTVNGDVFQDANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAA 578
           S AG EDMGTT+NGDVFQ+ANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAA
Sbjct: 57  SLAGSEDMGTTINGDVFQEANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAA 116

Query: 579 SKVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNRASEEAFVKESKEETPGTEWEKVAQL 758
           SKVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNRASEEAFVKESKEETPGTEWEKVAQL
Sbjct: 117 SKVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNRASEEAFVKESKEETPGTEWEKVAQL 176

Query: 759 CDFNPKSSKQCKDVSRLRSVLMSLKQTPLSR 851
           CDFNPKSSKQCKDVSRLRSVLMSLKQTPLSR
Sbjct: 177 CDFNPKSSKQCKDVSRLRSVLMSLKQTPLSR 207


>ref|XP_866787.1| PREDICTED: similar to clathrin, light polypeptide A isoform a
           isoform 3 [Canis familiaris]
          Length = 218

 Score =  230 bits (586), Expect = 2e-60
 Identities = 115/183 (62%), Positives = 137/183 (74%)
 Frame = +3

Query: 297 FLAQQESEIAGIENDEGFGAPAGSQAALAQPGPASGAGPEDMGTTVNGDVFQDANGPADG 476
           FLAQQESEIAGIENDE F    G        G   G  P+ +   +NG+ +Q++NGP D 
Sbjct: 35  FLAQQESEIAGIENDEAFAILDGGAPGPQPHGEPPGV-PDAVDGVMNGEYYQESNGPTDS 93

Query: 477 YAAIAQADRLTQEPESIRKWREEQRKRLQELDAASKVTEQEWREKAKKDLEEWNQRQSEQ 656
           YAAI+Q DRL  EPESIRKWREEQ +RL+ LDA S+  E EW+EKA K+LEEW  RQ EQ
Sbjct: 94  YAAISQVDRLQSEPESIRKWREEQTERLEALDANSRKQEAEWKEKAIKELEEWYARQDEQ 153

Query: 657 VEKNKINNRASEEAFVKESKEETPGTEWEKVAQLCDFNPKSSKQCKDVSRLRSVLMSLKQ 836
           ++K K NNRA+EEAFV +  E +PGTEWE+VA+LCDFNPKSSKQ KDVSR+RSVL+SLKQ
Sbjct: 154 LQKTKANNRAAEEAFVNDIDESSPGTEWERVARLCDFNPKSSKQAKDVSRMRSVLISLKQ 213

Query: 837 TPL 845
            PL
Sbjct: 214 APL 216


>ref|XP_866825.1| PREDICTED: similar to Clathrin light chain A (Lca) isoform 6 [Canis
           familiaris]
          Length = 230

 Score =  219 bits (559), Expect = 3e-57
 Identities = 114/195 (58%), Positives = 137/195 (70%), Gaps = 12/195 (6%)
 Frame = +3

Query: 297 FLAQQESEIAGIENDEGFGAPAGSQAALAQPGPASGAGPEDMGTTVNGDVFQDANGPADG 476
           FLAQQESEIAGIENDE F    G        G   G  P+ +   +NG+ +Q++NGP D 
Sbjct: 35  FLAQQESEIAGIENDEAFAILDGGAPGPQPHGEPPGV-PDAVDGVMNGEYYQESNGPTDS 93

Query: 477 YAAIAQADRLTQEPESIRKWREEQRKRLQELDAASKVTEQEWREKAKKDLEEWNQRQSEQ 656
           YAAI+Q DRL  EPESIRKWREEQ +RL+ LDA S+  E EW+EKA K+LEEW  RQ EQ
Sbjct: 94  YAAISQVDRLQSEPESIRKWREEQTERLEALDANSRKQEAEWKEKAIKELEEWYARQDEQ 153

Query: 657 VEKNKINN------------RASEEAFVKESKEETPGTEWEKVAQLCDFNPKSSKQCKDV 800
           ++K K NN            +A+EEAFV +  E +PGTEWE+VA+LCDFNPKSSKQ KDV
Sbjct: 154 LQKTKANNSTNINHPCYSLEQAAEEAFVNDIDESSPGTEWERVARLCDFNPKSSKQAKDV 213

Query: 801 SRLRSVLMSLKQTPL 845
           SR+RSVL+SLKQ PL
Sbjct: 214 SRMRSVLISLKQAPL 228


>ref|XP_866761.1| PREDICTED: similar to Clathrin light chain A (Lca) isoform 2 [Canis
           familiaris]
          Length = 236

 Score =  219 bits (557), Expect = 5e-57
 Identities = 115/201 (57%), Positives = 137/201 (68%), Gaps = 18/201 (8%)
 Frame = +3

Query: 297 FLAQQESEIAGIENDEGFGAPAGSQAALAQPGPASGAGPEDMGTTVNGDVFQDANGPADG 476
           FLAQQESEIAGIENDE F    G        G   G  P+ +   +NG+ +Q++NGP D 
Sbjct: 35  FLAQQESEIAGIENDEAFAILDGGAPGPQPHGEPPGV-PDAVDGVMNGEYYQESNGPTDS 93

Query: 477 YAAIAQADRLTQEPESIRKWREEQRKRLQELDAASKVTEQEWREKAKKDLEEWNQRQSEQ 656
           YAAI+Q DRL  EPESIRKWREEQ +RL+ LDA S+  E EW+EKA K+LEEW  RQ EQ
Sbjct: 94  YAAISQVDRLQSEPESIRKWREEQTERLEALDANSRKQEAEWKEKAIKELEEWYARQDEQ 153

Query: 657 VEKNKINNR------------------ASEEAFVKESKEETPGTEWEKVAQLCDFNPKSS 782
           ++K K NNR                  A+EEAFV +  E +PGTEWE+VA+LCDFNPKSS
Sbjct: 154 LQKTKANNRVADEAFYKQPFADVIGYVAAEEAFVNDIDESSPGTEWERVARLCDFNPKSS 213

Query: 783 KQCKDVSRLRSVLMSLKQTPL 845
           KQ KDVSR+RSVL+SLKQ PL
Sbjct: 214 KQAKDVSRMRSVLISLKQAPL 234


>ref|XP_531996.2| PREDICTED: similar to Clathrin light chain A (Lca) isoform 1 [Canis
           familiaris]
          Length = 248

 Score =  214 bits (545), Expect = 1e-55
 Identities = 115/213 (53%), Positives = 137/213 (64%), Gaps = 30/213 (14%)
 Frame = +3

Query: 297 FLAQQESEIAGIENDEGFGAPAGSQAALAQPGPASGAGPEDMGTTVNGDVFQDANGPADG 476
           FLAQQESEIAGIENDE F    G        G   G  P+ +   +NG+ +Q++NGP D 
Sbjct: 35  FLAQQESEIAGIENDEAFAILDGGAPGPQPHGEPPGV-PDAVDGVMNGEYYQESNGPTDS 93

Query: 477 YAAIAQADRLTQEPESIRKWREEQRKRLQELDAASKVTEQEWREKAKKDLEEWNQRQSEQ 656
           YAAI+Q DRL  EPESIRKWREEQ +RL+ LDA S+  E EW+EKA K+LEEW  RQ EQ
Sbjct: 94  YAAISQVDRLQSEPESIRKWREEQTERLEALDANSRKQEAEWKEKAIKELEEWYARQDEQ 153

Query: 657 VEKNKINNR------------------------------ASEEAFVKESKEETPGTEWEK 746
           ++K K NNR                              A+EEAFV +  E +PGTEWE+
Sbjct: 154 LQKTKANNRVADEAFYKQPFADVIGYVTNINHPCYSLEQAAEEAFVNDIDESSPGTEWER 213

Query: 747 VAQLCDFNPKSSKQCKDVSRLRSVLMSLKQTPL 845
           VA+LCDFNPKSSKQ KDVSR+RSVL+SLKQ PL
Sbjct: 214 VARLCDFNPKSSKQAKDVSRMRSVLISLKQAPL 246


>ref|XP_866835.1| PREDICTED: similar to clathrin, light polypeptide A isoform a
           isoform 7 [Canis familiaris]
          Length = 139

 Score =  192 bits (488), Expect = 5e-49
 Identities = 91/132 (68%), Positives = 109/132 (82%)
 Frame = +3

Query: 450 QDANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAASKVTEQEWREKAKKDLE 629
           +++NGP D YAAI+Q DRL  EPESIRKWREEQ +RL+ LDA S+  E EW+EKA K+LE
Sbjct: 6   RESNGPTDSYAAISQVDRLQSEPESIRKWREEQTERLEALDANSRKQEAEWKEKAIKELE 65

Query: 630 EWNQRQSEQVEKNKINNRASEEAFVKESKEETPGTEWEKVAQLCDFNPKSSKQCKDVSRL 809
           EW  RQ EQ++K K NNRA+EEAFV +  E +PGTEWE+VA+LCDFNPKSSKQ KDVSR+
Sbjct: 66  EWYARQDEQLQKTKANNRAAEEAFVNDIDESSPGTEWERVARLCDFNPKSSKQAKDVSRM 125

Query: 810 RSVLMSLKQTPL 845
           RSVL+SLKQ PL
Sbjct: 126 RSVLISLKQAPL 137


  Database: RefSeqCP
    Posted date:  Aug 1, 2006  9:25 PM
  Number of letters in database: 19,266,565
  Number of sequences in database:  33,732
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 44,843,298
Number of Sequences: 33732
Number of extensions: 1235189
Number of successful extensions: 10206
Number of sequences better than 1.0e-05: 10
Number of HSP's better than  0.0 without gapping: 6376
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 9927
length of database: 19,266,565
effective HSP length: 105
effective length of database: 15,724,705
effective search space used: 4418642105
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqSP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= LVRM1_0083_F07
         (1160 letters)

Database: RefSeqSP 
           1040 sequences; 434,620 total letters

Searching...done

 ***** No hits found ******

  Database: RefSeqSP
    Posted date:  Aug 1, 2006  7:14 PM
  Number of letters in database: 434,620
  Number of sequences in database:  1040
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 979,534
Number of Sequences: 1040
Number of extensions: 25121
Number of successful extensions: 188
Number of sequences better than 1.0e-05: 0
Number of HSP's better than  0.0 without gapping: 111
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 176
length of database: 434,620
effective HSP length: 78
effective length of database: 353,500
effective search space used: 108878000
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqHP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= LVRM1_0083_F07
         (1160 letters)

Database: RefSeqHP 
           39,411 sequences; 17,774,539 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_001825.1| clathrin, light polypeptide isoform a [Homo sap...   363   e-100
Alignment   gi|NP_009028.1| clathrin, light polypeptide isoform b [Homo sap...   352   3e-97
Alignment   gi|NP_001824.1| clathrin, light polypeptide A isoform a [Homo s...   233   2e-61
Alignment   gi|NP_009027.1| clathrin, light polypeptide A isoform b [Homo s...   217   1e-56

>ref|NP_001825.1| clathrin, light polypeptide isoform a [Homo sapiens]
          Length = 211

 Score =  363 bits (932), Expect = e-100
 Identities = 184/211 (87%), Positives = 185/211 (87%)
 Frame = +3

Query: 219 MADDXXXXXXXXXXXXXXXXXXXXXXFLAQQESEIAGIENDEGFGAPAGSQAALAQPGPA 398
           MADD                      FLAQQESEIAGIENDEGFGAPAGS AA AQPGP 
Sbjct: 1   MADDFGFFSSSESGAPEAAEEDPAAAFLAQQESEIAGIENDEGFGAPAGSHAAPAQPGPT 60

Query: 399 SGAGPEDMGTTVNGDVFQDANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAA 578
           SGAG EDMGTTVNGDVFQ+ANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAA
Sbjct: 61  SGAGSEDMGTTVNGDVFQEANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAA 120

Query: 579 SKVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNRASEEAFVKESKEETPGTEWEKVAQL 758
           SKVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNRASEEAFVKESKEETPGTEWEKVAQL
Sbjct: 121 SKVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNRASEEAFVKESKEETPGTEWEKVAQL 180

Query: 759 CDFNPKSSKQCKDVSRLRSVLMSLKQTPLSR 851
           CDFNPKSSKQCKDVSRLRSVLMSLKQTPLSR
Sbjct: 181 CDFNPKSSKQCKDVSRLRSVLMSLKQTPLSR 211


>ref|NP_009028.1| clathrin, light polypeptide isoform b [Homo sapiens]
          Length = 229

 Score =  352 bits (903), Expect = 3e-97
 Identities = 184/229 (80%), Positives = 185/229 (80%), Gaps = 18/229 (7%)
 Frame = +3

Query: 219 MADDXXXXXXXXXXXXXXXXXXXXXXFLAQQESEIAGIENDEGFGAPAGSQAALAQPGPA 398
           MADD                      FLAQQESEIAGIENDEGFGAPAGS AA AQPGP 
Sbjct: 1   MADDFGFFSSSESGAPEAAEEDPAAAFLAQQESEIAGIENDEGFGAPAGSHAAPAQPGPT 60

Query: 399 SGAGPEDMGTTVNGDVFQDANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAA 578
           SGAG EDMGTTVNGDVFQ+ANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAA
Sbjct: 61  SGAGSEDMGTTVNGDVFQEANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAA 120

Query: 579 SKVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNR------------------ASEEAFV 704
           SKVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNR                  ASEEAFV
Sbjct: 121 SKVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNRIADKAFYQQPDADIIGYVASEEAFV 180

Query: 705 KESKEETPGTEWEKVAQLCDFNPKSSKQCKDVSRLRSVLMSLKQTPLSR 851
           KESKEETPGTEWEKVAQLCDFNPKSSKQCKDVSRLRSVLMSLKQTPLSR
Sbjct: 181 KESKEETPGTEWEKVAQLCDFNPKSSKQCKDVSRLRSVLMSLKQTPLSR 229


>ref|NP_001824.1| clathrin, light polypeptide A isoform a [Homo sapiens]
          Length = 218

 Score =  233 bits (594), Expect = 2e-61
 Identities = 117/183 (63%), Positives = 139/183 (75%)
 Frame = +3

Query: 297 FLAQQESEIAGIENDEGFGAPAGSQAALAQPGPASGAGPEDMGTTVNGDVFQDANGPADG 476
           FLAQQESEIAGIENDE F    G  A   QP      GP+ +   +NG+ +Q++NGP D 
Sbjct: 35  FLAQQESEIAGIENDEAFAILDGG-APGPQPHGEPPGGPDAVDGVMNGEYYQESNGPTDS 93

Query: 477 YAAIAQADRLTQEPESIRKWREEQRKRLQELDAASKVTEQEWREKAKKDLEEWNQRQSEQ 656
           YAAI+Q DRL  EPESIRKWREEQ +RL+ LDA S+  E EW+EKA K+LEEW  RQ EQ
Sbjct: 94  YAAISQVDRLQSEPESIRKWREEQMERLEALDANSRKQEAEWKEKAIKELEEWYARQDEQ 153

Query: 657 VEKNKINNRASEEAFVKESKEETPGTEWEKVAQLCDFNPKSSKQCKDVSRLRSVLMSLKQ 836
           ++K K NNRA+EEAFV +  E +PGTEWE+VA+LCDFNPKSSKQ KDVSR+RSVL+SLKQ
Sbjct: 154 LQKTKANNRAAEEAFVNDIDESSPGTEWERVARLCDFNPKSSKQAKDVSRMRSVLISLKQ 213

Query: 837 TPL 845
            PL
Sbjct: 214 APL 216


>ref|NP_009027.1| clathrin, light polypeptide A isoform b [Homo sapiens]
          Length = 248

 Score =  217 bits (553), Expect = 1e-56
 Identities = 117/213 (54%), Positives = 139/213 (65%), Gaps = 30/213 (14%)
 Frame = +3

Query: 297 FLAQQESEIAGIENDEGFGAPAGSQAALAQPGPASGAGPEDMGTTVNGDVFQDANGPADG 476
           FLAQQESEIAGIENDE F    G  A   QP      GP+ +   +NG+ +Q++NGP D 
Sbjct: 35  FLAQQESEIAGIENDEAFAILDGG-APGPQPHGEPPGGPDAVDGVMNGEYYQESNGPTDS 93

Query: 477 YAAIAQADRLTQEPESIRKWREEQRKRLQELDAASKVTEQEWREKAKKDLEEWNQRQSEQ 656
           YAAI+Q DRL  EPESIRKWREEQ +RL+ LDA S+  E EW+EKA K+LEEW  RQ EQ
Sbjct: 94  YAAISQVDRLQSEPESIRKWREEQMERLEALDANSRKQEAEWKEKAIKELEEWYARQDEQ 153

Query: 657 VEKNKINNR------------------------------ASEEAFVKESKEETPGTEWEK 746
           ++K K NNR                              A+EEAFV +  E +PGTEWE+
Sbjct: 154 LQKTKANNRVADEAFYKQPFADVIGYVTNINHPCYSLEQAAEEAFVNDIDESSPGTEWER 213

Query: 747 VAQLCDFNPKSSKQCKDVSRLRSVLMSLKQTPL 845
           VA+LCDFNPKSSKQ KDVSR+RSVL+SLKQ PL
Sbjct: 214 VARLCDFNPKSSKQAKDVSRMRSVLISLKQAPL 246


  Database: RefSeqHP
    Posted date:  Aug 2, 2006 12:57 AM
  Number of letters in database: 17,774,539
  Number of sequences in database:  39,411
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 43,868,156
Number of Sequences: 39411
Number of extensions: 1262053
Number of successful extensions: 10115
Number of sequences better than 1.0e-05: 4
Number of HSP's better than  0.0 without gapping: 6074
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 9874
length of database: 17,774,539
effective HSP length: 104
effective length of database: 13,675,795
effective search space used: 3856574190
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqMP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= LVRM1_0083_F07
         (1160 letters)

Database: RefSeqMP 
           45,328 sequences; 21,768,885 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_083146.1| clathrin, light polypeptide (Lcb) [Mus musculus]     352   4e-97
Alignment   gi|NP_058040.1| clathrin, light polypeptide (Lca) [Mus musculus]     218   1e-56

>ref|NP_083146.1| clathrin, light polypeptide (Lcb) [Mus musculus]
          Length = 211

 Score =  352 bits (903), Expect = 4e-97
 Identities = 179/211 (84%), Positives = 182/211 (86%)
 Frame = +3

Query: 219 MADDXXXXXXXXXXXXXXXXXXXXXXFLAQQESEIAGIENDEGFGAPAGSQAALAQPGPA 398
           MA+D                      FLAQQESEIAGIEND GFGAPA SQ A AQPG A
Sbjct: 1   MAEDFGFFSSSESGAPEAAEEDPAAAFLAQQESEIAGIENDPGFGAPAASQVASAQPGLA 60

Query: 399 SGAGPEDMGTTVNGDVFQDANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAA 578
           SGAG EDM TTVNGDVFQ+ANGPADGYAAIAQADRLTQEPESIRKWREEQ+KRLQELDAA
Sbjct: 61  SGAGSEDMSTTVNGDVFQEANGPADGYAAIAQADRLTQEPESIRKWREEQKKRLQELDAA 120

Query: 579 SKVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNRASEEAFVKESKEETPGTEWEKVAQL 758
           SKVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNRASEEAFVKESKEETPGTEWEKVAQL
Sbjct: 121 SKVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNRASEEAFVKESKEETPGTEWEKVAQL 180

Query: 759 CDFNPKSSKQCKDVSRLRSVLMSLKQTPLSR 851
           CDFNPKSSKQCKDVSRLRSVLMSLKQTPLSR
Sbjct: 181 CDFNPKSSKQCKDVSRLRSVLMSLKQTPLSR 211


>ref|NP_058040.1| clathrin, light polypeptide (Lca) [Mus musculus]
          Length = 235

 Score =  218 bits (554), Expect = 1e-56
 Identities = 115/204 (56%), Positives = 139/204 (68%), Gaps = 21/204 (10%)
 Frame = +3

Query: 297 FLAQQESEIAGIENDEGFGAPAGSQAALAQPGPAS---GAGPEDMGTTVNGDVFQDANGP 467
           FLA +ESEIAGIENDE F    G       PG A+   G GP+ +   +NG+ +Q++NGP
Sbjct: 35  FLAHEESEIAGIENDEAFAILDGGA-----PGRATRRAGGGPDAVDGVMNGEYYQESNGP 89

Query: 468 ADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAASKVTEQEWREKAKKDLEEWNQRQ 647
            D YAAI++ DRL  EPESIRKWREEQ +RL+ LDA S+  E EW+EKA K+LEEW  RQ
Sbjct: 90  TDSYAAISEVDRLQSEPESIRKWREEQTERLEALDANSRKQEAEWKEKAIKELEEWYARQ 149

Query: 648 SEQVEKNKINNRASEEAFVKES------------------KEETPGTEWEKVAQLCDFNP 773
            EQ++K K NNRA+EEAF K+                    E +PGTEWE+VA LCDFNP
Sbjct: 150 DEQLQKTKANNRAAEEAFYKQPFADVIGYVAAEEAFVNDIDESSPGTEWERVAPLCDFNP 209

Query: 774 KSSKQCKDVSRLRSVLMSLKQTPL 845
           KSSKQ KDVSR+RSVL+SLKQ PL
Sbjct: 210 KSSKQAKDVSRMRSVLISLKQAPL 233


  Database: RefSeqMP
    Posted date:  Aug 2, 2006 12:58 AM
  Number of letters in database: 21,768,885
  Number of sequences in database:  45,328
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 50,729,862
Number of Sequences: 45328
Number of extensions: 1373206
Number of successful extensions: 12016
Number of sequences better than 1.0e-05: 2
Number of HSP's better than  0.0 without gapping: 6792
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 10774
length of database: 21,768,885
effective HSP length: 105
effective length of database: 17,009,445
effective search space used: 4779654045
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)