Animal-Genome cDNA LVRM1_0110_B08


Search to RefSeqBP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= LVRM1_0110_B08
         (1546 letters)

Database: RefSeqBP 
           33,508 sequences; 16,112,626 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|XP_582319.2| PREDICTED: similar to retinol dehydrogenase 14 ...   563   e-160
Alignment   gi|NP_899207.1| double substrate-specificity short chain dehydr...   245   8e-65
Alignment   gi|XP_592820.2| PREDICTED: similar to retinol dehydrogenase 11 ...   213   3e-55
Alignment   gi|XP_870721.1| PREDICTED: similar to Retinol dehydrogenase 11 ...   183   3e-46
Alignment   gi|XP_582373.2| PREDICTED: similar to Retinol dehydrogenase 11 ...   179   4e-45
Alignment   gi|XP_584642.2| PREDICTED: similar to retinol dehydrogenase 11 ...   157   2e-38
Alignment   gi|XP_584810.2| PREDICTED: similar to retinol dehydrogenase 13 ...   141   2e-33
Alignment   gi|XP_591168.2| PREDICTED: similar to dehydrogenase/reductase (...   139   5e-33
Alignment   gi|XP_584629.2| PREDICTED: similar to Retinol dehydrogenase 13,...   104   2e-22
Alignment   gi|XP_583859.2| PREDICTED: similar to short chain dehydrogenase...    98   2e-20

>ref|XP_582319.2| PREDICTED: similar to retinol dehydrogenase 14 (all-trans and 9-cis)
            [Bos taurus]
          Length = 420

 Score =  563 bits (1452), Expect = e-160
 Identities = 291/364 (79%), Positives = 302/364 (82%)
 Frame = +1

Query: 1    VQVAALAPGARRLRKSCEGDGGPSXXXXXXXXXXXXXXXXXXXXXXXXXRRFVGPSVQRL 180
            VQVA   PG  R RKS  G GGPS                         RRFVG SVQRL
Sbjct: 57   VQVAGFGPGKPRPRKSRAGAGGPSAPVAMAVGTAAALLAALGGILWLAARRFVGSSVQRL 116

Query: 181  HRGGDSGLMHGKTVLITGANSGLGRATAAELLRLGARVIMGCRDRARAEEAAGQLRRELR 360
            H+G DSGLM GKTVLITGANSGLGRATAAELLRLGARVIMGCRDR RAEEAAGQLRRE+ 
Sbjct: 117  HQGRDSGLMRGKTVLITGANSGLGRATAAELLRLGARVIMGCRDRERAEEAAGQLRREVC 176

Query: 361  QTEGPEEGPNSGGAGELVVRELDLASLRSVRAFCQEMLQEEPRLDVLINNAGIFQCPYMK 540
               GP+ GPNSGGAGELVV+ELDLASL SVR+FCQEMLQEEPRLDVLINNAG+FQCPYMK
Sbjct: 177  PAGGPDSGPNSGGAGELVVKELDLASLSSVRSFCQEMLQEEPRLDVLINNAGVFQCPYMK 236

Query: 541  TEDGFEMQFAVXXXXXXXXXXXXXXXXKSSAPSRIVVVSSKLYKYGDINFEDLNSEQSYN 720
            TEDGFEMQF V                KSSAPSRIVVVSSKLYKYGDINFEDLNSEQSYN
Sbjct: 237  TEDGFEMQFGVNHLGHFLLTNLLLGLLKSSAPSRIVVVSSKLYKYGDINFEDLNSEQSYN 296

Query: 721  KSFCYSRSKLANILFTRELARRLEGTNVTVNVLHPGIVRTNLGRHIHIPLLVKPLFNLVS 900
            KSFCYSRSKLANILFTRELARRLEGT+VTVNVLHPGIVRTNLGRHIHIPLLV+PLFNLVS
Sbjct: 297  KSFCYSRSKLANILFTRELARRLEGTSVTVNVLHPGIVRTNLGRHIHIPLLVRPLFNLVS 356

Query: 901  WAFFKTPAEGAQTSVYLASSPEVEGVSGKYFGDCKEEELLPKAMDDSVARKLWDISEVMV 1080
            WAFFKTP EGAQT+VYLASSPEVEGVSG+YFGDCKEEELLPKAMD+SVARKLWDISEVMV
Sbjct: 357  WAFFKTPEEGAQTAVYLASSPEVEGVSGRYFGDCKEEELLPKAMDESVARKLWDISEVMV 416

Query: 1081 GILK 1092
            GILK
Sbjct: 417  GILK 420


>ref|NP_899207.1| double substrate-specificity short chain dehydrogenase/reductase 2
            [Bos taurus]
          Length = 316

 Score =  245 bits (625), Expect = 8e-65
 Identities = 133/313 (42%), Positives = 190/313 (60%), Gaps = 3/313 (0%)
 Frame = +1

Query: 157  VGPSVQRLHRGG---DSGLMHGKTVLITGANSGLGRATAAELLRLGARVIMGCRDRARAE 327
            + PS+++   GG       + GK V+ITGAN+G+G+ TA EL R GARV + CRD  + E
Sbjct: 18   IAPSIRKFFAGGVCRTDVQLFGKVVVITGANTGIGKETARELARRGARVYIACRDVLKGE 77

Query: 328  EAAGQLRRELRQTEGPEEGPNSGGAGELVVRELDLASLRSVRAFCQEMLQEEPRLDVLIN 507
             AA +++ + + ++             ++VR+LDL+  +S+RAF +  L EE +L +LIN
Sbjct: 78   SAASEIQADTKNSQ-------------VLVRKLDLSDTKSIRAFAEGFLAEEKQLHILIN 124

Query: 508  NAGIFQCPYMKTEDGFEMQFAVXXXXXXXXXXXXXXXXKSSAPSRIVVVSSKLYKYGDIN 687
            NAG+  CPY KT DGFE   AV                K SAP+R+V +SS  +  G I 
Sbjct: 125  NAGVMLCPYSKTADGFETHLAVNHLGHFLLTHLLLGRLKESAPARVVNLSSVAHHLGKIR 184

Query: 688  FEDLNSEQSYNKSFCYSRSKLANILFTRELARRLEGTNVTVNVLHPGIVRTNLGRHIHIP 867
            F DL  ++ YN  F Y  SKLAN+LFTRELA+RL+GT VT   +HPGIVR+ L RH  + 
Sbjct: 185  FHDLQGDKYYNLGFAYCHSKLANVLFTRELAKRLKGTGVTTYAVHPGIVRSKLVRHSFLL 244

Query: 868  LLVKPLFNLVSWAFFKTPAEGAQTSVYLASSPEVEGVSGKYFGDCKEEELLPKAMDDSVA 1047
             L+  LF+     F KT  EGAQTS++ A +  +E +SGKYF DCK+  + P+A ++  A
Sbjct: 245  CLLWRLFS----PFLKTTWEGAQTSLHCALAEGLEPLSGKYFSDCKKTWVSPRARNNKTA 300

Query: 1048 RKLWDISEVMVGI 1086
             +LW++S  ++GI
Sbjct: 301  ERLWNVSCELLGI 313


>ref|XP_592820.2| PREDICTED: similar to retinol dehydrogenase 11 (predicted) [Bos
            taurus]
          Length = 377

 Score =  213 bits (542), Expect = 3e-55
 Identities = 123/296 (41%), Positives = 167/296 (56%), Gaps = 2/296 (0%)
 Frame = +1

Query: 205  MHGKTVLITGANSGLGRATAAELLRLGARVIMGCRDRARAEEAAGQLRRELRQTEGPEEG 384
            + G+T ++TGANSG+G+ TA EL R GARV++ CR R R E AA  LR+E          
Sbjct: 34   LRGRTAVVTGANSGIGKMTALELARRGARVVLACRSRERGEAAAFDLRQE---------- 83

Query: 385  PNSGGAGELVVRELDLASLRSVRAFCQEMLQEEPRLDVLINNAGIFQCPYMKTEDGFEMQ 564
                G  E++   LDLASL SVRAF    L  EPRLD+LI+NAGI  C   +T + F + 
Sbjct: 84   ---SGNNEVIFMALDLASLASVRAFATAFLSSEPRLDILIHNAGISSCG--RTREPFNLL 138

Query: 565  FAVXXXXXXXXXXXXXXXXKSSAPSRIVVVSSKLYKYGDINFEDLNSEQS--YNKSFCYS 738
              V                K+SAPSR+VVVSS  ++ G ++F  L+        +   Y+
Sbjct: 139  LRVNHIGPFLLTHLLLPRLKTSAPSRVVVVSSAAHRRGRLDFTRLDHPVVGWQQELRAYA 198

Query: 739  RSKLANILFTRELARRLEGTNVTVNVLHPGIVRTNLGRHIHIPLLVKPLFNLVSWAFFKT 918
             SKLAN+LF RELA +LEGT VT    HPG V + L    H+P  ++PL   ++W   + 
Sbjct: 199  NSKLANVLFARELATQLEGTGVTCYAAHPGPVNSELFLR-HVPGWLRPLLRPLAWLVLRA 257

Query: 919  PAEGAQTSVYLASSPEVEGVSGKYFGDCKEEELLPKAMDDSVARKLWDISEVMVGI 1086
            P  GAQT +Y A    +E +SG+YF +C  EE+ P A DD  A +LW+ S  + G+
Sbjct: 258  PRGGAQTPLYCALQEGIEPLSGRYFANCHVEEVPPAARDDRAAHRLWEASRKLAGL 313


>ref|XP_870721.1| PREDICTED: similar to Retinol dehydrogenase 11 (Retinal reductase 1)
            (RalR1) (Prostate short-chain dehydrogenase/reductase 1)
            (Androgen-regulated short-chain dehydrogenase/reductase
            1) (HCV core-binding protein HCBP12) isoform 2 [Bos
            taurus]
          Length = 314

 Score =  183 bits (465), Expect = 3e-46
 Identities = 108/292 (36%), Positives = 164/292 (56%)
 Frame = +1

Query: 211  GKTVLITGANSGLGRATAAELLRLGARVIMGCRDRARAEEAAGQLRRELRQTEGPEEGPN 390
            GK  ++TGAN+G+G+ TA EL R GARV + CRD    E  A    RE++   G ++   
Sbjct: 15   GKVAVVTGANAGIGKETAKELARRGARVYLACRDVQNGELVA----REIQMMTGNQQ--- 67

Query: 391  SGGAGELVVRELDLASLRSVRAFCQEMLQEEPRLDVLINNAGIFQCPYMKTEDGFEMQFA 570
                  ++VR+LDLA  +S+RAF +  L++   + ++ ++     C +  +  G +    
Sbjct: 68   ------VLVRKLDLADTKSIRAFAKRFLEDHKYIHLINSSPHFLICGFPGSSAGKDSACN 121

Query: 571  VXXXXXXXXXXXXXXXXKSSAPSRIVVVSSKLYKYGDINFEDLNSEQSYNKSFCYSRSKL 750
                             + SAPSR+V VSS  +  G I+F +L  E+ Y     Y  SKL
Sbjct: 122  TGYLGHFLLTHLLLEKLEESAPSRVVNVSSLAHLLGRIHFHNLQGEKFYQSGLAYCHSKL 181

Query: 751  ANILFTRELARRLEGTNVTVNVLHPGIVRTNLGRHIHIPLLVKPLFNLVSWAFFKTPAEG 930
            ANILFT+ELARRL+G+ VTV  +HPG V + L RH  +   +  +F+     F KTP +G
Sbjct: 182  ANILFTQELARRLKGSGVTVYSVHPGTVNSELVRHSALMRWIWWIFSF----FIKTPQQG 237

Query: 931  AQTSVYLASSPEVEGVSGKYFGDCKEEELLPKAMDDSVARKLWDISEVMVGI 1086
            AQTS+Y A +  +E +SG +F DC    +  +A +++VAR+LWD+S  ++GI
Sbjct: 238  AQTSLYCALTEGLEVLSGNHFSDCHVAWVSAQARNETVARRLWDVSCDLLGI 289


>ref|XP_582373.2| PREDICTED: similar to Retinol dehydrogenase 11 (Retinal reductase 1)
            (RalR1) (Prostate short-chain dehydrogenase/reductase 1)
            (Androgen-regulated short-chain dehydrogenase/reductase
            1) (HCV core-binding protein HCBP12) isoform 1 [Bos
            taurus]
          Length = 308

 Score =  179 bits (455), Expect = 4e-45
 Identities = 111/292 (38%), Positives = 164/292 (56%)
 Frame = +1

Query: 211  GKTVLITGANSGLGRATAAELLRLGARVIMGCRDRARAEEAAGQLRRELRQTEGPEEGPN 390
            GK  ++TGAN+G+G+ TA EL R GARV + CRD    E  A    RE++   G ++   
Sbjct: 15   GKVAVVTGANAGIGKETAKELARRGARVYLACRDVQNGELVA----REIQMMTGNQQ--- 67

Query: 391  SGGAGELVVRELDLASLRSVRAFCQEMLQEEPRLDVLINNAGIFQCPYMKTEDGFEMQFA 570
                  ++VR+LDLA  +S+RAF +  L++   +  LIN+ G     +  +  G +    
Sbjct: 68   ------VLVRKLDLADTKSIRAFAKRFLEDHKYIH-LINSVG-----FPGSSAGKDSACN 115

Query: 571  VXXXXXXXXXXXXXXXXKSSAPSRIVVVSSKLYKYGDINFEDLNSEQSYNKSFCYSRSKL 750
                             + SAPSR+V VSS  +  G I+F +L  E+ Y     Y  SKL
Sbjct: 116  TGYLGHFLLTHLLLEKLEESAPSRVVNVSSLAHLLGRIHFHNLQGEKFYQSGLAYCHSKL 175

Query: 751  ANILFTRELARRLEGTNVTVNVLHPGIVRTNLGRHIHIPLLVKPLFNLVSWAFFKTPAEG 930
            ANILFT+ELARRL+G+ VTV  +HPG V + L RH  +   +  +F+     F KTP +G
Sbjct: 176  ANILFTQELARRLKGSGVTVYSVHPGTVNSELVRHSALMRWIWWIFSF----FIKTPQQG 231

Query: 931  AQTSVYLASSPEVEGVSGKYFGDCKEEELLPKAMDDSVARKLWDISEVMVGI 1086
            AQTS+Y A +  +E +SG +F DC    +  +A +++VAR+LWD+S  ++GI
Sbjct: 232  AQTSLYCALTEGLEVLSGNHFSDCHVAWVSAQARNETVARRLWDVSCDLLGI 283


>ref|XP_584642.2| PREDICTED: similar to retinol dehydrogenase 11 (predicted) [Bos
            taurus]
          Length = 330

 Score =  157 bits (397), Expect = 2e-38
 Identities = 101/290 (34%), Positives = 161/290 (55%), Gaps = 4/290 (1%)
 Frame = +1

Query: 211  GKTVLITGANSGLGRATAAELLRLGARVIMGCRDRARAEEAAGQLRRELRQTEGPEEGPN 390
            GKT ++TGANSG+G+A + EL   GARVI+ CR R R ++A  +++   +          
Sbjct: 49   GKTAVVTGANSGIGKAVSQELAHRGARVILACRSRERGQQALAEIQATSK---------- 98

Query: 391  SGGAGELVVRELDLASLRSVRAFCQEMLQEEPRLDVLINNAGIFQCPYMKTEDGFEMQFA 570
               +  L++ E+DL+S+ S+R+F Q +LQE P + +L+NNA +   P   T +G ++ FA
Sbjct: 99   ---SNRLLLGEVDLSSMASIRSFAQRLLQECPEIHLLVNNAAVCGFPTTLTPEGLDLTFA 155

Query: 571  VXXXXXXXXXXXXXXXXKSSAPSRIVVVSSKLYKYGDINFEDL---NSEQSYNKSFCYSR 741
                             + +  +R+V VSS    +G I+ + L       ++N++  Y  
Sbjct: 156  TNYTGPFLLTNLLQGALQRAGSARVVNVSSFRQSHGYIDEDHLIGAGRPLTFNQN--YDC 213

Query: 742  SKLANILFTRELARRLEGTNVTVNVLHPGIVRTNLGRHIHIPLLVKPLFNLVSWAFFKTP 921
            SKL    FT +LA+RL+GT VTVN + PG+V T + +  H     + LF L+S+ FFK  
Sbjct: 214  SKLLLASFTGKLAQRLQGTGVTVNSVDPGVVYTKIMK--HFSWSYRFLFWLLSF-FFKDS 270

Query: 922  AEGAQTSVYLASSPEVEGVSGKYFGDCKEEELLPK-AMDDSVARKLWDIS 1068
             +GA   +YL+ + E++G+SGK+F       L P+ A D  VA+ LW+ S
Sbjct: 271  KQGAVPVLYLSLAKELDGISGKHFSSSCVITLPPEAAQDPHVAQSLWNTS 320


>ref|XP_584810.2| PREDICTED: similar to retinol dehydrogenase 13 (all-trans and 9-cis)
            [Bos taurus]
          Length = 223

 Score =  141 bits (355), Expect = 2e-33
 Identities = 79/158 (50%), Positives = 104/158 (65%), Gaps = 3/158 (1%)
 Frame = +1

Query: 622  KSSAPSRIVVVSSKLYKYGDINFEDLNSEQ-SYNKSFCYSRSKLANILFTRELARRLEGT 798
            K+SAPSRI+ VSS  +  G I+FEDLN E+  Y+    Y +SKLA ++ T+EL+RRL+GT
Sbjct: 50   KASAPSRIINVSSLAHVAGHIDFEDLNWEKRKYDTKAAYCQSKLAVVVSTKELSRRLQGT 109

Query: 799  NVTVNVLHPGIVRTNLGRHIHIPLLVKPLFNL--VSWAFFKTPAEGAQTSVYLASSPEVE 972
             VTVN LHPG+ RT LGRH  +       F L  + W   K+P   AQ SVYLA + E+E
Sbjct: 110  GVTVNALHPGVARTELGRHTGMHSSAFSSFTLGPIFWLLVKSPELAAQPSVYLAVAEELE 169

Query: 973  GVSGKYFGDCKEEELLPKAMDDSVARKLWDISEVMVGI 1086
            GVSGKYF   KE+   P+A D+ VA++LW  S  +VG+
Sbjct: 170  GVSGKYFDVLKEKPPAPEAEDEEVAKRLWAESVRLVGL 207


>ref|XP_591168.2| PREDICTED: similar to dehydrogenase/reductase (SDR family) X-linked
            [Bos taurus]
          Length = 251

 Score =  139 bits (351), Expect = 5e-33
 Identities = 91/227 (40%), Positives = 123/227 (54%), Gaps = 7/227 (3%)
 Frame = +1

Query: 427  DLASLRSVRAFCQEMLQEEPRLDVLINNAGIFQCPYMKTEDGFEMQFAVXXXXXXXXXXX 606
            DLAS+RS+R F Q    ++  L VL+NNAG+   P   TEDGFE  F V           
Sbjct: 11   DLASMRSIREFVQTFKMKKLPLHVLVNNAGVMMVPQRTTEDGFEEHFGVNYLGHFLLTNL 70

Query: 607  XXXXXKSS-AP---SRIVVVSSKLYKYGDINFEDLNSEQSYNKSFCYSRSKLANILFTRE 774
                 + S AP   +R+V VSS  +  G++N +DL S   Y+    Y++SKLA +LFT  
Sbjct: 71   LLDTLQESGAPGHSARVVTVSSATHYVGELNLDDLQSSTYYSAHAAYAQSKLALVLFTYH 130

Query: 775  LARRL--EGTNVTVNVLHPGIVRTNLGRHIHIPL-LVKPLFNLVSWAFFKTPAEGAQTSV 945
            L   L  +G  VT +V  PG+V T+L R++     LVK    L+ W  FKTP EGA TSV
Sbjct: 131  LQALLTAQGMPVTASVADPGVVDTDLYRYVFWGTRLVK---KLLGWWVFKTPDEGAWTSV 187

Query: 946  YLASSPEVEGVSGKYFGDCKEEELLPKAMDDSVARKLWDISEVMVGI 1086
            Y A +P +EG+ G+Y  + KE   L    D  + R+LW  S  + GI
Sbjct: 188  YAAVTPALEGLGGRYLYNEKETRSLEATYDPELQRQLWARSCQLTGI 234


>ref|XP_584629.2| PREDICTED: similar to Retinol dehydrogenase 13, partial [Bos
           taurus]
          Length = 148

 Score =  104 bits (259), Expect = 2e-22
 Identities = 52/121 (42%), Positives = 74/121 (61%)
 Frame = +1

Query: 211 GKTVLITGANSGLGRATAAELLRLGARVIMGCRDRARAEEAAGQLRRELRQTEGPEEGPN 390
           GKTV++TGAN+G+G+ TA EL + G  +I+ CRD  + E AA ++R E            
Sbjct: 38  GKTVIVTGANTGIGKQTALELAKRGGNIILACRDMEKCEAAAKEIRGETLNHR------- 90

Query: 391 SGGAGELVVRELDLASLRSVRAFCQEMLQEEPRLDVLINNAGIFQCPYMKTEDGFEMQFA 570
                 +  R LDLASL+S+R F  ++ +EE  + +LINNA + +CP+  TEDGFEMQ  
Sbjct: 91  ------VNARHLDLASLKSIREFAAKVTEEEEHVHILINNAAVMRCPHWTTEDGFEMQLG 144

Query: 571 V 573
           V
Sbjct: 145 V 145


>ref|XP_583859.2| PREDICTED: similar to short chain dehydrogenase/reductase [Bos
            taurus]
          Length = 317

 Score = 98.2 bits (243), Expect = 2e-20
 Identities = 80/267 (29%), Positives = 124/267 (46%), Gaps = 2/267 (0%)
 Frame = +1

Query: 211  GKTVLITGANSGLGRATAAELLRLGARVIMGCRDRARAEEAAGQLRRELRQTEGPEEGPN 390
            G+  ++TG NSG+G+ATA E+ + G  V + CRD +RAE A  ++ RE            
Sbjct: 40   GRAFMVTGGNSGIGKATAMEIAKRGGTVHLVCRDHSRAEGAKAEIIRE------------ 87

Query: 391  SGGAGELVVRELDLASLRSVRAFCQEMLQEEPRLDVLINNAGIFQCPYMKTEDGFEMQFA 570
              G   + +  +DL+  +SV  F +   QE   L+VLINNAG        TEDG E  FA
Sbjct: 88   -SGNQNIFLHIVDLSLPKSVWKFVENFKQEH-TLNVLINNAGCMVNKRELTEDGLEKNFA 145

Query: 571  VXXXXXXXXXXXXXXXXKSSAPSRIVVVSSKLYKYGDINFEDLNSEQ-SYNKSFCYSRSK 747
                             +     R++ VSS       +N +D  SE+ +++ +  Y+++K
Sbjct: 146  TNTLGVYVLTTALIPVLEKEHDPRVITVSSGGMLVQKLNTDDPQSERTAFDGTMVYAQNK 205

Query: 748  LANILFTRELARRLEGTNVTVNVLHPGIVRTNLGRHIHIPLLVKPLFNLVSWAFFKTPAE 927
               ++ T   AR      +  + +HPG V T   R      L  P F+    A  ++ A+
Sbjct: 206  RQQVVLTERWARAHPA--IHFSCMHPGWVDTPGVR------LSMPGFHARLGARLRSEAQ 257

Query: 928  GAQTSVYLASSPEVEG-VSGKYFGDCK 1005
            GA T ++LA +P      SG +F D K
Sbjct: 258  GADTVLWLALAPAATAQPSGCFFQDRK 284


  Database: RefSeqBP
    Posted date:  Aug 1, 2006  7:14 PM
  Number of letters in database: 16,112,626
  Number of sequences in database:  33,508
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 45,143,401
Number of Sequences: 33508
Number of extensions: 1056881
Number of successful extensions: 3619
Number of sequences better than 1.0e-05: 10
Number of HSP's better than  0.0 without gapping: 3167
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3553
length of database: 16,112,626
effective HSP length: 106
effective length of database: 12,560,778
effective search space used: 5124797424
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqCP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= LVRM1_0110_B08
         (1546 letters)

Database: RefSeqCP 
           33,732 sequences; 19,266,565 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|XP_540096.2| PREDICTED: similar to retinol dehydrogenase 14 ...   550   e-156
Alignment   gi|XP_857582.1| PREDICTED: similar to retinol dehydrogenase 14 ...   474   e-133
Alignment   gi|XP_547866.2| PREDICTED: similar to retinol dehydrogenase 12 ...   239   7e-63
Alignment   gi|XP_854127.1| PREDICTED: similar to Retinol dehydrogenase 13 ...   237   3e-62
Alignment   gi|XP_854354.1| PREDICTED: similar to Retinol dehydrogenase 11 ...   227   3e-59
Alignment   gi|XP_548293.2| PREDICTED: similar to retinol dehydrogenase 11 ...   207   2e-53
Alignment   gi|XP_857503.1| PREDICTED: similar to retinol dehydrogenase 14 ...   187   2e-47
Alignment   gi|XP_852222.1| PREDICTED: similar to dehydrogenase/reductase (...   168   2e-41
Alignment   gi|XP_533000.2| PREDICTED: similar to Retinol dehydrogenase 12 ...   153   4e-37
Alignment   gi|XP_852623.1| PREDICTED: similar to WW domain-containing oxid...   125   9e-29

>ref|XP_540096.2| PREDICTED: similar to retinol dehydrogenase 14 (all-trans and 9-cis)
            isoform 1 [Canis familiaris]
          Length = 336

 Score =  550 bits (1417), Expect = e-156
 Identities = 281/315 (89%), Positives = 287/315 (91%)
 Frame = +1

Query: 148  RRFVGPSVQRLHRGGDSGLMHGKTVLITGANSGLGRATAAELLRLGARVIMGCRDRARAE 327
            RRFVGP VQ+LH GGDSGLMHGKTVLITGANSGLGRATAA LLRLGARVIMGCRDRARAE
Sbjct: 22   RRFVGPGVQQLHGGGDSGLMHGKTVLITGANSGLGRATAAALLRLGARVIMGCRDRARAE 81

Query: 328  EAAGQLRRELRQTEGPEEGPNSGGAGELVVRELDLASLRSVRAFCQEMLQEEPRLDVLIN 507
            EAAGQLRRELRQ  G E G + G AGELVVRELDLASLRSVRAFCQE+LQEEPRLDVLIN
Sbjct: 82   EAAGQLRRELRQAGGREPGSDVGAAGELVVRELDLASLRSVRAFCQEVLQEEPRLDVLIN 141

Query: 508  NAGIFQCPYMKTEDGFEMQFAVXXXXXXXXXXXXXXXXKSSAPSRIVVVSSKLYKYGDIN 687
            NAGIFQCPYMKTEDGFEMQF V                K+SAPSRIVVVSSKLYKYGDIN
Sbjct: 142  NAGIFQCPYMKTEDGFEMQFGVNHLGHFLLTNLLLGLLKNSAPSRIVVVSSKLYKYGDIN 201

Query: 688  FEDLNSEQSYNKSFCYSRSKLANILFTRELARRLEGTNVTVNVLHPGIVRTNLGRHIHIP 867
            FEDLNSEQSYNKSFCYSRSKLANILFTRELARRLEGTNVTVNVLHPGIVRTNLGRHIHIP
Sbjct: 202  FEDLNSEQSYNKSFCYSRSKLANILFTRELARRLEGTNVTVNVLHPGIVRTNLGRHIHIP 261

Query: 868  LLVKPLFNLVSWAFFKTPAEGAQTSVYLASSPEVEGVSGKYFGDCKEEELLPKAMDDSVA 1047
            LLV+PLFNLVSWAFFKTP EGAQTSVYLASSPEVEGVSGKYFGDCKEEELLPKAMD+SVA
Sbjct: 262  LLVRPLFNLVSWAFFKTPVEGAQTSVYLASSPEVEGVSGKYFGDCKEEELLPKAMDESVA 321

Query: 1048 RKLWDISEVMVGILK 1092
            RKLWDISEVMVGILK
Sbjct: 322  RKLWDISEVMVGILK 336


>ref|XP_857582.1| PREDICTED: similar to retinol dehydrogenase 14 (all-trans and 9-cis)
            isoform 4 [Canis familiaris]
          Length = 307

 Score =  474 bits (1220), Expect = e-133
 Identities = 252/315 (80%), Positives = 258/315 (81%)
 Frame = +1

Query: 148  RRFVGPSVQRLHRGGDSGLMHGKTVLITGANSGLGRATAAELLRLGARVIMGCRDRARAE 327
            RRFVGP VQ+LH GGDSGLMHGKTVLITGANSGLGRATAA LLRLGARVIMGCRDRARAE
Sbjct: 22   RRFVGPGVQQLHGGGDSGLMHGKTVLITGANSGLGRATAAALLRLGARVIMGCRDRARAE 81

Query: 328  EAAGQLRRELRQTEGPEEGPNSGGAGELVVRELDLASLRSVRAFCQEMLQEEPRLDVLIN 507
            EAAGQLRRELRQ  G E G + G AGELVVRELDLASLRSVRAFCQE+LQ          
Sbjct: 82   EAAGQLRRELRQAGGREPGSDVGAAGELVVRELDLASLRSVRAFCQEVLQ---------- 131

Query: 508  NAGIFQCPYMKTEDGFEMQFAVXXXXXXXXXXXXXXXXKSSAPSRIVVVSSKLYKYGDIN 687
                               F V                K+SAPSRIVVVSSKLYKYGDIN
Sbjct: 132  -------------------FGVNHLGHFLLTNLLLGLLKNSAPSRIVVVSSKLYKYGDIN 172

Query: 688  FEDLNSEQSYNKSFCYSRSKLANILFTRELARRLEGTNVTVNVLHPGIVRTNLGRHIHIP 867
            FEDLNSEQSYNKSFCYSRSKLANILFTRELARRLEGTNVTVNVLHPGIVRTNLGRHIHIP
Sbjct: 173  FEDLNSEQSYNKSFCYSRSKLANILFTRELARRLEGTNVTVNVLHPGIVRTNLGRHIHIP 232

Query: 868  LLVKPLFNLVSWAFFKTPAEGAQTSVYLASSPEVEGVSGKYFGDCKEEELLPKAMDDSVA 1047
            LLV+PLFNLVSWAFFKTP EGAQTSVYLASSPEVEGVSGKYFGDCKEEELLPKAMD+SVA
Sbjct: 233  LLVRPLFNLVSWAFFKTPVEGAQTSVYLASSPEVEGVSGKYFGDCKEEELLPKAMDESVA 292

Query: 1048 RKLWDISEVMVGILK 1092
            RKLWDISEVMVGILK
Sbjct: 293  RKLWDISEVMVGILK 307


>ref|XP_547866.2| PREDICTED: similar to retinol dehydrogenase 12 (all-trans and 9-cis)
            [Canis familiaris]
          Length = 303

 Score =  239 bits (609), Expect = 7e-63
 Identities = 129/314 (41%), Positives = 188/314 (59%), Gaps = 3/314 (0%)
 Frame = +1

Query: 154  FVGPSVQRLHRGG---DSGLMHGKTVLITGANSGLGRATAAELLRLGARVIMGCRDRARA 324
            FV  + ++   GG    +  + GK V+ITGAN+G+G+ TA EL R GARV + CRD  + 
Sbjct: 4    FVSLAYRKFFAGGVCRSNVQLPGKVVVITGANTGIGKETARELARRGARVYIACRDVLKG 63

Query: 325  EEAAGQLRRELRQTEGPEEGPNSGGAGELVVRELDLASLRSVRAFCQEMLQEEPRLDVLI 504
            E AA ++R + + ++             ++VR+LDL+  +S+RAF +  L EE +L +LI
Sbjct: 64   ESAASEIRADTKNSQ-------------VLVRKLDLSDTKSIRAFAEGFLAEEKQLHILI 110

Query: 505  NNAGIFQCPYMKTEDGFEMQFAVXXXXXXXXXXXXXXXXKSSAPSRIVVVSSKLYKYGDI 684
            NNAG+  CPY KT DGFE    V                K S P+R+V +SS  +  G I
Sbjct: 111  NNAGVMMCPYSKTADGFETHLGVNHLGHFLLTHLLLERLKESTPARVVNLSSVAHHIGKI 170

Query: 685  NFEDLNSEQSYNKSFCYSRSKLANILFTRELARRLEGTNVTVNVLHPGIVRTNLGRHIHI 864
            +F DL  E+ Y++ F Y  SKLAN+LFTRELA+RL+GT VT   +HPG+V + L RH  +
Sbjct: 171  HFHDLQGEKRYSRGFAYCHSKLANMLFTRELAKRLQGTGVTTYAVHPGVVSSELVRHSFL 230

Query: 865  PLLVKPLFNLVSWAFFKTPAEGAQTSVYLASSPEVEGVSGKYFGDCKEEELLPKAMDDSV 1044
              L+  +F+     F K+  EGAQTS++ A +  +E +SGKYF DCK   + P+A D+  
Sbjct: 231  LCLLWRIFS----PFVKSAREGAQTSLHCALAEGLEPLSGKYFSDCKRAWVSPRARDNKT 286

Query: 1045 ARKLWDISEVMVGI 1086
            A +LW++S  ++GI
Sbjct: 287  AERLWNVSCELLGI 300


>ref|XP_854127.1| PREDICTED: similar to Retinol dehydrogenase 13 [Canis familiaris]
          Length = 334

 Score =  237 bits (604), Expect = 3e-62
 Identities = 130/295 (44%), Positives = 180/295 (61%), Gaps = 3/295 (1%)
 Frame = +1

Query: 211  GKTVLITGANSGLGRATAAELLRLGARVIMGCRDRARAEEAAGQLRRELRQTEGPEEGPN 390
            GKTV++TGAN+G+G+ TA EL R G  +I+ CRD  + E AA ++R E            
Sbjct: 38   GKTVIVTGANTGIGKQTALELARRGGNIILACRDMEKCEAAAKEIRGETLNHR------- 90

Query: 391  SGGAGELVVRELDLASLRSVRAFCQEMLQEEPRLDVLINNAGIFQCPYMKTEDGFEMQFA 570
                  +    LDLASL+S+R F  ++++EE ++ +L+NNA + +CP+  T+DGFEMQF 
Sbjct: 91   ------VSAWHLDLASLKSIREFAAKIIEEEEQVHILVNNAAVMRCPHWTTKDGFEMQFG 144

Query: 571  VXXXXXXXXXXXXXXXXKSSAPSRIVVVSSKLYKYGDINFEDLNSE-QSYNKSFCYSRSK 747
            V                K+SAPSRI+ +SS  +  G I+F+DLN E + Y+    Y +SK
Sbjct: 145  VNHLGHFLLTNLLLDKLKASAPSRIINLSSLAHVAGHIDFDDLNWEKRKYDTKAAYCQSK 204

Query: 748  LANILFTRELARRLEGTNVTVNVLHPGIVRTNLGRHIHIPLLVKPLFNL--VSWAFFKTP 921
            LA ILFT+EL+RRL+GT VTVN LHPG+ RT LGRH  +       F L  + W   K+P
Sbjct: 205  LAVILFTKELSRRLQGTGVTVNALHPGVARTELGRHTGMHSSAFSSFTLGPIFWLLVKSP 264

Query: 922  AEGAQTSVYLASSPEVEGVSGKYFGDCKEEELLPKAMDDSVARKLWDISEVMVGI 1086
               AQ S YLA + E+EGVSGKYF   KE+   P+A D+ VA++LW  S  +VG+
Sbjct: 265  QLAAQPSTYLAVAEELEGVSGKYFDGLKEKAPAPEAEDEEVAQRLWAESARLVGL 319


>ref|XP_854354.1| PREDICTED: similar to Retinol dehydrogenase 11 (Retinal reductase 1)
            (RalR1) (Prostate short-chain dehydrogenase/reductase 1)
            (Androgen-regulated short-chain dehydrogenase/reductase
            1) (HCV core-binding protein HCBP12) [Canis familiaris]
          Length = 337

 Score =  227 bits (578), Expect = 3e-59
 Identities = 127/295 (43%), Positives = 174/295 (58%), Gaps = 3/295 (1%)
 Frame = +1

Query: 211  GKTVLITGANSGLGRATAAELLRLGARVIMGCRDRARAEEAAGQLRRELRQTEGPEEGPN 390
            GK  ++TGAN+G+G+ TA EL + GARV + CRD  + E  A    RE++   G ++   
Sbjct: 60   GKVAVVTGANTGIGKETAKELAQRGARVYLACRDVLKGELVA----REIQTMTGNKQ--- 112

Query: 391  SGGAGELVVRELDLASLRSVRAFCQEMLQEEPRLDVLINNAGIFQCPYMKTEDGFEMQFA 570
                  ++VR+LDLA  +S+RAF +  L EE  L +LINNAG+  CPY KT DGFEM   
Sbjct: 113  ------VLVRKLDLADTKSIRAFAKGFLAEEKHLHILINNAGVMMCPYTKTVDGFEMHMG 166

Query: 571  VXXXXXXXXXXXXXXXXKSSAPSRIVVVSSKLYKYGDINFEDLNSEQSYNKSFCYSRSKL 750
            V                K SAPSRIV VSS  +  G I+F DL  E+ YN    Y  SKL
Sbjct: 167  VNHLGHFLLTHLLLEKLKESAPSRIVNVSSLAHHLGRIHFHDLQGEKFYNSGLAYCHSKL 226

Query: 751  ANILFTRELARRLEGTNVTVNVLHPGIVRTNLGRHIHIPLLVKPLFNLVSWA---FFKTP 921
            ANILFT+ELARRL+G+ +T   +HPG V++ L RH        P    + W    F KTP
Sbjct: 227  ANILFTQELARRLKGSGITAYSVHPGTVKSELVRH-------SPFMKWMWWLFSFFIKTP 279

Query: 922  AEGAQTSVYLASSPEVEGVSGKYFGDCKEEELLPKAMDDSVARKLWDISEVMVGI 1086
             +GAQTS+Y A +  +E +SG +F DC    +  +A ++++AR+LWD+S  ++GI
Sbjct: 280  QQGAQTSLYCAITEGLEVLSGHHFSDCSVAWVSAQARNETIARRLWDVSCDLLGI 334


>ref|XP_548293.2| PREDICTED: similar to retinol dehydrogenase 11 (predicted) [Canis
            familiaris]
          Length = 377

 Score =  207 bits (528), Expect = 2e-53
 Identities = 123/301 (40%), Positives = 166/301 (55%), Gaps = 2/301 (0%)
 Frame = +1

Query: 190  GDSGLMHGKTVLITGANSGLGRATAAELLRLGARVIMGCRDRARAEEAAGQLRRELRQTE 369
            G    + G+T ++TGANSG+G+ TA EL R GARV++ CR R R E AA  LR+E     
Sbjct: 29   GGIASLRGRTAVVTGANSGIGKMTALELARRGARVVLACRSRERGEAAAFDLRQE----- 83

Query: 370  GPEEGPNSGGAGELVVRELDLASLRSVRAFCQEMLQEEPRLDVLINNAGIFQCPYMKTED 549
                     G  E++   LDLASL SVRAF    L  EPRLD+LI+NAGI  C   +T  
Sbjct: 84   --------SGNNEVIFMALDLASLASVRAFATAFLSSEPRLDILIHNAGISSCG--RTHK 133

Query: 550  GFEMQFAVXXXXXXXXXXXXXXXXKSSAPSRIVVVSSKLYKYGDINFEDLNSEQS--YNK 723
             F +   V                K+ APSR+VVVSS  ++ G ++F  L+        +
Sbjct: 134  PFNLLLRVNHIGPFLLTHLLLPRLKTCAPSRVVVVSSAAHRRGRLDFTRLDRPVVGWQQE 193

Query: 724  SFCYSRSKLANILFTRELARRLEGTNVTVNVLHPGIVRTNLGRHIHIPLLVKPLFNLVSW 903
               Y+ SKLAN+LF RELA +LEGT VT    HPG V + L    H+P  + PL   ++W
Sbjct: 194  LRAYADSKLANVLFARELATQLEGTGVTCYAAHPGPVNSELFLR-HVPGWLCPLLRPLAW 252

Query: 904  AFFKTPAEGAQTSVYLASSPEVEGVSGKYFGDCKEEELLPKAMDDSVARKLWDISEVMVG 1083
               + P  GAQT +Y A    +E +SG+YF +C  EE+ P A DD  A +LW+ S+ + G
Sbjct: 253  LMLRAPRGGAQTPLYCALQEGIEPLSGRYFANCHVEEVPPAARDDRAAHQLWEASKRLAG 312

Query: 1084 I 1086
            +
Sbjct: 313  L 313


>ref|XP_857503.1| PREDICTED: similar to retinol dehydrogenase 14 (all-trans and
           9-cis) isoform 3 [Canis familiaris]
          Length = 153

 Score =  187 bits (475), Expect = 2e-47
 Identities = 97/110 (88%), Positives = 100/110 (90%)
 Frame = +1

Query: 148 RRFVGPSVQRLHRGGDSGLMHGKTVLITGANSGLGRATAAELLRLGARVIMGCRDRARAE 327
           RRFVGP VQ+LH GGDSGLMHGKTVLITGANSGLGRATAA LLRLGARVIMGCRDRARAE
Sbjct: 22  RRFVGPGVQQLHGGGDSGLMHGKTVLITGANSGLGRATAAALLRLGARVIMGCRDRARAE 81

Query: 328 EAAGQLRRELRQTEGPEEGPNSGGAGELVVRELDLASLRSVRAFCQEMLQ 477
           EAAGQLRRELRQ  G E G + G AGELVVRELDLASLRSVRAFCQE+LQ
Sbjct: 82  EAAGQLRRELRQAGGREPGSDVGAAGELVVRELDLASLRSVRAFCQEVLQ 131


>ref|XP_852222.1| PREDICTED: similar to dehydrogenase/reductase (SDR family) X-linked
            [Canis familiaris]
          Length = 387

 Score =  168 bits (425), Expect = 2e-41
 Identities = 109/298 (36%), Positives = 158/298 (53%), Gaps = 7/298 (2%)
 Frame = +1

Query: 214  KTVLITGANSGLGRATAAELLRLGARVIMGCRDRARAEEAAGQLRRELRQTEGPEEGPNS 393
            +  ++TG   G+G +TA  L RLG  VI+   + + A +   +++ E    +        
Sbjct: 96   RVAIVTGGTDGIGYSTAKHLARLGMHVILAGNNDSSAPDVVRKIQEETLNDK-------- 147

Query: 394  GGAGELVVRELDLASLRSVRAFCQEMLQEEPRLDVLINNAGIFQCPYMKTEDGFEMQFAV 573
                 +     DLASLRS+R F Q+  +++  L VL+NNAG+   P   TEDGFE  F +
Sbjct: 148  -----VEFLYCDLASLRSIRQFVQKFKKKKIPLHVLVNNAGVMMVPERTTEDGFEEHFGL 202

Query: 574  XXXXXXXXXXXXXXXXKSS-AP---SRIVVVSSKLYKYGDINFEDLNSEQSYNKSFCYSR 741
                            K S AP   +R+V VSS  +  G+++ +DL   + Y+    Y++
Sbjct: 203  NYLGHFLLTNLLLDTLKESGAPGRCARVVTVSSATHYIGELDMDDLQGSRCYSPHAAYAQ 262

Query: 742  SKLANILFTRELARRL--EGTNVTVNVLHPGIVRTNLGRHIHIPL-LVKPLFNLVSWAFF 912
            SKLA +LFT  L R L  +G+ VT NV+ PG+V TNL RH+     L+K LF    W FF
Sbjct: 263  SKLALVLFTYHLQRLLAAQGSPVTANVVDPGVVNTNLYRHVFWGTRLIKKLFG---WWFF 319

Query: 913  KTPAEGAQTSVYLASSPEVEGVSGKYFGDCKEEELLPKAMDDSVARKLWDISEVMVGI 1086
            KTP EGA TSVY A +P++EG+ G+Y  + KE + L    D  +  +LW  S  M GI
Sbjct: 320  KTPDEGAWTSVYAAVTPDLEGLGGRYLYNEKETKSLAVTYDLDLQTELWARSCQMTGI 377


>ref|XP_533000.2| PREDICTED: similar to Retinol dehydrogenase 12 [Canis familiaris]
          Length = 596

 Score =  153 bits (387), Expect = 4e-37
 Identities = 104/296 (35%), Positives = 160/296 (54%), Gaps = 2/296 (0%)
 Frame = +1

Query: 211  GKTVLITGANSGLGRATAAELLRLGARVIMGCRDRARAEEAAGQLRRELRQTEGPEEGPN 390
            GKT ++TGANSG+G+A   EL R GARVI+ CR+  R ++A  +++   + T        
Sbjct: 315  GKTAVVTGANSGIGKAVCQELARRGARVILACRNWERGQKALAEIQVASKGT-------- 366

Query: 391  SGGAGELVVRELDLASLRSVRAFCQEMLQEEPRLDVLINNAGIFQCPYMKTEDGFEMQFA 570
                  L++ ++DL+S+ S+R+F + +LQE P + +L+NNA I   P   T +G ++ FA
Sbjct: 367  -----CLLLGQVDLSSMASIRSFARWLLQEYPEIHLLVNNAAISGFPKTLTPEGLDLTFA 421

Query: 571  VXXXXXXXXXXXXXXXXKSSAPSRIVVVSSKLYKYGDINFEDL-NSEQSYNKSFCYSRSK 747
                             + +  +R+V VSS  + +G ++ + L  + +  N    Y  SK
Sbjct: 422  TNYVGPFLLTNLLQGALQRAGSARVVNVSSFRHAHGYVDEKHLTGAGKPLNLIQSYDCSK 481

Query: 748  LANILFTRELARRLEGTNVTVNVLHPGIVRTNLGRHIHIPLLVKPLFNLVSWAFFKTPAE 927
            L    FT ELARRL+GT VTVN + PG+V T + +    P L + LF L S+ F K   +
Sbjct: 482  LLLTSFTGELARRLQGTGVTVNSVDPGVVYTEIMK--PYPWLYRFLFWLFSF-FCKDVKQ 538

Query: 928  GAQTSVYLASSPEVEGVSGKYF-GDCKEEELLPKAMDDSVARKLWDISEVMVGILK 1092
            GA   +YL+ + E++GVSGKYF   C        A D  VA+ LW+ S  +  + K
Sbjct: 539  GAIPVLYLSLAKELDGVSGKYFSSSCMITLPTEAAQDPQVAQSLWNASVQLTNLDK 594


>ref|XP_852623.1| PREDICTED: similar to WW domain-containing oxidoreductase isoform 1
           [Canis familiaris]
          Length = 383

 Score =  125 bits (315), Expect = 9e-29
 Identities = 83/214 (38%), Positives = 108/214 (50%), Gaps = 8/214 (3%)
 Frame = +1

Query: 211 GKTVLITGANSGLGRATAAELLRLGARVIMGCRDRARAEEAAGQLRRELRQTEGPEEGPN 390
           GK V++TGANSG+G  TA      GA VI+ CR+  RA EA  Q+  E  +         
Sbjct: 124 GKVVVVTGANSGIGFETAKSFALHGAHVILACRNMTRANEAVSQILGEWHK--------- 174

Query: 391 SGGAGELVVRELDLASLRSVRAFCQEMLQEEPRLDVLINNAGIFQCPYMKTEDGFEMQFA 570
                ++    LDLA LRSV+ F Q    +   L VL+ NA  F  P+  T+DG E  F 
Sbjct: 175 ----AKVEAMTLDLALLRSVQHFAQAFKAKNVSLHVLVCNAAAFALPWSLTKDGLETTFQ 230

Query: 571 VXXXXXXXXXXXXXXXXKSSAPSRIVVVSSKLYKYGDIN-------FEDLN-SEQSYNKS 726
           V                  SAP+R+VVVSS+ +++ DIN       F  L+ S+  Y   
Sbjct: 231 VNHLGHFYLVQLLQDVLCRSAPARVVVVSSESHRFTDINDSSGKLDFSRLSPSKSDYWAM 290

Query: 727 FCYSRSKLANILFTRELARRLEGTNVTVNVLHPG 828
             Y+RSKL NILF+ EL RRL    VT N +HPG
Sbjct: 291 LAYNRSKLCNILFSNELHRRLSPRGVTSNAVHPG 324


  Database: RefSeqCP
    Posted date:  Aug 1, 2006  9:25 PM
  Number of letters in database: 19,266,565
  Number of sequences in database:  33,732
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 53,054,029
Number of Sequences: 33732
Number of extensions: 1233671
Number of successful extensions: 4506
Number of sequences better than 1.0e-05: 10
Number of HSP's better than  0.0 without gapping: 3809
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4447
length of database: 19,266,565
effective HSP length: 107
effective length of database: 15,657,241
effective search space used: 6372497087
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqSP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= LVRM1_0110_B08
         (1546 letters)

Database: RefSeqSP 
           1040 sequences; 434,620 total letters

Searching...done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_999238.1| 20-beta-hydroxysteroid dehydrogenase [Sus scrofa]     62   3e-11
Alignment   gi|NP_999471.1| 17beta-estradiol dehydrogenase [Sus scrofa]           47   9e-07

>ref|NP_999238.1| 20-beta-hydroxysteroid dehydrogenase [Sus scrofa]
          Length = 289

 Score = 62.4 bits (150), Expect = 3e-11
 Identities = 79/303 (26%), Positives = 119/303 (39%), Gaps = 36/303 (11%)
 Frame = +1

Query: 214  KTVLITGANSGLGRATAAELLR-LGARVIMGCRDRARAEEAAGQLRRELRQTEGPEEGPN 390
            +  L+TGAN G+G A   +L R     V++  RD AR + A  QL     Q EG      
Sbjct: 6    RVALVTGANKGIGFAIVRDLCRQFAGDVVLTARDVARGQAAVKQL-----QAEGLSPR-- 58

Query: 391  SGGAGELVVRELDLASLRSVRAFCQEMLQEEPRLDVLINNAGIFQCPYMKTEDGFEMQFA 570
                      +LD+  L+S+RA C  + +E   LDVL+NNA I       T    + +  
Sbjct: 59   --------FHQLDIIDLQSIRALCDFLRKEYGGLDVLVNNAAIAFQLDNPTPFHIQAELT 110

Query: 571  VXXXXXXXXXXXXXXXXKSSAPSRIVVVSS---------------KLYKYGDINFEDL-- 699
            +                      R+V VSS               + +K   I  E+L  
Sbjct: 111  MKTNFMGTRNVCTELLPLIKPQGRVVNVSSTEGVRALNECSPELQQKFKSETITEEELVG 170

Query: 700  -------------NSEQSYNKSFCYSRSKLANILFTRELARRLE----GTNVTVNVLHPG 828
                         + ++ ++ S  Y  +K+   + +R  AR+L     G  + +N   PG
Sbjct: 171  LMNKFVEDTKNGVHRKEGWSDS-TYGVTKIGVSVLSRIYARKLREQRAGDKILLNACCPG 229

Query: 829  IVRTNLGRHIHIPLLVKPLFNLVSWAFFKTPAEGAQTSVYLASSP-EVEGVSGKYFGDCK 1005
             VRT++G     P               K+P  GA+T VYLA  P + EG  G++  D K
Sbjct: 230  WVRTDMGGP-KAP---------------KSPEVGAETPVYLALLPSDAEGPHGQFVTDKK 273

Query: 1006 EEE 1014
              E
Sbjct: 274  VVE 276


>ref|NP_999471.1| 17beta-estradiol dehydrogenase [Sus scrofa]
          Length = 737

 Score = 47.4 bits (111), Expect = 9e-07
 Identities = 54/214 (25%), Positives = 85/214 (39%), Gaps = 8/214 (3%)
 Frame = +1

Query: 208 HGKTVLITGANSGLGRATAAELLRLGARVIMG-----CRDRARAEEAAGQLRRELRQTEG 372
           +G+ VL+TGA  GLGR  A      GA V++       +   +   AA ++  E+R+  G
Sbjct: 8   YGRVVLVTGAGGGLGRTYALAFAERGASVVVNDLGGDMKGVGKGSLAADKVVEEIRRKGG 67

Query: 373 PE-EGPNSGGAGELVVRELDLASLRSVRAFCQEMLQEEPRLDVLINNAGIFQCPYMK--T 543
                 +S  AGE +V+                 L    R+DV++NNAGI +       +
Sbjct: 68  KAVANYDSVEAGEKIVK---------------AALDAFGRIDVVVNNAGILRDRSFSRIS 112

Query: 544 EDGFEMQFAVXXXXXXXXXXXXXXXXKSSAPSRIVVVSSKLYKYGDINFEDLNSEQSYNK 723
           ++ ++M   V                K     RI++ SS    YG  NF   N       
Sbjct: 113 DEDWDMIQRVHLRGSFMVTRAAWDHMKKQNFGRIIMTSSAAGIYG--NFGQAN------- 163

Query: 724 SFCYSRSKLANILFTRELARRLEGTNVTVNVLHP 825
              YS +KL  +  +  LA   +  N+  N + P
Sbjct: 164 ---YSAAKLGLLGLSNSLAVEGKKNNIHCNTVAP 194


  Database: RefSeqSP
    Posted date:  Aug 1, 2006  7:14 PM
  Number of letters in database: 434,620
  Number of sequences in database:  1040
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,230,321
Number of Sequences: 1040
Number of extensions: 28314
Number of successful extensions: 93
Number of sequences better than 1.0e-05: 2
Number of HSP's better than  0.0 without gapping: 84
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 91
length of database: 434,620
effective HSP length: 81
effective length of database: 350,380
effective search space used: 151714540
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqHP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= LVRM1_0110_B08
         (1546 letters)

Database: RefSeqHP 
           39,411 sequences; 17,774,539 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_065956.1| retinol dehydrogenase 14 (all-trans and 9-cis) ...   544   e-155
Alignment   gi|NP_689656.1| retinol dehydrogenase 12 (all-trans and 9-cis) ...   245   7e-65
Alignment   gi|NP_057110.2| androgen-regulated short-chain dehydrogenase/re...   224   2e-58
Alignment   gi|NP_612421.1| retinol dehydrogenase 13 (all-trans and 9-cis) ...   202   6e-52
Alignment   gi|NP_653284.1| hypothetical protein LOC147015 [Homo sapiens]        181   2e-45
Alignment   gi|NP_660160.1| dehydrogenase/reductase (SDR family) X-linked [...   168   1e-41
Alignment   gi|NP_057457.1| WW domain-containing oxidoreductase isoform 1 [...   166   7e-41
Alignment   gi|XP_371503.3| PREDICTED: similar to short-chain dehydrogenase...    79   1e-14
Alignment   gi|XP_947127.1| PREDICTED: similar to short-chain dehydrogenase...    79   1e-14
Alignment   gi|NP_001748.1| carbonyl reductase 1 [Homo sapiens]                   58   3e-08

>ref|NP_065956.1| retinol dehydrogenase 14 (all-trans and 9-cis) [Homo sapiens]
          Length = 336

 Score =  544 bits (1402), Expect = e-155
 Identities = 280/317 (88%), Positives = 286/317 (90%), Gaps = 2/317 (0%)
 Frame = +1

Query: 148  RRFVGPSVQRLHRGGDSGLMHGKTVLITGANSGLGRATAAELLRLGARVIMGCRDRARAE 327
            RRFVGP VQRL RGGD GLMHGKTVLITGANSGLGRATAAELLRLGARVIMGCRDRARAE
Sbjct: 22   RRFVGPRVQRLRRGGDPGLMHGKTVLITGANSGLGRATAAELLRLGARVIMGCRDRARAE 81

Query: 328  EAAGQLRRELRQTE--GPEEGPNSGGAGELVVRELDLASLRSVRAFCQEMLQEEPRLDVL 501
            EAAGQLRRELRQ    GPE  P   G GEL+VRELDLASLRSVRAFCQEMLQEEPRLDVL
Sbjct: 82   EAAGQLRRELRQAAECGPE--PGVSGVGELIVRELDLASLRSVRAFCQEMLQEEPRLDVL 139

Query: 502  INNAGIFQCPYMKTEDGFEMQFAVXXXXXXXXXXXXXXXXKSSAPSRIVVVSSKLYKYGD 681
            INNAGIFQCPYMKTEDGFEMQF V                KSSAPSRIVVVSSKLYKYGD
Sbjct: 140  INNAGIFQCPYMKTEDGFEMQFGVNHLGHFLLTNLLLGLLKSSAPSRIVVVSSKLYKYGD 199

Query: 682  INFEDLNSEQSYNKSFCYSRSKLANILFTRELARRLEGTNVTVNVLHPGIVRTNLGRHIH 861
            INF+DLNSEQSYNKSFCYSRSKLANILFTRELARRLEGTNVTVNVLHPGIVRTNLGRHIH
Sbjct: 200  INFDDLNSEQSYNKSFCYSRSKLANILFTRELARRLEGTNVTVNVLHPGIVRTNLGRHIH 259

Query: 862  IPLLVKPLFNLVSWAFFKTPAEGAQTSVYLASSPEVEGVSGKYFGDCKEEELLPKAMDDS 1041
            IPLLVKPLFNLVSWAFFKTP EGAQTS+YLASSPEVEGVSG+YFGDCKEEELLPKAMD+S
Sbjct: 260  IPLLVKPLFNLVSWAFFKTPVEGAQTSIYLASSPEVEGVSGRYFGDCKEEELLPKAMDES 319

Query: 1042 VARKLWDISEVMVGILK 1092
            VARKLWDISEVMVG+LK
Sbjct: 320  VARKLWDISEVMVGLLK 336


>ref|NP_689656.1| retinol dehydrogenase 12 (all-trans and 9-cis) [Homo sapiens]
          Length = 316

 Score =  245 bits (626), Expect = 7e-65
 Identities = 134/313 (42%), Positives = 190/313 (60%), Gaps = 3/313 (0%)
 Frame = +1

Query: 157  VGPSVQRLHRGG---DSGLMHGKTVLITGANSGLGRATAAELLRLGARVIMGCRDRARAE 327
            V PS+++   GG    +  + GK V+ITGAN+G+G+ TA EL   GARV + CRD  + E
Sbjct: 18   VAPSIRKFFAGGVCRTNVQLPGKVVVITGANTGIGKETARELASRGARVYIACRDVLKGE 77

Query: 328  EAAGQLRRELRQTEGPEEGPNSGGAGELVVRELDLASLRSVRAFCQEMLQEEPRLDVLIN 507
             AA ++R + + ++             ++VR+LDL+  +S+RAF +  L EE +L +LIN
Sbjct: 78   SAASEIRVDTKNSQ-------------VLVRKLDLSDTKSIRAFAEGFLAEEKQLHILIN 124

Query: 508  NAGIFQCPYMKTEDGFEMQFAVXXXXXXXXXXXXXXXXKSSAPSRIVVVSSKLYKYGDIN 687
            NAG+  CPY KT DGFE    V                K SAP+R+V VSS  +  G I 
Sbjct: 125  NAGVMMCPYSKTADGFETHLGVNHLGHFLLTYLLLEQLKVSAPARVVNVSSVAHHIGKIP 184

Query: 688  FEDLNSEQSYNKSFCYSRSKLANILFTRELARRLEGTNVTVNVLHPGIVRTNLGRHIHIP 867
            F DL SE+ Y++ F Y  SKLAN+LFTRELA+RL+GT VT   +HPG+VR+ L RH  + 
Sbjct: 185  FHDLQSEKRYSRGFAYCHSKLANVLFTRELAKRLQGTGVTTYAVHPGVVRSELVRHSSLL 244

Query: 868  LLVKPLFNLVSWAFFKTPAEGAQTSVYLASSPEVEGVSGKYFGDCKEEELLPKAMDDSVA 1047
             L+  LF+     F KT  EGAQTS++ A +  +E +SGKYF DCK   + P+A ++  A
Sbjct: 245  CLLWRLFS----PFVKTAREGAQTSLHCALAEGLEPLSGKYFSDCKRTWVSPRARNNKTA 300

Query: 1048 RKLWDISEVMVGI 1086
             +LW++S  ++GI
Sbjct: 301  ERLWNVSCELLGI 313


>ref|NP_057110.2| androgen-regulated short-chain dehydrogenase/reductase 1 [Homo
            sapiens]
          Length = 318

 Score =  224 bits (570), Expect = 2e-58
 Identities = 126/292 (43%), Positives = 177/292 (60%)
 Frame = +1

Query: 211  GKTVLITGANSGLGRATAAELLRLGARVIMGCRDRARAEEAAGQLRRELRQTEGPEEGPN 390
            GK V++TGAN+G+G+ TA EL + GARV + CRD  + E  A    +E++ T G ++   
Sbjct: 41   GKVVVVTGANTGIGKETAKELAQRGARVYLACRDVEKGELVA----KEIQTTTGNQQ--- 93

Query: 391  SGGAGELVVRELDLASLRSVRAFCQEMLQEEPRLDVLINNAGIFQCPYMKTEDGFEMQFA 570
                  ++VR+LDL+  +S+RAF +  L EE  L VLINNAG+  CPY KT DGFEM   
Sbjct: 94   ------VLVRKLDLSDTKSIRAFAKGFLAEEKHLHVLINNAGVMMCPYSKTADGFEMHIG 147

Query: 571  VXXXXXXXXXXXXXXXXKSSAPSRIVVVSSKLYKYGDINFEDLNSEQSYNKSFCYSRSKL 750
            V                K SAPSRIV VSS  +  G I+F +L  E+ YN    Y  SKL
Sbjct: 148  VNHLGHFLLTHLLLEKLKESAPSRIVNVSSLAHHLGRIHFHNLQGEKFYNAGLAYCHSKL 207

Query: 751  ANILFTRELARRLEGTNVTVNVLHPGIVRTNLGRHIHIPLLVKPLFNLVSWAFFKTPAEG 930
            ANILFT+ELARRL+G+ VT   +HPG V++ L RH      +  LF+     F KTP +G
Sbjct: 208  ANILFTQELARRLKGSGVTTYSVHPGTVQSELVRHSSFMRWMWWLFSF----FIKTPQQG 263

Query: 931  AQTSVYLASSPEVEGVSGKYFGDCKEEELLPKAMDDSVARKLWDISEVMVGI 1086
            AQTS++ A +  +E +SG +F DC    +  +A ++++AR+LWD+S  ++G+
Sbjct: 264  AQTSLHCALTEGLEILSGNHFSDCHVAWVSVQARNETIARRLWDVSCDLLGL 315


>ref|NP_612421.1| retinol dehydrogenase 13 (all-trans and 9-cis) [Homo sapiens]
          Length = 260

 Score =  202 bits (514), Expect = 6e-52
 Identities = 107/226 (47%), Positives = 143/226 (63%), Gaps = 3/226 (1%)
 Frame = +1

Query: 418  RELDLASLRSVRAFCQEMLQEEPRLDVLINNAGIFQCPYMKTEDGFEMQFAVXXXXXXXX 597
            R LDLASL+S+R F  ++++EE R+D+LINNAG+ +CP+  TEDGFEMQF V        
Sbjct: 23   RHLDLASLKSIREFAAKIIEEEERVDILINNAGVMRCPHWTTEDGFEMQFGVNHLGHFLL 82

Query: 598  XXXXXXXXKSSAPSRIVVVSSKLYKYGDINFEDLN-SEQSYNKSFCYSRSKLANILFTRE 774
                    K+SAPSRI+ +SS  +  G I+F+DLN   + YN    Y +SKLA +LFT+E
Sbjct: 83   TNLLLDKLKASAPSRIINLSSLAHVAGHIDFDDLNWQTRKYNTKAAYCQSKLAIVLFTKE 142

Query: 775  LARRLEGTNVTVNVLHPGIVRTNLGRH--IHIPLLVKPLFNLVSWAFFKTPAEGAQTSVY 948
            L+RRL+G+ VTVN LHPG+ RT LGRH  IH           + W   K+P   AQ S Y
Sbjct: 143  LSRRLQGSGVTVNALHPGVARTELGRHTGIHGSTFSSTTLGPIFWLLVKSPELAAQPSTY 202

Query: 949  LASSPEVEGVSGKYFGDCKEEELLPKAMDDSVARKLWDISEVMVGI 1086
            LA + E+  VSGKYF   K++   P+A D+ VAR+LW  S  +VG+
Sbjct: 203  LAVAEELADVSGKYFDGLKQKAPAPEAEDEEVARRLWAESARLVGL 248


>ref|NP_653284.1| hypothetical protein LOC147015 [Homo sapiens]
          Length = 327

 Score =  181 bits (458), Expect = 2e-45
 Identities = 109/278 (39%), Positives = 151/278 (54%), Gaps = 2/278 (0%)
 Frame = +1

Query: 259  TAAELLRLGARVIMGCRDRARAEEAAGQLRRELRQTEGPEEGPNSGGAGELVVRELDLAS 438
            TA EL R GARV++ CR + R E AA  LR+E              G  E++   LDLAS
Sbjct: 2    TALELARRGARVVLACRSQERGEAAAFDLRQE-------------SGNNEVIFMALDLAS 48

Query: 439  LRSVRAFCQEMLQEEPRLDVLINNAGIFQCPYMKTEDGFEMQFAVXXXXXXXXXXXXXXX 618
            L SVRAF    L  EPRLD+LI+NAGI  C   +T + F +   V               
Sbjct: 49   LASVRAFATAFLSSEPRLDILIHNAGISSCG--RTREAFNLLLRVNHIGPFLLTHLLLPC 106

Query: 619  XKSSAPSRIVVVSSKLYKYGDINFEDLNSEQS--YNKSFCYSRSKLANILFTRELARRLE 792
             K+ APSR+VVV+S  +  G ++F+ L+        +   Y+ +KLAN+LF RELA +LE
Sbjct: 107  LKACAPSRVVVVASAAHCRGRLDFKRLDRPVVGWRQELRAYADTKLANVLFARELANQLE 166

Query: 793  GTNVTVNVLHPGIVRTNLGRHIHIPLLVKPLFNLVSWAFFKTPAEGAQTSVYLASSPEVE 972
             T VT    HPG V + L    H+P  ++PL   ++W   + P  GAQT +Y A    +E
Sbjct: 167  ATGVTCYAAHPGPVNSELFLR-HVPGWLRPLLRPLAWLVLRAPRGGAQTPLYCALQEGIE 225

Query: 973  GVSGKYFGDCKEEELLPKAMDDSVARKLWDISEVMVGI 1086
             +SG+YF +C  EE+ P A DD  A +LW+ S+ + G+
Sbjct: 226  PLSGRYFANCHVEEVPPAARDDRAAHRLWEASKRLAGL 263


>ref|NP_660160.1| dehydrogenase/reductase (SDR family) X-linked [Homo sapiens]
          Length = 330

 Score =  168 bits (425), Expect = 1e-41
 Identities = 102/298 (34%), Positives = 155/298 (52%), Gaps = 6/298 (2%)
 Frame = +1

Query: 214  KTVLITGANSGLGRATAAELLRLGARVIMGCRDRARAEEAAGQLRRELRQTEGPEEGPNS 393
            +  ++TG   G+G +TA  L RLG  VI+   + ++A++   +++ E    +        
Sbjct: 44   RVAIVTGGTDGIGYSTAKHLARLGMHVIIAGNNDSKAKQVVSKIKEETLNDK-------- 95

Query: 394  GGAGELVVRELDLASLRSVRAFCQEMLQEEPRLDVLINNAGIFQCPYMKTEDGFEMQFAV 573
                 +     DLAS+ S+R F Q+   ++  L VLINNAG+   P  KT DGFE  F +
Sbjct: 96   -----VEFLYCDLASMTSIRQFVQKFKMKKIPLHVLINNAGVMMVPQRKTRDGFEEHFGL 150

Query: 574  XXXXXXXXXXXXXXXXKSSAP----SRIVVVSSKLYKYGDINFEDLNSEQSYNKSFCYSR 741
                            K S      +R+V VSS  +   ++N +DL S   Y+    Y++
Sbjct: 151  NYLGHFLLTNLLLDTLKESGSPGHSARVVTVSSATHYVAELNMDDLQSSACYSPHAAYAQ 210

Query: 742  SKLANILFTRELARRL--EGTNVTVNVLHPGIVRTNLGRHIHIPLLVKPLFNLVSWAFFK 915
            SKLA +LFT  L R L  EG++VT NV+ PG+V T+L +H+     +     L+ W  FK
Sbjct: 211  SKLALVLFTYHLQRLLAAEGSHVTANVVDPGVVNTDLYKHVFWATRLAK--KLLGWLLFK 268

Query: 916  TPAEGAQTSVYLASSPEVEGVSGKYFGDCKEEELLPKAMDDSVARKLWDISEVMVGIL 1089
            TP EGA TS+Y A +PE+EGV G+Y  + KE + L    +  + ++LW  S  M G+L
Sbjct: 269  TPDEGAWTSIYAAVTPELEGVGGRYLYNEKETKSLHVTYNQKLQQQLWSKSCEMTGVL 326


>ref|NP_057457.1| WW domain-containing oxidoreductase isoform 1 [Homo sapiens]
          Length = 414

 Score =  166 bits (419), Expect = 7e-41
 Identities = 108/298 (36%), Positives = 154/298 (51%), Gaps = 8/298 (2%)
 Frame = +1

Query: 211  GKTVLITGANSGLGRATAAELLRLGARVIMGCRDRARAEEAAGQLRRELRQTEGPEEGPN 390
            GK V++TGANSG+G  TA      GA VI+ CR+ ARA EA  ++  E  + +       
Sbjct: 124  GKVVVVTGANSGIGFETAKSFALHGAHVILACRNMARASEAVSRILEEWHKAK------- 176

Query: 391  SGGAGELVVRELDLASLRSVRAFCQEMLQEEPRLDVLINNAGIFQCPYMKTEDGFEMQFA 570
                  +    LDLA LRSV+ F +    +   L VL+ NA  F  P+  T+DG E  F 
Sbjct: 177  ------VEAMTLDLALLRSVQHFAEAFKAKNVPLHVLVCNAATFALPWSLTKDGLETTFQ 230

Query: 571  VXXXXXXXXXXXXXXXXKSSAPSRIVVVSSKLYKYGDIN-------FEDLN-SEQSYNKS 726
            V                  SAP+R++VVSS+ +++ DIN       F  L+ ++  Y   
Sbjct: 231  VNHLGHFYLVQLLQDVLCRSAPARVIVVSSESHRFTDINDSLGKLDFSRLSPTKNDYWAM 290

Query: 727  FCYSRSKLANILFTRELARRLEGTNVTVNVLHPGIVRTNLGRHIHIPLLVKPLFNLVSWA 906
              Y+RSKL NILF+ EL RRL    VT N +HPG +  +   +IH    V  L   ++  
Sbjct: 291  LAYNRSKLCNILFSNELHRRLSPRGVTSNAVHPGNMMYS---NIHRSWWVYTLLFTLARP 347

Query: 907  FFKTPAEGAQTSVYLASSPEVEGVSGKYFGDCKEEELLPKAMDDSVARKLWDISEVMV 1080
            F K+  +GA T+VY A+ PE+EG+ G YF +C      P+A  +  AR LW +SE ++
Sbjct: 348  FTKSMQQGAATTVYCAAVPELEGLGGMYFNNCCRCMPSPEAQSEETARTLWALSERLI 405


>ref|XP_371503.3| PREDICTED: similar to short-chain dehydrogenase/reductase 1 [Homo
           sapiens]
          Length = 891

 Score = 78.6 bits (192), Expect = 1e-14
 Identities = 39/120 (32%), Positives = 70/120 (58%), Gaps = 1/120 (0%)
 Frame = +1

Query: 211 GKTVLITGANSGLGRATAAELLRLGARVIMGCRDRARAEEAAGQLRRELRQTEGPEEGPN 390
           GK  ++TGANSG+G+  + +L R GA+VI+ C+ R   ++A  +++              
Sbjct: 602 GKIAIVTGANSGIGKVVSQDLARCGAQVILTCQSRECGQQALAEIQA------------- 648

Query: 391 SGGAGELVVRELDLASLRSVRAFCQEMLQEEPRLDVLINNAGIF-QCPYMKTEDGFEMQF 567
           +  +  L++ E+DL+S+ S+R+F + +LQE P + +L+NNAG+    P   T  G ++ F
Sbjct: 649 ASNSNRLLLGEVDLSSMTSIRSFARRLLQENPEIHLLVNNAGVSGMIPKTLTPGGLDLTF 708


>ref|XP_947127.1| PREDICTED: similar to short-chain dehydrogenase/reductase 1 [Homo
           sapiens]
          Length = 916

 Score = 78.6 bits (192), Expect = 1e-14
 Identities = 39/120 (32%), Positives = 70/120 (58%), Gaps = 1/120 (0%)
 Frame = +1

Query: 211 GKTVLITGANSGLGRATAAELLRLGARVIMGCRDRARAEEAAGQLRRELRQTEGPEEGPN 390
           GK  ++TGANSG+G+  + +L R GA+VI+ C+ R   ++A  +++              
Sbjct: 627 GKIAIVTGANSGIGKVVSQDLARCGAQVILTCQSRECGQQALAEIQA------------- 673

Query: 391 SGGAGELVVRELDLASLRSVRAFCQEMLQEEPRLDVLINNAGIF-QCPYMKTEDGFEMQF 567
           +  +  L++ E+DL+S+ S+R+F + +LQE P + +L+NNAG+    P   T  G ++ F
Sbjct: 674 ASNSNRLLLGEVDLSSMTSIRSFARRLLQENPEIHLLVNNAGVSGMIPKTLTPGGLDLTF 733


>ref|NP_001748.1| carbonyl reductase 1 [Homo sapiens]
          Length = 277

 Score = 57.8 bits (138), Expect = 3e-08
 Identities = 74/299 (24%), Positives = 119/299 (39%), Gaps = 35/299 (11%)
 Frame = +1

Query: 223  LITGANSGLGRATAAELLRL-GARVIMGCRDRARAEEAAGQLRRELRQTEGPEEGPNSGG 399
            L+TG N G+G A   +L RL    V++  RD  R + A  QL     Q EG         
Sbjct: 9    LVTGGNKGIGLAIVRDLCRLFSGDVVLTARDVTRGQAAVQQL-----QAEGLSPR----- 58

Query: 400  AGELVVRELDLASLRSVRAFCQEMLQEEPRLDVLINNAGIFQCPYMKTEDGFEMQFAVXX 579
                   +LD+  L+S+RA    + +E   LDVL+NNAGI       T    + +  +  
Sbjct: 59   -----FHQLDIDDLQSIRALRDFLRKEYGGLDVLVNNAGIAFKVADPTPFHIQAEVTMKT 113

Query: 580  XXXXXXXXXXXXXXKSSAPSRIVVVSS---------------KLYKYGDINFEDL----- 699
                                R+V VSS               + ++   I  E+L     
Sbjct: 114  NFFGTRDVCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQKFRSETITEEELVGLMN 173

Query: 700  ----NSEQSYNK-----SFCYSRSKLANILFTRELARRL----EGTNVTVNVLHPGIVRT 840
                ++++  ++     S  Y  +K+   + +R  AR+L    +G  + +N   PG VRT
Sbjct: 174  KFVEDTKKGVHQKEGWPSSAYGVTKIGVTVLSRIHARKLSEQRKGDKILLNACCPGWVRT 233

Query: 841  NLGRHIHIPLLVKPLFNLVSWAFFKTPAEGAQTSVYLA-SSPEVEGVSGKYFGDCKEEE 1014
                            ++      K+P EGA+T VYLA   P+ EG  G++  + + E+
Sbjct: 234  ----------------DMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQFVSEKRVEQ 276


  Database: RefSeqHP
    Posted date:  Aug 2, 2006 12:57 AM
  Number of letters in database: 17,774,539
  Number of sequences in database:  39,411
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 50,928,764
Number of Sequences: 39411
Number of extensions: 1218885
Number of successful extensions: 4275
Number of sequences better than 1.0e-05: 10
Number of HSP's better than  0.0 without gapping: 3590
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4219
length of database: 17,774,539
effective HSP length: 106
effective length of database: 13,596,973
effective search space used: 5547564984
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqMP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= LVRM1_0110_B08
         (1546 letters)

Database: RefSeqMP 
           45,328 sequences; 21,768,885 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_076186.1| alcohol dehydrogenase PAN2 [Mus musculus]            513   e-145
Alignment   gi|NP_084293.1| retinol dehydrogenase 12 [Mus musculus]              238   1e-62
Alignment   gi|NP_780581.1| retinol dehydrogenase 13 (all-trans and 9-cis) ...   238   1e-62
Alignment   gi|NP_067532.2| short-chain dehydrogenase/reductase 1 [Mus musc...   220   4e-57
Alignment   gi|NP_001028498.1| dehydrogenase/reductase (SDR family) X chrom...   162   7e-40
Alignment   gi|NP_062519.2| WW-domain oxidoreductase [Mus musculus]              161   2e-39
Alignment   gi|NP_899109.1| hypothetical protein LOC70451 [Mus musculus]         158   1e-38
Alignment   gi|NP_663403.1| hypothetical protein LOC216820 [Mus musculus]         58   3e-08
Alignment   gi|NP_598593.1| retinol dehydrogenase 10 [Mus musculus]               53   8e-07
Alignment   gi|NP_871789.1| epidermal retinal dehydrogenase 2 [Mus musculus]      50   8e-06

>ref|NP_076186.1| alcohol dehydrogenase PAN2 [Mus musculus]
          Length = 334

 Score =  513 bits (1321), Expect = e-145
 Identities = 265/315 (84%), Positives = 277/315 (87%)
 Frame = +1

Query: 148  RRFVGPSVQRLHRGGDSGLMHGKTVLITGANSGLGRATAAELLRLGARVIMGCRDRARAE 327
            RRF GP  QR   GGD GLMHGKTVLITGANSGLGRATAAELLRLGARVIMGCRDRARAE
Sbjct: 23   RRFSGPRNQRQQGGGDPGLMHGKTVLITGANSGLGRATAAELLRLGARVIMGCRDRARAE 82

Query: 328  EAAGQLRRELRQTEGPEEGPNSGGAGELVVRELDLASLRSVRAFCQEMLQEEPRLDVLIN 507
            EAAGQLR+EL Q  G   GP+ G  G+LVV+ELDLASLRSVRAFCQE+LQEEPRLDVLIN
Sbjct: 83   EAAGQLRQELCQAGGA--GPD-GTDGQLVVKELDLASLRSVRAFCQELLQEEPRLDVLIN 139

Query: 508  NAGIFQCPYMKTEDGFEMQFAVXXXXXXXXXXXXXXXXKSSAPSRIVVVSSKLYKYGDIN 687
            NAG+F CPY KTEDGFEMQF V                KSSAPSRIVVVSSKLYKYG+IN
Sbjct: 140  NAGVFHCPYTKTEDGFEMQFGVNHLGHFLLTNLLLGLLKSSAPSRIVVVSSKLYKYGEIN 199

Query: 688  FEDLNSEQSYNKSFCYSRSKLANILFTRELARRLEGTNVTVNVLHPGIVRTNLGRHIHIP 867
            FEDLNSEQSYNKSFCYSRSKLANILFTRELARRLEGTNVTVNVLHPGIVRTNLGRHIHIP
Sbjct: 200  FEDLNSEQSYNKSFCYSRSKLANILFTRELARRLEGTNVTVNVLHPGIVRTNLGRHIHIP 259

Query: 868  LLVKPLFNLVSWAFFKTPAEGAQTSVYLASSPEVEGVSGKYFGDCKEEELLPKAMDDSVA 1047
            LL +PLFNLVSWAFFKTP EGAQTS+YLA SP+VEGVSG+YFGDCKEEELLPKAMD+SVA
Sbjct: 260  LLARPLFNLVSWAFFKTPLEGAQTSIYLACSPDVEGVSGRYFGDCKEEELLPKAMDESVA 319

Query: 1048 RKLWDISEVMVGILK 1092
            RKLWDISEVMVGILK
Sbjct: 320  RKLWDISEVMVGILK 334


>ref|NP_084293.1| retinol dehydrogenase 12 [Mus musculus]
          Length = 316

 Score =  238 bits (608), Expect = 1e-62
 Identities = 127/311 (40%), Positives = 190/311 (61%), Gaps = 3/311 (0%)
 Frame = +1

Query: 163  PSVQRLHRGG---DSGLMHGKTVLITGANSGLGRATAAELLRLGARVIMGCRDRARAEEA 333
            PS+++   GG    +  + GK V+ITGAN+G+G+ TA EL R GARV + CRD  + E A
Sbjct: 20   PSIRKFFAGGVCTTNVQIPGKVVVITGANTGIGKETARELARRGARVYIACRDVLKGESA 79

Query: 334  AGQLRRELRQTEGPEEGPNSGGAGELVVRELDLASLRSVRAFCQEMLQEEPRLDVLINNA 513
            A ++R + + ++             ++VR+LDL+  +S+RAF +  L EE +L +LINNA
Sbjct: 80   ASEIRADTKNSQ-------------VLVRKLDLSDTKSIRAFAERFLAEEKKLHILINNA 126

Query: 514  GIFQCPYMKTEDGFEMQFAVXXXXXXXXXXXXXXXXKSSAPSRIVVVSSKLYKYGDINFE 693
            G+  CPY KT DGFE  F V                K SAP+R+V +SS  +  G I F 
Sbjct: 127  GVMMCPYSKTTDGFETHFGVNHLGHFLLTYLLLERLKESAPARVVNLSSIAHLIGKIRFH 186

Query: 694  DLNSEQSYNKSFCYSRSKLANILFTRELARRLEGTNVTVNVLHPGIVRTNLGRHIHIPLL 873
            DL  ++ Y  +F Y  SKLAN+LFTRELA+RL+GT VT   +HPG+V + + R+ ++  L
Sbjct: 187  DLQGQKRYCSAFAYGHSKLANLLFTRELAKRLQGTGVTAYAVHPGVVLSEITRNSYLLCL 246

Query: 874  VKPLFNLVSWAFFKTPAEGAQTSVYLASSPEVEGVSGKYFGDCKEEELLPKAMDDSVARK 1053
            +  LF+     FFK+ ++GAQTS++ A + ++E +SGKYF DCK   +  +A +   A +
Sbjct: 247  LWRLFS----PFFKSTSQGAQTSLHCALAEDLEPLSGKYFSDCKRMWVSSRARNKKTAER 302

Query: 1054 LWDISEVMVGI 1086
            LW++S  ++GI
Sbjct: 303  LWNVSCELLGI 313


>ref|NP_780581.1| retinol dehydrogenase 13 (all-trans and 9-cis) [Mus musculus]
          Length = 334

 Score =  238 bits (607), Expect = 1e-62
 Identities = 131/295 (44%), Positives = 181/295 (61%), Gaps = 3/295 (1%)
 Frame = +1

Query: 211  GKTVLITGANSGLGRATAAELLRLGARVIMGCRDRARAEEAAGQLRRELRQTEGPEEGPN 390
            GKTV++TGAN+G+G+ TA EL + G  VI+ CRD  + E AA  +R E   T  P     
Sbjct: 38   GKTVIVTGANTGIGKQTALELAKRGGNVILACRDMEKCEVAAKDIRGE---TLNPR---- 90

Query: 391  SGGAGELVVRELDLASLRSVRAFCQEMLQEEPRLDVLINNAGIFQCPYMKTEDGFEMQFA 570
                  +    LDLASL+S+R F +++++EE R+D+L+NNA + +CP+  TEDGFEMQF 
Sbjct: 91   ------VRAERLDLASLKSIREFARKVIKEEERVDILVNNAAVMRCPHWTTEDGFEMQFG 144

Query: 571  VXXXXXXXXXXXXXXXXKSSAPSRIVVVSSKLYKYGDINFEDLNSE-QSYNKSFCYSRSK 747
            V                K+SAPSRI+ +SS  +  G I+FEDLN + + Y+    Y +SK
Sbjct: 145  VNYLGHFLLTNLLLDKLKASAPSRIINLSSLAHVAGHIDFEDLNWQMKKYDTKAAYCQSK 204

Query: 748  LANILFTRELARRLEGTNVTVNVLHPGIVRTNLGRH--IHIPLLVKPLFNLVSWAFFKTP 921
            LA +LFT+EL+ RL+G+ VTVN LHPG+ RT LGRH  +H       +     W  FK+P
Sbjct: 205  LAVVLFTKELSHRLQGSGVTVNALHPGVARTELGRHTGMHNSAFSGFMLGPFFWLLFKSP 264

Query: 922  AEGAQTSVYLASSPEVEGVSGKYFGDCKEEELLPKAMDDSVARKLWDISEVMVGI 1086
               AQ S YLA + E+E VSGKYF   +E+   P+A D+ VAR+LW  S  +VG+
Sbjct: 265  QLAAQPSTYLAVAEELENVSGKYFDGLREKAPSPEAEDEEVARRLWTESARLVGL 319


>ref|NP_067532.2| short-chain dehydrogenase/reductase 1 [Mus musculus]
          Length = 316

 Score =  220 bits (560), Expect = 4e-57
 Identities = 128/313 (40%), Positives = 185/313 (59%), Gaps = 3/313 (0%)
 Frame = +1

Query: 157  VGPSVQRLHRGG---DSGLMHGKTVLITGANSGLGRATAAELLRLGARVIMGCRDRARAE 327
            V P ++++   G    +  + GK  ++TGAN+G+G+ TA +L + GARV + CRD  + E
Sbjct: 17   VTPKIRKMLSSGVCTSNVQLPGKVAIVTGANTGIGKETAKDLAQRGARVYLACRDVDKGE 76

Query: 328  EAAGQLRRELRQTEGPEEGPNSGGAGELVVRELDLASLRSVRAFCQEMLQEEPRLDVLIN 507
             AA    RE++   G     NS    ++ VR+LDLA  +S+RAF ++ L EE  L +LIN
Sbjct: 77   LAA----REIQAVTG-----NS----QVFVRKLDLADTKSIRAFAKDFLAEEKHLHLLIN 123

Query: 508  NAGIFQCPYMKTEDGFEMQFAVXXXXXXXXXXXXXXXXKSSAPSRIVVVSSKLYKYGDIN 687
            NAG+  CPY KT DGFEM   V                K SAPSRIV +SS  +  G I+
Sbjct: 124  NAGVMMCPYSKTADGFEMHIGVNHLGHFLLTHLLLEKLKESAPSRIVNLSSLGHHLGRIH 183

Query: 688  FEDLNSEQSYNKSFCYSRSKLANILFTRELARRLEGTNVTVNVLHPGIVRTNLGRHIHIP 867
            F +L  E+ Y+    Y  SKLANILFT+ELA+RL+G+ VT   +HPG V + L R+  I 
Sbjct: 184  FHNLQGEKFYSAGLAYCHSKLANILFTKELAKRLKGSGVTTYSVHPGTVHSELTRYSSIM 243

Query: 868  LLVKPLFNLVSWAFFKTPAEGAQTSVYLASSPEVEGVSGKYFGDCKEEELLPKAMDDSVA 1047
              +  LF    + F KTP EGAQTS+Y A +  +E +SG +F DC+   +  +  ++ +A
Sbjct: 244  RWLWQLF----FVFIKTPQEGAQTSLYCALTEGLESLSGSHFSDCQLAWVSYQGRNEIIA 299

Query: 1048 RKLWDISEVMVGI 1086
            R+LWD+S  ++G+
Sbjct: 300  RRLWDVSCDLLGL 312


>ref|NP_001028498.1| dehydrogenase/reductase (SDR family) X chromosome [Mus musculus]
          Length = 335

 Score =  162 bits (411), Expect = 7e-40
 Identities = 104/289 (35%), Positives = 146/289 (50%), Gaps = 6/289 (2%)
 Frame = +1

Query: 211  GKTVLITGANSGLGRATAAELLRLGARVIMGCRDRARAEEAAGQLRRELRQTEGPEEGPN 390
            G+  ++TGA +G+GR+TA +L RLG  V++   D  R +E    +R E+           
Sbjct: 43   GRVAIVTGATAGIGRSTARQLARLGMCVVVAGNDEHRGQEVVSSIRAEM----------- 91

Query: 391  SGGAGELVVRELDLASLRSVRAFCQEMLQEEPRLDVLINNAGIFQCPYMKTEDGFEMQFA 570
              G+       LDLASL SVR F ++       L +L+NNAG+   P  +TEDGFE    
Sbjct: 92   --GSDRAHFLPLDLASLASVRGFARDFQALGLPLHLLVNNAGVMLEPRAETEDGFERHLG 149

Query: 571  VXXXXXXXXXXXXXXXXKSSAP----SRIVVVSSKLYKYGDINFEDLNSEQSYNKSFCYS 738
            V                ++S      SR+V V S  +  G ++  DL+   +Y+    Y+
Sbjct: 150  VNFLGHFLLTLLLLPALRASGAEGRGSRVVTVGSATHYVGTVDMADLHGRHAYSPYAAYA 209

Query: 739  RSKLANILFTRELARRLE--GTNVTVNVLHPGIVRTNLGRHIHIPLLVKPLFNLVSWAFF 912
            +SKLA  LF  +L R L+  G  VT N+  PG+V T L RH    L     F  + W  F
Sbjct: 210  QSKLALALFALQLQRILDARGDPVTSNMADPGVVDTELYRHAGWVLRTAKRF--LGWLVF 267

Query: 913  KTPAEGAQTSVYLASSPEVEGVSGKYFGDCKEEELLPKAMDDSVARKLW 1059
            K+P EGA T VY A++PE+EGV G+Y  D  E E L  A D  + R+LW
Sbjct: 268  KSPEEGAWTLVYAAAAPELEGVGGRYLRDEAEAEPLGTARDQELQRRLW 316


>ref|NP_062519.2| WW-domain oxidoreductase [Mus musculus]
          Length = 414

 Score =  161 bits (408), Expect = 2e-39
 Identities = 107/298 (35%), Positives = 152/298 (51%), Gaps = 8/298 (2%)
 Frame = +1

Query: 211  GKTVLITGANSGLGRATAAELLRLGARVIMGCRDRARAEEAAGQLRRELRQTEGPEEGPN 390
            GK VL+TGANSG+G  TA      GA VI+ CR+ +RA EA  ++  E  +         
Sbjct: 124  GKVVLVTGANSGIGFETAKSFALHGAHVILACRNLSRASEAVSRILEEWHK--------- 174

Query: 391  SGGAGELVVRELDLASLRSVRAFCQEMLQEEPRLDVLINNAGIFQCPYMKTEDGFEMQFA 570
                 ++    LDLA LRSV+ F +    +   L VL+ NAG F  P+  T+DG E  F 
Sbjct: 175  ----AKVEAMTLDLAVLRSVQHFAEAFKAKNVSLHVLVCNAGTFALPWGLTKDGLETTFQ 230

Query: 571  VXXXXXXXXXXXXXXXXKSSAPSRIVVVSSKLYKYGDINFE----DLN----SEQSYNKS 726
            V                  S+P+R++VVSS+ +++ DIN      DL+        Y   
Sbjct: 231  VNHLGHFYLVQLLQDVLCRSSPARVIVVSSESHRFTDINDSSGKLDLSRLSPPRSDYWAM 290

Query: 727  FCYSRSKLANILFTRELARRLEGTNVTVNVLHPGIVRTNLGRHIHIPLLVKPLFNLVSWA 906
              Y+RSKL NILF+ EL RRL    VT N +HPG +  +    IH    V  L   ++  
Sbjct: 291  LAYNRSKLCNILFSNELHRRLSPRGVTSNAVHPGNMMYSA---IHRNSWVYKLLFTLARP 347

Query: 907  FFKTPAEGAQTSVYLASSPEVEGVSGKYFGDCKEEELLPKAMDDSVARKLWDISEVMV 1080
            F K+  +GA T+VY A +PE+EG+ G YF +C       +A  +  AR LW++SE ++
Sbjct: 348  FTKSMQQGAATTVYCAVAPELEGLGGMYFNNCCRCLPSEEAQSEETARALWELSERLI 405


>ref|NP_899109.1| hypothetical protein LOC70451 [Mus musculus]
          Length = 260

 Score =  158 bits (400), Expect = 1e-38
 Identities = 98/240 (40%), Positives = 133/240 (55%), Gaps = 2/240 (0%)
 Frame = +1

Query: 190 GDSGLMHGKTVLITGANSGLGRATAAELLRLGARVIMGCRDRARAEEAAGQLRRELRQTE 369
           G  G + G+TV++TGANSG+G+ TA EL R GARV++ CR R R E AA  LR+E     
Sbjct: 29  GGIGSLRGRTVVVTGANSGIGKMTALELARRGARVVLACRSRERGEAAAFDLRQE----- 83

Query: 370 GPEEGPNSGGAGELVVRELDLASLRSVRAFCQEMLQEEPRLDVLINNAGIFQCPYMKTED 549
                    G  E++   LDLASL SV+AF    L  EPRLDVLI+NAGI  C   +T +
Sbjct: 84  --------SGNNEVIFMALDLASLASVQAFATAFLSSEPRLDVLIHNAGISSCG--RTRE 133

Query: 550 GFEMQFAVXXXXXXXXXXXXXXXXKSSAPSRIVVVSSKLYKYGDINFEDLNSEQS--YNK 723
            F +   V                +S APSR+V+VSS  ++ G ++F  L+        +
Sbjct: 134 TFNLLLRVNHVGPFLLTHLLLPRLRSCAPSRVVIVSSAAHRRGRLDFTRLDCPVVGWQQE 193

Query: 724 SFCYSRSKLANILFTRELARRLEGTNVTVNVLHPGIVRTNLGRHIHIPLLVKPLFNLVSW 903
              Y+ SKLAN+LF RELA +LEGT VT    HPG V + L    H+   ++P+   ++W
Sbjct: 194 LRAYADSKLANVLFARELATQLEGTGVTCYAAHPGPVNSELFLR-HLRGWLRPILRPLAW 252


>ref|NP_663403.1| hypothetical protein LOC216820 [Mus musculus]
          Length = 323

 Score = 57.8 bits (138), Expect = 3e-08
 Identities = 63/223 (28%), Positives = 89/223 (39%)
 Frame = +1

Query: 178 LHRGGDSGLMHGKTVLITGANSGLGRATAAELLRLGARVIMGCRDRARAEEAAGQLRREL 357
           L R      +    V++TGA SGLGR  A      GA++++ C    +A E   +L REL
Sbjct: 41  LQRIRSKAYLRNAVVVVTGATSGLGRECAKVFHAAGAKLVL-CGRNVKALE---ELSREL 96

Query: 358 RQTEGPEEGPNSGGAGELVVRELDLASLRSVRAFCQEMLQEEPRLDVLINNAGIFQCPYM 537
                   G + G   +  V   DLA   ++ A   E+LQ    +DVLINNAGI    Y 
Sbjct: 97  -------AGSSQGQTHQPFVVTFDLADPGTIAAAAAEILQCFGYVDVLINNAGI---SYR 146

Query: 538 KTEDGFEMQFAVXXXXXXXXXXXXXXXXKSSAPSRIVVVSSKLYKYGDINFEDLNSEQSY 717
            T    +    V                K+  PS +      +     +    +  + S 
Sbjct: 147 GTIS--DTIVDVDRKVMEINYFGPVALTKALLPSMVERKQGHI-----VAISSIQGKISI 199

Query: 718 NKSFCYSRSKLANILFTRELARRLEGTNVTVNVLHPGIVRTNL 846
                YS SK A   F   L   +E  N+ V V+ PG + TNL
Sbjct: 200 PFRSAYSASKHATQAFFDCLRAEMEEANIKVTVISPGYIHTNL 242


>ref|NP_598593.1| retinol dehydrogenase 10 [Mus musculus]
          Length = 341

 Score = 53.1 bits (126), Expect = 8e-07
 Identities = 58/243 (23%), Positives = 88/243 (36%), Gaps = 19/243 (7%)
 Frame = +1

Query: 211 GKTVLITGANSGLGRATAAELLRLGARVIMGCRDRARAEEAAGQLRRELRQTEGPEEGPN 390
           G+  LITGA SGLGR  A E  R  A +++   +    EE AG +R   R  E  +    
Sbjct: 36  GQVCLITGAGSGLGRLFALEFARRRALLVLWDINTQSNEETAGMVRHIYRDLEAADAAAL 95

Query: 391 SGGAGE----------LVVRELDLASLRSVRAFCQEMLQEEPRLDVLINNAGI------F 522
             G GE          +     D+    +V    + + +E   + VL+NNAG+       
Sbjct: 96  QAGKGEEEILPPCNLQVFTYTCDVGKRENVYLTAERVRKEVGEVSVLVNNAGVVSGHHLL 155

Query: 523 QCPYMKTEDGFEMQFAVXXXXXXXXXXXXXXXXKSSAPSRIVVVSSKLYKYGDINFEDLN 702
           +CP    ++  E    V                       IV V+S L  +     ED  
Sbjct: 156 ECP----DELIERTMMVNCHAHFWTTKAFLPTMLEINHGHIVTVASSLGLFSTAGVED-- 209

Query: 703 SEQSYNKSFCYSRSKLANILFTRELARRL---EGTNVTVNVLHPGIVRTNLGRHIHIPLL 873
                     Y  SK   + F   L+  L   E   +   ++ P +V T + R   I   
Sbjct: 210 ----------YCASKFGVVGFHESLSHELKAAEKDGIKTTLVCPYLVDTGMFRGCRIRKE 259

Query: 874 VKP 882
           ++P
Sbjct: 260 IEP 262


>ref|NP_871789.1| epidermal retinal dehydrogenase 2 [Mus musculus]
          Length = 309

 Score = 49.7 bits (117), Expect = 8e-06
 Identities = 39/125 (31%), Positives = 56/125 (44%), Gaps = 6/125 (4%)
 Frame = +1

Query: 211 GKTVLITGANSGLGRATAAELLRLGARVIMGCRDRARAEEAAGQLRRELRQTEGPEEGPN 390
           G+ VLITGA SGLGR  A +  RLGA +++   ++  A +   QL RE            
Sbjct: 40  GEIVLITGAGSGLGRLLALQFARLGAVLVLWDVNK-EANDETHQLARE------------ 86

Query: 391 SGGAGELVVRELDLASLRSVRAFCQEMLQEEPRLDVLINNAGI------FQCPYMKTEDG 552
             GA  +     D +    V     ++ +E   + +LINNAGI        CP    E  
Sbjct: 87  -AGAARVHAYTCDCSRREEVYRVADQVKKEVGDVSILINNAGIVTGRNFLDCPDDLMEKS 145

Query: 553 FEMQF 567
           F++ F
Sbjct: 146 FDVNF 150


  Database: RefSeqMP
    Posted date:  Aug 2, 2006 12:58 AM
  Number of letters in database: 21,768,885
  Number of sequences in database:  45,328
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 60,950,843
Number of Sequences: 45328
Number of extensions: 1424419
Number of successful extensions: 4834
Number of sequences better than 1.0e-05: 10
Number of HSP's better than  0.0 without gapping: 4166
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4776
length of database: 21,768,885
effective HSP length: 108
effective length of database: 16,873,461
effective search space used: 6850625166
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)