Animal-Genome cDNA LVRM1_0187_E10


Search to RefSeqBP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= LVRM1_0187_E10
         (1343 letters)

Database: RefSeqBP 
           33,508 sequences; 16,112,626 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|XP_591168.2| PREDICTED: similar to dehydrogenase/reductase (...   382   e-106
Alignment   gi|XP_582319.2| PREDICTED: similar to retinol dehydrogenase 14 ...   182   7e-46
Alignment   gi|NP_899207.1| double substrate-specificity short chain dehydr...   166   4e-41
Alignment   gi|XP_592820.2| PREDICTED: similar to retinol dehydrogenase 11 ...   133   3e-31
Alignment   gi|XP_584642.2| PREDICTED: similar to retinol dehydrogenase 11 ...   133   3e-31
Alignment   gi|XP_870721.1| PREDICTED: similar to Retinol dehydrogenase 11 ...   130   3e-30
Alignment   gi|XP_582373.2| PREDICTED: similar to Retinol dehydrogenase 11 ...   128   9e-30
Alignment   gi|XP_584629.2| PREDICTED: similar to Retinol dehydrogenase 13,...   104   2e-22
Alignment   gi|XP_583859.2| PREDICTED: similar to short chain dehydrogenase...    93   5e-19
Alignment   gi|XP_584810.2| PREDICTED: similar to retinol dehydrogenase 13 ...    87   4e-17

>ref|XP_591168.2| PREDICTED: similar to dehydrogenase/reductase (SDR family) X-linked
            [Bos taurus]
          Length = 251

 Score =  382 bits (980), Expect = e-106
 Identities = 186/240 (77%), Positives = 207/240 (86%)
 Frame = +2

Query: 332  VEFLYCDLASMKSIRQFVQKFKMKKIPLHVLVNNAGVMMVPQRETEDGFEEHFGVNYXXX 511
            +EFLYCDLASM+SIR+FVQ FKMKK+PLHVLVNNAGVMMVPQR TEDGFEEHFGVNY   
Sbjct: 5    MEFLYCDLASMRSIREFVQTFKMKKLPLHVLVNNAGVMMVPQRTTEDGFEEHFGVNYLGH 64

Query: 512  XXXXXXXXXXXQASGSPGRSARVVTVSSATHYVGELDLDDLQSSGGYSPHGAYARSKLAL 691
                       Q SG+PG SARVVTVSSATHYVGEL+LDDLQSS  YS H AYA+SKLAL
Sbjct: 65   FLLTNLLLDTLQESGAPGHSARVVTVSSATHYVGELNLDDLQSSTYYSAHAAYAQSKLAL 124

Query: 692  VLFSHRLQALLAAKGSPVTANVADPGVVNTDLYRHVFWGTRLLKKLFGWWFFKTPDEGAW 871
            VLF++ LQALL A+G PVTA+VADPGVV+TDLYR+VFWGTRL+KKL GWW FKTPDEGAW
Sbjct: 125  VLFTYHLQALLTAQGMPVTASVADPGVVDTDLYRYVFWGTRLVKKLLGWWVFKTPDEGAW 184

Query: 872  TSVYAAVSPALEGVGGRYLYNEKEAKSLAITYDPKLQRQLWARSCQMTGIADMTRDTLWG 1051
            TSVYAAV+PALEG+GGRYLYNEKE +SL  TYDP+LQRQLWARSCQ+TGIAD+T +T  G
Sbjct: 185  TSVYAAVTPALEGLGGRYLYNEKETRSLEATYDPELQRQLWARSCQLTGIADVTWETFSG 244


>ref|XP_582319.2| PREDICTED: similar to retinol dehydrogenase 14 (all-trans and 9-cis)
            [Bos taurus]
          Length = 420

 Score =  182 bits (461), Expect = 7e-46
 Identities = 114/298 (38%), Positives = 158/298 (53%), Gaps = 15/298 (5%)
 Frame = +2

Query: 173  GRVAIVTGGTEGIGFATAKHLARLGMHVIIAGNNDSKAREAVRKIREETLN--------- 325
            G+  ++TG   G+G ATA  L RLG  VI+   +  +A EA  ++R E            
Sbjct: 127  GKTVLITGANSGLGRATAAELLRLGARVIMGCRDRERAEEAAGQLRREVCPAGGPDSGPN 186

Query: 326  ----DKVEFLYCDLASMKSIRQFVQKFKMKKIPLHVLVNNAGVMMVPQRETEDGFEEHFG 493
                 ++     DLAS+ S+R F Q+   ++  L VL+NNAGV   P  +TEDGFE  FG
Sbjct: 187  SGGAGELVVKELDLASLSSVRSFCQEMLQEEPRLDVLINNAGVFQCPYMKTEDGFEMQFG 246

Query: 494  VNYXXXXXXXXXXXXXXQASGSPGRSARVVTVSSATHYVGELDLDDLQSSGGYSPHGAYA 673
            VN+              ++S      +R+V VSS  +  G+++ +DL S   Y+    Y+
Sbjct: 247  VNHLGHFLLTNLLLGLLKSSAP----SRIVVVSSKLYKYGDINFEDLNSEQSYNKSFCYS 302

Query: 674  RSKLALVLFSHRLQALLAAKGSPVTANVADPGVVNTDLYRHVFWG--TRLLKKLFGWWFF 847
            RSKLA +LF+  L   L  +G+ VT NV  PG+V T+L RH+      R L  L  W FF
Sbjct: 303  RSKLANILFTRELARRL--EGTSVTVNVLHPGIVRTNLGRHIHIPLLVRPLFNLVSWAFF 360

Query: 848  KTPDEGAWTSVYAAVSPALEGVGGRYLYNEKEAKSLAITYDPKLQRQLWARSCQMTGI 1021
            KTP+EGA T+VY A SP +EGV GRY  + KE + L    D  + R+LW  S  M GI
Sbjct: 361  KTPEEGAQTAVYLASSPEVEGVSGRYFGDCKEEELLPKAMDESVARKLWDISEVMVGI 418


>ref|NP_899207.1| double substrate-specificity short chain dehydrogenase/reductase 2
            [Bos taurus]
          Length = 316

 Score =  166 bits (420), Expect = 4e-41
 Identities = 108/283 (38%), Positives = 150/283 (53%)
 Frame = +2

Query: 173  GRVAIVTGGTEGIGFATAKHLARLGMHVIIAGNNDSKAREAVRKIREETLNDKVEFLYCD 352
            G+V ++TG   GIG  TA+ LAR G  V IA  +  K   A  +I+ +T N +V     D
Sbjct: 39   GKVVVITGANTGIGKETARELARRGARVYIACRDVLKGESAASEIQADTKNSQVLVRKLD 98

Query: 353  LASMKSIRQFVQKFKMKKIPLHVLVNNAGVMMVPQRETEDGFEEHFGVNYXXXXXXXXXX 532
            L+  KSIR F + F  ++  LH+L+NNAGVM+ P  +T DGFE H  VN+          
Sbjct: 99   LSDTKSIRAFAEGFLAEEKQLHILINNAGVMLCPYSKTADGFETHLAVNHLGHFLLTHLL 158

Query: 533  XXXXQASGSPGRSARVVTVSSATHYVGELDLDDLQSSGGYSPHGAYARSKLALVLFSHRL 712
                + S      ARVV +SS  H++G++   DLQ    Y+   AY  SKLA VLF+  L
Sbjct: 159  LGRLKESA----PARVVNLSSVAHHLGKIRFHDLQGDKYYNLGFAYCHSKLANVLFTREL 214

Query: 713  QALLAAKGSPVTANVADPGVVNTDLYRHVFWGTRLLKKLFGWWFFKTPDEGAWTSVYAAV 892
               L  KG+ VT     PG+V + L RH F    LL +LF   F KT  EGA TS++ A+
Sbjct: 215  AKRL--KGTGVTTYAVHPGIVRSKLVRHSFL-LCLLWRLFS-PFLKTTWEGAQTSLHCAL 270

Query: 893  SPALEGVGGRYLYNEKEAKSLAITYDPKLQRQLWARSCQMTGI 1021
            +  LE + G+Y  + K+        + K   +LW  SC++ GI
Sbjct: 271  AEGLEPLSGKYFSDCKKTWVSPRARNNKTAERLWNVSCELLGI 313


>ref|XP_592820.2| PREDICTED: similar to retinol dehydrogenase 11 (predicted) [Bos
            taurus]
          Length = 377

 Score =  133 bits (335), Expect = 3e-31
 Identities = 97/286 (33%), Positives = 138/286 (48%), Gaps = 3/286 (1%)
 Frame = +2

Query: 173  GRVAIVTGGTEGIGFATAKHLARLGMHVIIAGNNDSKAREAVRKIREETLNDKVEFLYCD 352
            GR A+VTG   GIG  TA  LAR G  V++A  +  +   A   +R+E+ N++V F+  D
Sbjct: 36   GRTAVVTGANSGIGKMTALELARRGARVVLACRSRERGEAAAFDLRQESGNNEVIFMALD 95

Query: 353  LASMKSIRQFVQKFKMKKIPLHVLVNNAGVMMVPQRETEDGFEEHFGVNYXXXXXXXXXX 532
            LAS+ S+R F   F   +  L +L++NAG+    +  T + F     VN+          
Sbjct: 96   LASLASVRAFATAFLSSEPRLDILIHNAGISSCGR--TREPFNLLLRVNHIGPFLLTHLL 153

Query: 533  XXXXQASGSPGRSARVVTVSSATHYVGELDLDDLQSS--GGYSPHGAYARSKLALVLFSH 706
                + S      +RVV VSSA H  G LD   L     G      AYA SKLA VLF+ 
Sbjct: 154  LPRLKTSA----PSRVVVVSSAAHRRGRLDFTRLDHPVVGWQQELRAYANSKLANVLFAR 209

Query: 707  RLQALLAAKGSPVTANVADPGVVNTDLY-RHVFWGTRLLKKLFGWWFFKTPDEGAWTSVY 883
             L   L  +G+ VT   A PG VN++L+ RHV    R L +   W   + P  GA T +Y
Sbjct: 210  ELATQL--EGTGVTCYAAHPGPVNSELFLRHVPGWLRPLLRPLAWLVLRAPRGGAQTPLY 267

Query: 884  AAVSPALEGVGGRYLYNEKEAKSLAITYDPKLQRQLWARSCQMTGI 1021
             A+   +E + GRY  N    +      D +   +LW  S ++ G+
Sbjct: 268  CALQEGIEPLSGRYFANCHVEEVPPAARDDRAAHRLWEASRKLAGL 313


>ref|XP_584642.2| PREDICTED: similar to retinol dehydrogenase 11 (predicted) [Bos
            taurus]
          Length = 330

 Score =  133 bits (335), Expect = 3e-31
 Identities = 96/293 (32%), Positives = 147/293 (50%), Gaps = 7/293 (2%)
 Frame = +2

Query: 173  GRVAIVTGGTEGIGFATAKHLARLGMHVIIAGNNDSKAREAVRKIREETLNDKVEFLYCD 352
            G+ A+VTG   GIG A ++ LA  G  VI+A  +  + ++A+ +I+  + ++++     D
Sbjct: 49   GKTAVVTGANSGIGKAVSQELAHRGARVILACRSRERGQQALAEIQATSKSNRLLLGEVD 108

Query: 353  LASMKSIRQFVQKFKMKKIPLHVLVNNAGVMMVPQRETEDGFEEHFGVNYXXXXXXXXXX 532
            L+SM SIR F Q+   +   +H+LVNNA V   P   T +G +  F  NY          
Sbjct: 109  LSSMASIRSFAQRLLQECPEIHLLVNNAAVCGFPTTLTPEGLDLTFATNYTGPFLLTNLL 168

Query: 533  XXXXQASGSPGRSARVVTVSSATHYVGELDLDDLQSSG-GYSPHGAYARSKLALVLFSHR 709
                Q +G    SARVV VSS     G +D D L  +G   + +  Y  SKL L  F+ +
Sbjct: 169  QGALQRAG----SARVVNVSSFRQSHGYIDEDHLIGAGRPLTFNQNYDCSKLLLASFTGK 224

Query: 710  LQALLAAKGSPVTANVADPGVVNTDLYRHVFWGTRLLKKLFGWWFFKTPDEGAWTSVYAA 889
            L   L  +G+ VT N  DPGVV T + +H  W  R L  L   +FFK   +GA   +Y +
Sbjct: 225  LAQRL--QGTGVTVNSVDPGVVYTKIMKHFSWSYRFLFWLLS-FFFKDSKQGAVPVLYLS 281

Query: 890  VSPALEGVGGRYLYNEKEAKSLAIT------YDPKLQRQLWARSCQMTGIADM 1030
            ++  L+G+ G++      + S  IT       DP + + LW  S ++T +  M
Sbjct: 282  LAKELDGISGKHF-----SSSCVITLPPEAAQDPHVAQSLWNTSVRLTNLDKM 329


>ref|XP_870721.1| PREDICTED: similar to Retinol dehydrogenase 11 (Retinal reductase 1)
            (RalR1) (Prostate short-chain dehydrogenase/reductase 1)
            (Androgen-regulated short-chain dehydrogenase/reductase
            1) (HCV core-binding protein HCBP12) isoform 2 [Bos
            taurus]
          Length = 314

 Score =  130 bits (326), Expect = 3e-30
 Identities = 95/288 (32%), Positives = 137/288 (47%), Gaps = 4/288 (1%)
 Frame = +2

Query: 170  PGRVAIVTGGTEGIGFATAKHLARLGMHVIIAGNNDSKAREAVRKIREETLNDKVEFLYC 349
            PG+VA+VTG   GIG  TAK LAR G  V +A  +        R+I+  T N +V     
Sbjct: 14   PGKVAVVTGANAGIGKETAKELARRGARVYLACRDVQNGELVAREIQMMTGNQQVLVRKL 73

Query: 350  DLASMKSIRQFVQKFKMKKIPLHVLVNNAGVMMVPQRETEDGFEEHFGVNYXXXXXXXXX 529
            DLA  KSIR F ++F      +H++ ++   ++     +  G +      Y         
Sbjct: 74   DLADTKSIRAFAKRFLEDHKYIHLINSSPHFLICGFPGSSAGKDSACNTGYLGHFLLTHL 133

Query: 530  XXXXXQASGSPGRSARVVTVSSATHYVGELDLDDLQSSGGYSPHGAYARSKLALVLFSHR 709
                 + S      +RVV VSS  H +G +   +LQ    Y    AY  SKLA +LF+  
Sbjct: 134  LLEKLEESA----PSRVVNVSSLAHLLGRIHFHNLQGEKFYQSGLAYCHSKLANILFTQE 189

Query: 710  LQALLAAKGSPVTANVADPGVVNTDLYRHVFWGTRLLKKLFGWW----FFKTPDEGAWTS 877
            L   L  KGS VT     PG VN++L RH    + L++ +  WW    F KTP +GA TS
Sbjct: 190  LARRL--KGSGVTVYSVHPGTVNSELVRH----SALMRWI--WWIFSFFIKTPQQGAQTS 241

Query: 878  VYAAVSPALEGVGGRYLYNEKEAKSLAITYDPKLQRQLWARSCQMTGI 1021
            +Y A++  LE + G +  +   A   A   +  + R+LW  SC + GI
Sbjct: 242  LYCALTEGLEVLSGNHFSDCHVAWVSAQARNETVARRLWDVSCDLLGI 289


>ref|XP_582373.2| PREDICTED: similar to Retinol dehydrogenase 11 (Retinal reductase 1)
            (RalR1) (Prostate short-chain dehydrogenase/reductase 1)
            (Androgen-regulated short-chain dehydrogenase/reductase
            1) (HCV core-binding protein HCBP12) isoform 1 [Bos
            taurus]
          Length = 308

 Score =  128 bits (322), Expect = 9e-30
 Identities = 98/288 (34%), Positives = 136/288 (47%), Gaps = 4/288 (1%)
 Frame = +2

Query: 170  PGRVAIVTGGTEGIGFATAKHLARLGMHVIIAGNNDSKAREAVRKIREETLNDKVEFLYC 349
            PG+VA+VTG   GIG  TAK LAR G  V +A  +        R+I+  T N +V     
Sbjct: 14   PGKVAVVTGANAGIGKETAKELARRGARVYLACRDVQNGELVAREIQMMTGNQQVLVRKL 73

Query: 350  DLASMKSIRQFVQKFKMKKIPLHVLVNNAGVMMVPQRETEDGFEEHFGVNYXXXXXXXXX 529
            DLA  KSIR F ++F      +H L+N+ G        +  G +      Y         
Sbjct: 74   DLADTKSIRAFAKRFLEDHKYIH-LINSVGF-----PGSSAGKDSACNTGYLGHFLLTHL 127

Query: 530  XXXXXQASGSPGRSARVVTVSSATHYVGELDLDDLQSSGGYSPHGAYARSKLALVLFSHR 709
                 + S      +RVV VSS  H +G +   +LQ    Y    AY  SKLA +LF+  
Sbjct: 128  LLEKLEESA----PSRVVNVSSLAHLLGRIHFHNLQGEKFYQSGLAYCHSKLANILFTQE 183

Query: 710  LQALLAAKGSPVTANVADPGVVNTDLYRHVFWGTRLLKKLFGWW----FFKTPDEGAWTS 877
            L   L  KGS VT     PG VN++L RH    + L++ +  WW    F KTP +GA TS
Sbjct: 184  LARRL--KGSGVTVYSVHPGTVNSELVRH----SALMRWI--WWIFSFFIKTPQQGAQTS 235

Query: 878  VYAAVSPALEGVGGRYLYNEKEAKSLAITYDPKLQRQLWARSCQMTGI 1021
            +Y A++  LE + G +  +   A   A   +  + R+LW  SC + GI
Sbjct: 236  LYCALTEGLEVLSGNHFSDCHVAWVSAQARNETVARRLWDVSCDLLGI 283


>ref|XP_584629.2| PREDICTED: similar to Retinol dehydrogenase 13, partial [Bos
           taurus]
          Length = 148

 Score =  104 bits (259), Expect = 2e-22
 Identities = 59/130 (45%), Positives = 77/130 (59%)
 Frame = +2

Query: 113 AQLLRRCRGGFAEPVFPPQPGRVAIVTGGTEGIGFATAKHLARLGMHVIIAGNNDSKARE 292
           A LL+    G A P     PG+  IVTG   GIG  TA  LA+ G ++I+A  +  K   
Sbjct: 18  AVLLKDFVAGGACPSKATIPGKTVIVTGANTGIGKQTALELAKRGGNIILACRDMEKCEA 77

Query: 293 AVRKIREETLNDKVEFLYCDLASMKSIRQFVQKFKMKKIPLHVLVNNAGVMMVPQRETED 472
           A ++IR ETLN +V   + DLAS+KSIR+F  K   ++  +H+L+NNA VM  P   TED
Sbjct: 78  AAKEIRGETLNHRVNARHLDLASLKSIREFAAKVTEEEEHVHILINNAAVMRCPHWTTED 137

Query: 473 GFEEHFGVNY 502
           GFE   GVNY
Sbjct: 138 GFEMQLGVNY 147


>ref|XP_583859.2| PREDICTED: similar to short chain dehydrogenase/reductase [Bos
           taurus]
          Length = 317

 Score = 92.8 bits (229), Expect = 5e-19
 Identities = 80/252 (31%), Positives = 120/252 (47%), Gaps = 8/252 (3%)
 Frame = +2

Query: 170 PGRVAIVTGGTEGIGFATAKHLARLGMHVIIAGNNDSKAREAVRKIREETLNDKVEFLYC 349
           PGR  +VTGG  GIG ATA  +A+ G  V +   + S+A  A  +I  E+ N  +     
Sbjct: 39  PGRAFMVTGGNSGIGKATAMEIAKRGGTVHLVCRDHSRAEGAKAEIIRESGNQNIFLHIV 98

Query: 350 DLASMKSIRQFVQKFKMKKIPLHVLVNNAGVMMVPQRETEDGFEEHFGVNYXXXXXXXXX 529
           DL+  KS+ +FV+ FK +   L+VL+NNAG M+  +  TEDG E++F  N          
Sbjct: 99  DLSLPKSVWKFVENFKQEH-TLNVLINNAGCMVNKRELTEDGLEKNFATNTLGVYVLTTA 157

Query: 530 XXXXXQASGSPGRSARVVTVSSATHYVGELDLDDLQSS-GGYSPHGAYARSKLALVLFSH 706
                +    P    RV+TVSS    V +L+ DD QS    +     YA++K   V+ + 
Sbjct: 158 LIPVLEKEHDP----RVITVSSGGMLVQKLNTDDPQSERTAFDGTMVYAQNKRQQVVLTE 213

Query: 707 RLQALLAAKGSP-VTANVADPGVVNTDLYR------HVFWGTRLLKKLFGWWFFKTPDEG 865
           R      A+  P +  +   PG V+T   R      H   G RL          ++  +G
Sbjct: 214 RW-----ARAHPAIHFSCMHPGWVDTPGVRLSMPGFHARLGARL----------RSEAQG 258

Query: 866 AWTSVYAAVSPA 901
           A T ++ A++PA
Sbjct: 259 ADTVLWLALAPA 270


>ref|XP_584810.2| PREDICTED: similar to retinol dehydrogenase 13 (all-trans and 9-cis)
            [Bos taurus]
          Length = 223

 Score = 86.7 bits (213), Expect = 4e-17
 Identities = 55/156 (35%), Positives = 81/156 (51%), Gaps = 6/156 (3%)
 Frame = +2

Query: 572  ARVVTVSSATHYVGELDLDDLQ-SSGGYSPHGAYARSKLALVLFSHRLQALLAAKGSPVT 748
            +R++ VSS  H  G +D +DL      Y    AY +SKLA+V+ +  L   L  +G+ VT
Sbjct: 55   SRIINVSSLAHVAGHIDFEDLNWEKRKYDTKAAYCQSKLAVVVSTKELSRRL--QGTGVT 112

Query: 749  ANVADPGVVNTDLYRHV-----FWGTRLLKKLFGWWFFKTPDEGAWTSVYAAVSPALEGV 913
             N   PGV  T+L RH       + +  L  +F W   K+P+  A  SVY AV+  LEGV
Sbjct: 113  VNALHPGVARTELGRHTGMHSSAFSSFTLGPIF-WLLVKSPELAAQPSVYLAVAEELEGV 171

Query: 914  GGRYLYNEKEAKSLAITYDPKLQRQLWARSCQMTGI 1021
             G+Y    KE        D ++ ++LWA S ++ G+
Sbjct: 172  SGKYFDVLKEKPPAPEAEDEEVAKRLWAESVRLVGL 207


  Database: RefSeqBP
    Posted date:  Aug 1, 2006  7:14 PM
  Number of letters in database: 16,112,626
  Number of sequences in database:  33,508
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 41,182,257
Number of Sequences: 33508
Number of extensions: 1105006
Number of successful extensions: 6955
Number of sequences better than 1.0e-05: 10
Number of HSP's better than  0.0 without gapping: 5016
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6833
length of database: 16,112,626
effective HSP length: 105
effective length of database: 12,594,286
effective search space used: 4307245812
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqCP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= LVRM1_0187_E10
         (1343 letters)

Database: RefSeqCP 
           33,732 sequences; 19,266,565 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|XP_852222.1| PREDICTED: similar to dehydrogenase/reductase (...   482   e-136
Alignment   gi|XP_854127.1| PREDICTED: similar to Retinol dehydrogenase 13 ...   183   4e-46
Alignment   gi|XP_540096.2| PREDICTED: similar to retinol dehydrogenase 14 ...   177   2e-44
Alignment   gi|XP_547866.2| PREDICTED: similar to retinol dehydrogenase 12 ...   177   3e-44
Alignment   gi|XP_854354.1| PREDICTED: similar to Retinol dehydrogenase 11 ...   173   4e-43
Alignment   gi|XP_857582.1| PREDICTED: similar to retinol dehydrogenase 14 ...   134   2e-31
Alignment   gi|XP_548293.2| PREDICTED: similar to retinol dehydrogenase 11 ...   130   4e-30
Alignment   gi|XP_533000.2| PREDICTED: similar to Retinol dehydrogenase 12 ...   127   2e-29
Alignment   gi|XP_852623.1| PREDICTED: similar to WW domain-containing oxid...   121   2e-27
Alignment   gi|XP_852675.1| PREDICTED: similar to Carbonyl reductase [NADPH...    67   4e-11

>ref|XP_852222.1| PREDICTED: similar to dehydrogenase/reductase (SDR family) X-linked
            [Canis familiaris]
          Length = 387

 Score =  482 bits (1241), Expect = e-136
 Identities = 235/309 (76%), Positives = 262/309 (84%)
 Frame = +2

Query: 125  RRCRGGFAEPVFPPQPGRVAIVTGGTEGIGFATAKHLARLGMHVIIAGNNDSKAREAVRK 304
            R  R     P   PQP RVAIVTGGT+GIG++TAKHLARLGMHVI+AGNNDS A + VRK
Sbjct: 79   RFSRVHMGNPFLAPQPERVAIVTGGTDGIGYSTAKHLARLGMHVILAGNNDSSAPDVVRK 138

Query: 305  IREETLNDKVEFLYCDLASMKSIRQFVQKFKMKKIPLHVLVNNAGVMMVPQRETEDGFEE 484
            I+EETLNDKVEFLYCDLAS++SIRQFVQKFK KKIPLHVLVNNAGVMMVP+R TEDGFEE
Sbjct: 139  IQEETLNDKVEFLYCDLASLRSIRQFVQKFKKKKIPLHVLVNNAGVMMVPERTTEDGFEE 198

Query: 485  HFGVNYXXXXXXXXXXXXXXQASGSPGRSARVVTVSSATHYVGELDLDDLQSSGGYSPHG 664
            HFG+NY              + SG+PGR ARVVTVSSATHY+GELD+DDLQ S  YSPH 
Sbjct: 199  HFGLNYLGHFLLTNLLLDTLKESGAPGRCARVVTVSSATHYIGELDMDDLQGSRCYSPHA 258

Query: 665  AYARSKLALVLFSHRLQALLAAKGSPVTANVADPGVVNTDLYRHVFWGTRLLKKLFGWWF 844
            AYA+SKLALVLF++ LQ LLAA+GSPVTANV DPGVVNT+LYRHVFWGTRL+KKLFGWWF
Sbjct: 259  AYAQSKLALVLFTYHLQRLLAAQGSPVTANVVDPGVVNTNLYRHVFWGTRLIKKLFGWWF 318

Query: 845  FKTPDEGAWTSVYAAVSPALEGVGGRYLYNEKEAKSLAITYDPKLQRQLWARSCQMTGIA 1024
            FKTPDEGAWTSVYAAV+P LEG+GGRYLYNEKE KSLA+TYD  LQ +LWARSCQMTGI 
Sbjct: 319  FKTPDEGAWTSVYAAVTPDLEGLGGRYLYNEKETKSLAVTYDLDLQTELWARSCQMTGIT 378

Query: 1025 DMTRDTLWG 1051
            D+++DT  G
Sbjct: 379  DVSQDTFSG 387


>ref|XP_854127.1| PREDICTED: similar to Retinol dehydrogenase 13 [Canis familiaris]
          Length = 334

 Score =  183 bits (464), Expect = 4e-46
 Identities = 118/309 (38%), Positives = 161/309 (52%), Gaps = 6/309 (1%)
 Frame = +2

Query: 113  AQLLRRCRGGFAEPVFPPQPGRVAIVTGGTEGIGFATAKHLARLGMHVIIAGNNDSKARE 292
            A LLR    G A P     PG+  IVTG   GIG  TA  LAR G ++I+A  +  K   
Sbjct: 18   AVLLRDYIAGGACPSKATIPGKTVIVTGANTGIGKQTALELARRGGNIILACRDMEKCEA 77

Query: 293  AVRKIREETLNDKVEFLYCDLASMKSIRQFVQKFKMKKIPLHVLVNNAGVMMVPQRETED 472
            A ++IR ETLN +V   + DLAS+KSIR+F  K   ++  +H+LVNNA VM  P   T+D
Sbjct: 78   AAKEIRGETLNHRVSAWHLDLASLKSIREFAAKIIEEEEQVHILVNNAAVMRCPHWTTKD 137

Query: 473  GFEEHFGVNYXXXXXXXXXXXXXXQASGSPGRSARVVTVSSATHYVGELDLDDLQ-SSGG 649
            GFE  FGVN+              +AS      +R++ +SS  H  G +D DDL      
Sbjct: 138  GFEMQFGVNHLGHFLLTNLLLDKLKASA----PSRIINLSSLAHVAGHIDFDDLNWEKRK 193

Query: 650  YSPHGAYARSKLALVLFSHRLQALLAAKGSPVTANVADPGVVNTDLYRHV-----FWGTR 814
            Y    AY +SKLA++LF+  L   L  +G+ VT N   PGV  T+L RH       + + 
Sbjct: 194  YDTKAAYCQSKLAVILFTKELSRRL--QGTGVTVNALHPGVARTELGRHTGMHSSAFSSF 251

Query: 815  LLKKLFGWWFFKTPDEGAWTSVYAAVSPALEGVGGRYLYNEKEAKSLAITYDPKLQRQLW 994
             L  +F W   K+P   A  S Y AV+  LEGV G+Y    KE        D ++ ++LW
Sbjct: 252  TLGPIF-WLLVKSPQLAAQPSTYLAVAEELEGVSGKYFDGLKEKAPAPEAEDEEVAQRLW 310

Query: 995  ARSCQMTGI 1021
            A S ++ G+
Sbjct: 311  AESARLVGL 319


>ref|XP_540096.2| PREDICTED: similar to retinol dehydrogenase 14 (all-trans and 9-cis)
            isoform 1 [Canis familiaris]
          Length = 336

 Score =  177 bits (450), Expect = 2e-44
 Identities = 113/298 (37%), Positives = 158/298 (53%), Gaps = 15/298 (5%)
 Frame = +2

Query: 173  GRVAIVTGGTEGIGFATAKHLARLGMHVIIAGNNDSKAREAVRKIREETLN--------- 325
            G+  ++TG   G+G ATA  L RLG  VI+   + ++A EA  ++R E            
Sbjct: 43   GKTVLITGANSGLGRATAAALLRLGARVIMGCRDRARAEEAAGQLRRELRQAGGREPGSD 102

Query: 326  ----DKVEFLYCDLASMKSIRQFVQKFKMKKIPLHVLVNNAGVMMVPQRETEDGFEEHFG 493
                 ++     DLAS++S+R F Q+   ++  L VL+NNAG+   P  +TEDGFE  FG
Sbjct: 103  VGAAGELVVRELDLASLRSVRAFCQEVLQEEPRLDVLINNAGIFQCPYMKTEDGFEMQFG 162

Query: 494  VNYXXXXXXXXXXXXXXQASGSPGRSARVVTVSSATHYVGELDLDDLQSSGGYSPHGAYA 673
            VN+              + S      +R+V VSS  +  G+++ +DL S   Y+    Y+
Sbjct: 163  VNHLGHFLLTNLLLGLLKNSAP----SRIVVVSSKLYKYGDINFEDLNSEQSYNKSFCYS 218

Query: 674  RSKLALVLFSHRLQALLAAKGSPVTANVADPGVVNTDLYRHVFWG--TRLLKKLFGWWFF 847
            RSKLA +LF+  L   L  +G+ VT NV  PG+V T+L RH+      R L  L  W FF
Sbjct: 219  RSKLANILFTRELARRL--EGTNVTVNVLHPGIVRTNLGRHIHIPLLVRPLFNLVSWAFF 276

Query: 848  KTPDEGAWTSVYAAVSPALEGVGGRYLYNEKEAKSLAITYDPKLQRQLWARSCQMTGI 1021
            KTP EGA TSVY A SP +EGV G+Y  + KE + L    D  + R+LW  S  M GI
Sbjct: 277  KTPVEGAQTSVYLASSPEVEGVSGKYFGDCKEEELLPKAMDESVARKLWDISEVMVGI 334


>ref|XP_547866.2| PREDICTED: similar to retinol dehydrogenase 12 (all-trans and 9-cis)
            [Canis familiaris]
          Length = 303

 Score =  177 bits (448), Expect = 3e-44
 Identities = 112/284 (39%), Positives = 154/284 (54%)
 Frame = +2

Query: 170  PGRVAIVTGGTEGIGFATAKHLARLGMHVIIAGNNDSKAREAVRKIREETLNDKVEFLYC 349
            PG+V ++TG   GIG  TA+ LAR G  V IA  +  K   A  +IR +T N +V     
Sbjct: 25   PGKVVVITGANTGIGKETARELARRGARVYIACRDVLKGESAASEIRADTKNSQVLVRKL 84

Query: 350  DLASMKSIRQFVQKFKMKKIPLHVLVNNAGVMMVPQRETEDGFEEHFGVNYXXXXXXXXX 529
            DL+  KSIR F + F  ++  LH+L+NNAGVMM P  +T DGFE H GVN+         
Sbjct: 85   DLSDTKSIRAFAEGFLAEEKQLHILINNAGVMMCPYSKTADGFETHLGVNHLGHFLLTHL 144

Query: 530  XXXXXQASGSPGRSARVVTVSSATHYVGELDLDDLQSSGGYSPHGAYARSKLALVLFSHR 709
                 + S      ARVV +SS  H++G++   DLQ    YS   AY  SKLA +LF+  
Sbjct: 145  LLERLKES----TPARVVNLSSVAHHIGKIHFHDLQGEKRYSRGFAYCHSKLANMLFTRE 200

Query: 710  LQALLAAKGSPVTANVADPGVVNTDLYRHVFWGTRLLKKLFGWWFFKTPDEGAWTSVYAA 889
            L   L  +G+ VT     PGVV+++L RH F    LL ++F   F K+  EGA TS++ A
Sbjct: 201  LAKRL--QGTGVTTYAVHPGVVSSELVRHSFL-LCLLWRIFS-PFVKSAREGAQTSLHCA 256

Query: 890  VSPALEGVGGRYLYNEKEAKSLAITYDPKLQRQLWARSCQMTGI 1021
            ++  LE + G+Y  + K A       D K   +LW  SC++ GI
Sbjct: 257  LAEGLEPLSGKYFSDCKRAWVSPRARDNKTAERLWNVSCELLGI 300


>ref|XP_854354.1| PREDICTED: similar to Retinol dehydrogenase 11 (Retinal reductase 1)
            (RalR1) (Prostate short-chain dehydrogenase/reductase 1)
            (Androgen-regulated short-chain dehydrogenase/reductase
            1) (HCV core-binding protein HCBP12) [Canis familiaris]
          Length = 337

 Score =  173 bits (438), Expect = 4e-43
 Identities = 111/288 (38%), Positives = 152/288 (52%), Gaps = 4/288 (1%)
 Frame = +2

Query: 170  PGRVAIVTGGTEGIGFATAKHLARLGMHVIIAGNNDSKAREAVRKIREETLNDKVEFLYC 349
            PG+VA+VTG   GIG  TAK LA+ G  V +A  +  K     R+I+  T N +V     
Sbjct: 59   PGKVAVVTGANTGIGKETAKELAQRGARVYLACRDVLKGELVAREIQTMTGNKQVLVRKL 118

Query: 350  DLASMKSIRQFVQKFKMKKIPLHVLVNNAGVMMVPQRETEDGFEEHFGVNYXXXXXXXXX 529
            DLA  KSIR F + F  ++  LH+L+NNAGVMM P  +T DGFE H GVN+         
Sbjct: 119  DLADTKSIRAFAKGFLAEEKHLHILINNAGVMMCPYTKTVDGFEMHMGVNHLGHFLLTHL 178

Query: 530  XXXXXQASGSPGRSARVVTVSSATHYVGELDLDDLQSSGGYSPHGAYARSKLALVLFSHR 709
                 + S      +R+V VSS  H++G +   DLQ    Y+   AY  SKLA +LF+  
Sbjct: 179  LLEKLKESA----PSRIVNVSSLAHHLGRIHFHDLQGEKFYNSGLAYCHSKLANILFTQE 234

Query: 710  LQALLAAKGSPVTANVADPGVVNTDLYRHVFWGTRLLKKLFGWW----FFKTPDEGAWTS 877
            L   L  KGS +TA    PG V ++L RH    +  +K +  WW    F KTP +GA TS
Sbjct: 235  LARRL--KGSGITAYSVHPGTVKSELVRH----SPFMKWM--WWLFSFFIKTPQQGAQTS 286

Query: 878  VYAAVSPALEGVGGRYLYNEKEAKSLAITYDPKLQRQLWARSCQMTGI 1021
            +Y A++  LE + G +  +   A   A   +  + R+LW  SC + GI
Sbjct: 287  LYCAITEGLEVLSGHHFSDCSVAWVSAQARNETIARRLWDVSCDLLGI 334


>ref|XP_857582.1| PREDICTED: similar to retinol dehydrogenase 14 (all-trans and 9-cis)
            isoform 4 [Canis familiaris]
          Length = 307

 Score =  134 bits (338), Expect = 2e-31
 Identities = 99/298 (33%), Positives = 139/298 (46%), Gaps = 15/298 (5%)
 Frame = +2

Query: 173  GRVAIVTGGTEGIGFATAKHLARLGMHVIIAGNNDSKAREAVRKIREETLN--------- 325
            G+  ++TG   G+G ATA  L RLG  VI+   + ++A EA  ++R E            
Sbjct: 43   GKTVLITGANSGLGRATAAALLRLGARVIMGCRDRARAEEAAGQLRRELRQAGGREPGSD 102

Query: 326  ----DKVEFLYCDLASMKSIRQFVQKFKMKKIPLHVLVNNAGVMMVPQRETEDGFEEHFG 493
                 ++     DLAS++S+R F Q+                                FG
Sbjct: 103  VGAAGELVVRELDLASLRSVRAFCQEVLQ-----------------------------FG 133

Query: 494  VNYXXXXXXXXXXXXXXQASGSPGRSARVVTVSSATHYVGELDLDDLQSSGGYSPHGAYA 673
            VN+              + S      +R+V VSS  +  G+++ +DL S   Y+    Y+
Sbjct: 134  VNHLGHFLLTNLLLGLLKNSAP----SRIVVVSSKLYKYGDINFEDLNSEQSYNKSFCYS 189

Query: 674  RSKLALVLFSHRLQALLAAKGSPVTANVADPGVVNTDLYRHVFWG--TRLLKKLFGWWFF 847
            RSKLA +LF+  L   L  +G+ VT NV  PG+V T+L RH+      R L  L  W FF
Sbjct: 190  RSKLANILFTRELARRL--EGTNVTVNVLHPGIVRTNLGRHIHIPLLVRPLFNLVSWAFF 247

Query: 848  KTPDEGAWTSVYAAVSPALEGVGGRYLYNEKEAKSLAITYDPKLQRQLWARSCQMTGI 1021
            KTP EGA TSVY A SP +EGV G+Y  + KE + L    D  + R+LW  S  M GI
Sbjct: 248  KTPVEGAQTSVYLASSPEVEGVSGKYFGDCKEEELLPKAMDESVARKLWDISEVMVGI 305


>ref|XP_548293.2| PREDICTED: similar to retinol dehydrogenase 11 (predicted) [Canis
            familiaris]
          Length = 377

 Score =  130 bits (326), Expect = 4e-30
 Identities = 99/287 (34%), Positives = 138/287 (48%), Gaps = 4/287 (1%)
 Frame = +2

Query: 173  GRVAIVTGGTEGIGFATAKHLARLGMHVIIAGNNDSKAREAVRKIREETLNDKVEFLYCD 352
            GR A+VTG   GIG  TA  LAR G  V++A  +  +   A   +R+E+ N++V F+  D
Sbjct: 36   GRTAVVTGANSGIGKMTALELARRGARVVLACRSRERGEAAAFDLRQESGNNEVIFMALD 95

Query: 353  LASMKSIRQFVQKFKMKKIPLHVLVNNAGVMMVPQRETEDGFEEHFGVNYXXXXXXXXXX 532
            LAS+ S+R F   F   +  L +L++NAG+    +  T   F     VN+          
Sbjct: 96   LASLASVRAFATAFLSSEPRLDILIHNAGISSCGR--THKPFNLLLRVNHIGPFLLTHLL 153

Query: 533  XXXXQASGSPGRSARVVTVSSATHYVGELDLDDLQSS--GGYSPHGAYARSKLALVLFSH 706
                +        +RVV VSSA H  G LD   L     G      AYA SKLA VLF+ 
Sbjct: 154  LPRLKTCA----PSRVVVVSSAAHRRGRLDFTRLDRPVVGWQQELRAYADSKLANVLFAR 209

Query: 707  RLQALLAAKGSPVTANVADPGVVNTDLY-RHV-FWGTRLLKKLFGWWFFKTPDEGAWTSV 880
             L   L  +G+ VT   A PG VN++L+ RHV  W   LL+ L  W   + P  GA T +
Sbjct: 210  ELATQL--EGTGVTCYAAHPGPVNSELFLRHVPGWLCPLLRPL-AWLMLRAPRGGAQTPL 266

Query: 881  YAAVSPALEGVGGRYLYNEKEAKSLAITYDPKLQRQLWARSCQMTGI 1021
            Y A+   +E + GRY  N    +      D +   QLW  S ++ G+
Sbjct: 267  YCALQEGIEPLSGRYFANCHVEEVPPAARDDRAAHQLWEASKRLAGL 313


>ref|XP_533000.2| PREDICTED: similar to Retinol dehydrogenase 12 [Canis familiaris]
          Length = 596

 Score =  127 bits (320), Expect = 2e-29
 Identities = 98/293 (33%), Positives = 144/293 (49%), Gaps = 7/293 (2%)
 Frame = +2

Query: 173  GRVAIVTGGTEGIGFATAKHLARLGMHVIIAGNNDSKAREAVRKIREETLNDKVEFLYCD 352
            G+ A+VTG   GIG A  + LAR G  VI+A  N  + ++A+ +I+  +    +     D
Sbjct: 315  GKTAVVTGANSGIGKAVCQELARRGARVILACRNWERGQKALAEIQVASKGTCLLLGQVD 374

Query: 353  LASMKSIRQFVQKFKMKKIPLHVLVNNAGVMMVPQRETEDGFEEHFGVNYXXXXXXXXXX 532
            L+SM SIR F +    +   +H+LVNNA +   P+  T +G +  F  NY          
Sbjct: 375  LSSMASIRSFARWLLQEYPEIHLLVNNAAISGFPKTLTPEGLDLTFATNYVGPFLLTNLL 434

Query: 533  XXXXQASGSPGRSARVVTVSSATHYVGELDLDDLQSSG-GYSPHGAYARSKLALVLFSHR 709
                Q +G    SARVV VSS  H  G +D   L  +G   +   +Y  SKL L  F+  
Sbjct: 435  QGALQRAG----SARVVNVSSFRHAHGYVDEKHLTGAGKPLNLIQSYDCSKLLLTSFTGE 490

Query: 710  LQALLAAKGSPVTANVADPGVVNTDLYRHVFWGTRLLKKLFGWWFFKTPDEGAWTSVYAA 889
            L   L  +G+ VT N  DPGVV T++ +   W  R L  LF  +F K   +GA   +Y +
Sbjct: 491  LARRL--QGTGVTVNSVDPGVVYTEIMKPYPWLYRFLFWLFS-FFCKDVKQGAIPVLYLS 547

Query: 890  VSPALEGVGGRYLYNEKEAKSLAIT------YDPKLQRQLWARSCQMTGIADM 1030
            ++  L+GV G+Y      + S  IT       DP++ + LW  S Q+T +  M
Sbjct: 548  LAKELDGVSGKYF-----SSSCMITLPTEAAQDPQVAQSLWNASVQLTNLDKM 595


>ref|XP_852623.1| PREDICTED: similar to WW domain-containing oxidoreductase isoform 1
           [Canis familiaris]
          Length = 383

 Score =  121 bits (303), Expect = 2e-27
 Identities = 87/224 (38%), Positives = 111/224 (49%), Gaps = 8/224 (3%)
 Frame = +2

Query: 173 GRVAIVTGGTEGIGFATAKHLARLGMHVIIAGNNDSKAREAVRKIREETLNDKVEFLYCD 352
           G+V +VTG   GIGF TAK  A  G HVI+A  N ++A EAV +I  E    KVE +  D
Sbjct: 124 GKVVVVTGANSGIGFETAKSFALHGAHVILACRNMTRANEAVSQILGEWHKAKVEAMTLD 183

Query: 353 LASMKSIRQFVQKFKMKKIPLHVLVNNAGVMMVPQRETEDGFEEHFGVNYXXXXXXXXXX 532
           LA ++S++ F Q FK K + LHVLV NA    +P   T+DG E  F VN+          
Sbjct: 184 LALLRSVQHFAQAFKAKNVSLHVLVCNAAAFALPWSLTKDGLETTFQVNHLGHFYLVQLL 243

Query: 533 XXXXQASGSPGRSARVVTVSSATHYV-------GELDLDDLQ-SSGGYSPHGAYARSKLA 688
                 S      ARVV VSS +H         G+LD   L  S   Y    AY RSKL 
Sbjct: 244 QDVLCRSA----PARVVVVSSESHRFTDINDSSGKLDFSRLSPSKSDYWAMLAYNRSKLC 299

Query: 689 LVLFSHRLQALLAAKGSPVTANVADPGVVNTDLYRHVFWGTRLL 820
            +LFS+ L   L+ +G  VT+N   PG +        +W   LL
Sbjct: 300 NILFSNELHRRLSPRG--VTSNAVHPGNMMYSSIHRNWWVYTLL 341


>ref|XP_852675.1| PREDICTED: similar to Carbonyl reductase [NADPH] 1 (NADPH-dependent
           carbonyl reductase 1) (Prostaglandin-E(2) 9-reductase)
           (Prostaglandin 9-ketoreductase) (15-hydroxyprostaglandin
           dehydrogenase [NADP+]) [Canis familiaris]
          Length = 277

 Score = 67.0 bits (162), Expect = 4e-11
 Identities = 77/290 (26%), Positives = 122/290 (42%), Gaps = 35/290 (12%)
 Frame = +2

Query: 176 RVAIVTGGTEGIGFATAKHLAR-LGMHVIIAGNNDSKAREAVRKIREETLNDKVEFL-YC 349
           RVA+VTG  +GIGFA A+ L R     V++   ++++ R AV++++ E L+ +   L   
Sbjct: 6   RVALVTGANKGIGFAIARELCRQFSGDVVLTARDEARGRAAVQQLQAEGLSPRFHLLDID 65

Query: 350 DLASMKSIRQFVQKFKMKKIPLHVLVNNAGVMMVPQRETEDGFEEHFGVNYXXXXXXXXX 529
           DL S++++R F++K   +   L VLVNNAG+      +T D    H              
Sbjct: 66  DLQSIRALRDFLRK---EYGGLDVLVNNAGIAF----KTNDPTPFHIQAEVTMKTNFFGT 118

Query: 530 XXXXXQASGSPGRSARVVTVSSA------------------THYVGELDLDDLQS----- 640
                +         RVV VSS                   +  + E +L  L +     
Sbjct: 119 RDVCTELLPLMKPQGRVVNVSSVVSVRALKSCSPELQQKFRSEAITEEELVGLMNKFVED 178

Query: 641 -------SGGYSPHGAYARSKLALVLFS--HRLQALLAAKGSPVTANVADPGVVNTDLYR 793
                  + G+ P  AY  +K+ + + S  H  +     +   +  N   PG V TD+  
Sbjct: 179 TKKGVHRNEGW-PDNAYGVTKIGVTVLSRIHARKLSEQRRDDKILLNACCPGWVRTDMA- 236

Query: 794 HVFWGTRLLKKLFGWWFFKTPDEGAWTSVYAAVSPA-LEGVGGRYLYNEK 940
               G R           K+P+EGA T VY A+ P+  EG  G +L  +K
Sbjct: 237 ----GPRAP---------KSPEEGAETPVYLALLPSDAEGPHGEFLMEKK 273


  Database: RefSeqCP
    Posted date:  Aug 1, 2006  9:25 PM
  Number of letters in database: 19,266,565
  Number of sequences in database:  33,732
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 48,321,259
Number of Sequences: 33732
Number of extensions: 1299484
Number of successful extensions: 8457
Number of sequences better than 1.0e-05: 10
Number of HSP's better than  0.0 without gapping: 5819
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 8285
length of database: 19,266,565
effective HSP length: 106
effective length of database: 15,690,973
effective search space used: 5350621793
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqSP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= LVRM1_0187_E10
         (1343 letters)

Database: RefSeqSP 
           1040 sequences; 434,620 total letters

Searching...done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_999238.1| 20-beta-hydroxysteroid dehydrogenase [Sus scrofa]     49   2e-07
Alignment   gi|NP_999184.1| carbonyl reductase/NADP-retinol dehydrogenase [...    49   3e-07

>ref|NP_999238.1| 20-beta-hydroxysteroid dehydrogenase [Sus scrofa]
          Length = 289

 Score = 49.3 bits (116), Expect = 2e-07
 Identities = 30/90 (33%), Positives = 51/90 (56%), Gaps = 1/90 (1%)
 Frame = +2

Query: 176 RVAIVTGGTEGIGFATAKHLAR-LGMHVIIAGNNDSKAREAVRKIREETLNDKVEFLYCD 352
           RVA+VTG  +GIGFA  + L R     V++   + ++ + AV++++ E L+ +  F   D
Sbjct: 6   RVALVTGANKGIGFAIVRDLCRQFAGDVVLTARDVARGQAAVKQLQAEGLSPR--FHQLD 63

Query: 353 LASMKSIRQFVQKFKMKKIPLHVLVNNAGV 442
           +  ++SIR      + +   L VLVNNA +
Sbjct: 64  IIDLQSIRALCDFLRKEYGGLDVLVNNAAI 93


>ref|NP_999184.1| carbonyl reductase/NADP-retinol dehydrogenase [Sus scrofa]
          Length = 260

 Score = 48.9 bits (115), Expect = 3e-07
 Identities = 54/224 (24%), Positives = 88/224 (39%), Gaps = 3/224 (1%)
 Frame = +2

Query: 164 PQPGRVAIVTGGTEGIGFATAKHLARLGMHVIIAGNNDSKAREAVRKIREETLNDKVEFL 343
           P   +VA+VT  T+GIG A A+ LA+ G HV+++          V  ++ E L+  V   
Sbjct: 11  PLENKVALVTASTDGIGLAIARRLAQDGAHVVVSSRKQENVDRTVATLQGEGLS--VTGT 68

Query: 344 YCDLASMKSIRQFVQKFKMKKIPLHVLVNNAGVMMVPQR---ETEDGFEEHFGVNYXXXX 514
            C +   +   + V         + +LV+NA V          TE+ +++   VN     
Sbjct: 69  VCHVGKAEDRERLVAMAVNLHGGVDILVSNAAVNPFFGNIIDATEEVWDKILHVNVKATV 128

Query: 515 XXXXXXXXXXQASGSPGRSARVVTVSSATHYVGELDLDDLQSSGGYSPHGAYARSKLALV 694
                     +  G  G S  +V+   A H    L              G Y  SK AL+
Sbjct: 129 LMTKAVVPEMEKRG--GGSVLIVSSVGAYHPFPNL--------------GPYNVSKTALL 172

Query: 695 LFSHRLQALLAAKGSPVTANVADPGVVNTDLYRHVFWGTRLLKK 826
             +  L   LA +   +  N   PG++ T+ +  V W  +  K+
Sbjct: 173 GLTKNLAVELAPRN--IRVNCLAPGLIKTN-FSQVLWMDKARKE 213


  Database: RefSeqSP
    Posted date:  Aug 1, 2006  7:14 PM
  Number of letters in database: 434,620
  Number of sequences in database:  1040
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,066,577
Number of Sequences: 1040
Number of extensions: 27120
Number of successful extensions: 162
Number of sequences better than 1.0e-05: 2
Number of HSP's better than  0.0 without gapping: 106
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 159
length of database: 434,620
effective HSP length: 80
effective length of database: 351,420
effective search space used: 128971140
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqHP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= LVRM1_0187_E10
         (1343 letters)

Database: RefSeqHP 
           39,411 sequences; 17,774,539 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_660160.1| dehydrogenase/reductase (SDR family) X-linked [...   497   e-140
Alignment   gi|NP_065956.1| retinol dehydrogenase 14 (all-trans and 9-cis) ...   181   2e-45
Alignment   gi|NP_689656.1| retinol dehydrogenase 12 (all-trans and 9-cis) ...   174   2e-43
Alignment   gi|NP_057110.2| androgen-regulated short-chain dehydrogenase/re...   162   8e-40
Alignment   gi|NP_057457.1| WW domain-containing oxidoreductase isoform 1 [...   151   1e-36
Alignment   gi|NP_612421.1| retinol dehydrogenase 13 (all-trans and 9-cis) ...   149   7e-36
Alignment   gi|NP_653284.1| hypothetical protein LOC147015 [Homo sapiens]        114   2e-25
Alignment   gi|XP_371503.3| PREDICTED: similar to short-chain dehydrogenase...    72   1e-12
Alignment   gi|XP_947127.1| PREDICTED: similar to short-chain dehydrogenase...    72   1e-12
Alignment   gi|NP_005785.1| dehydrogenase/reductase (SDR family) member 2 i...    63   7e-10

>ref|NP_660160.1| dehydrogenase/reductase (SDR family) X-linked [Homo sapiens]
          Length = 330

 Score =  497 bits (1279), Expect = e-140
 Identities = 241/309 (77%), Positives = 269/309 (87%)
 Frame = +2

Query: 107  ILAQLLRRCRGGFAEPVFPPQPGRVAIVTGGTEGIGFATAKHLARLGMHVIIAGNNDSKA 286
            ILAQLLRRCRGGF EPVFPP+P RVAIVTGGT+GIG++TAKHLARLGMHVIIAGNNDSKA
Sbjct: 21   ILAQLLRRCRGGFLEPVFPPRPDRVAIVTGGTDGIGYSTAKHLARLGMHVIIAGNNDSKA 80

Query: 287  REAVRKIREETLNDKVEFLYCDLASMKSIRQFVQKFKMKKIPLHVLVNNAGVMMVPQRET 466
            ++ V KI+EETLNDKVEFLYCDLASM SIRQFVQKFKMKKIPLHVL+NNAGVMMVPQR+T
Sbjct: 81   KQVVSKIKEETLNDKVEFLYCDLASMTSIRQFVQKFKMKKIPLHVLINNAGVMMVPQRKT 140

Query: 467  EDGFEEHFGVNYXXXXXXXXXXXXXXQASGSPGRSARVVTVSSATHYVGELDLDDLQSSG 646
             DGFEEHFG+NY              + SGSPG SARVVTVSSATHYV EL++DDLQSS 
Sbjct: 141  RDGFEEHFGLNYLGHFLLTNLLLDTLKESGSPGHSARVVTVSSATHYVAELNMDDLQSSA 200

Query: 647  GYSPHGAYARSKLALVLFSHRLQALLAAKGSPVTANVADPGVVNTDLYRHVFWGTRLLKK 826
             YSPH AYA+SKLALVLF++ LQ LLAA+GS VTANV DPGVVNTDLY+HVFW TRL KK
Sbjct: 201  CYSPHAAYAQSKLALVLFTYHLQRLLAAEGSHVTANVVDPGVVNTDLYKHVFWATRLAKK 260

Query: 827  LFGWWFFKTPDEGAWTSVYAAVSPALEGVGGRYLYNEKEAKSLAITYDPKLQRQLWARSC 1006
            L GW  FKTPDEGAWTS+YAAV+P LEGVGGRYLYNEKE KSL +TY+ KLQ+QLW++SC
Sbjct: 261  LLGWLLFKTPDEGAWTSIYAAVTPELEGVGGRYLYNEKETKSLHVTYNQKLQQQLWSKSC 320

Query: 1007 QMTGIADMT 1033
            +MTG+ D+T
Sbjct: 321  EMTGVLDVT 329


>ref|NP_065956.1| retinol dehydrogenase 14 (all-trans and 9-cis) [Homo sapiens]
          Length = 336

 Score =  181 bits (458), Expect = 2e-45
 Identities = 114/299 (38%), Positives = 161/299 (53%), Gaps = 16/299 (5%)
 Frame = +2

Query: 173  GRVAIVTGGTEGIGFATAKHLARLGMHVIIAGNNDSKAREAVRKIREETLN--------- 325
            G+  ++TG   G+G ATA  L RLG  VI+   + ++A EA  ++R E            
Sbjct: 43   GKTVLITGANSGLGRATAAELLRLGARVIMGCRDRARAEEAAGQLRRELRQAAECGPEPG 102

Query: 326  ----DKVEFLYCDLASMKSIRQFVQKFKMKKIPLHVLVNNAGVMMVPQRETEDGFEEHFG 493
                 ++     DLAS++S+R F Q+   ++  L VL+NNAG+   P  +TEDGFE  FG
Sbjct: 103  VSGVGELIVRELDLASLRSVRAFCQEMLQEEPRLDVLINNAGIFQCPYMKTEDGFEMQFG 162

Query: 494  VNYXXXXXXXXXXXXXXQASGSPGRSARVVTVSSATHYVGELDLDDLQSSGGYSPHGAYA 673
            VN+              ++S      +R+V VSS  +  G+++ DDL S   Y+    Y+
Sbjct: 163  VNHLGHFLLTNLLLGLLKSSAP----SRIVVVSSKLYKYGDINFDDLNSEQSYNKSFCYS 218

Query: 674  RSKLALVLFSHRLQALLAAKGSPVTANVADPGVVNTDLYRHVFWGTRLLKKLFG---WWF 844
            RSKLA +LF+  L   L  +G+ VT NV  PG+V T+L RH+     L+K LF    W F
Sbjct: 219  RSKLANILFTRELARRL--EGTNVTVNVLHPGIVRTNLGRHIHIPL-LVKPLFNLVSWAF 275

Query: 845  FKTPDEGAWTSVYAAVSPALEGVGGRYLYNEKEAKSLAITYDPKLQRQLWARSCQMTGI 1021
            FKTP EGA TS+Y A SP +EGV GRY  + KE + L    D  + R+LW  S  M G+
Sbjct: 276  FKTPVEGAQTSIYLASSPEVEGVSGRYFGDCKEEELLPKAMDESVARKLWDISEVMVGL 334


>ref|NP_689656.1| retinol dehydrogenase 12 (all-trans and 9-cis) [Homo sapiens]
          Length = 316

 Score =  174 bits (441), Expect = 2e-43
 Identities = 113/284 (39%), Positives = 151/284 (53%)
 Frame = +2

Query: 170  PGRVAIVTGGTEGIGFATAKHLARLGMHVIIAGNNDSKAREAVRKIREETLNDKVEFLYC 349
            PG+V ++TG   GIG  TA+ LA  G  V IA  +  K   A  +IR +T N +V     
Sbjct: 38   PGKVVVITGANTGIGKETARELASRGARVYIACRDVLKGESAASEIRVDTKNSQVLVRKL 97

Query: 350  DLASMKSIRQFVQKFKMKKIPLHVLVNNAGVMMVPQRETEDGFEEHFGVNYXXXXXXXXX 529
            DL+  KSIR F + F  ++  LH+L+NNAGVMM P  +T DGFE H GVN+         
Sbjct: 98   DLSDTKSIRAFAEGFLAEEKQLHILINNAGVMMCPYSKTADGFETHLGVNHLGHFLLTYL 157

Query: 530  XXXXXQASGSPGRSARVVTVSSATHYVGELDLDDLQSSGGYSPHGAYARSKLALVLFSHR 709
                 + S      ARVV VSS  H++G++   DLQS   YS   AY  SKLA VLF+  
Sbjct: 158  LLEQLKVSA----PARVVNVSSVAHHIGKIPFHDLQSEKRYSRGFAYCHSKLANVLFTRE 213

Query: 710  LQALLAAKGSPVTANVADPGVVNTDLYRHVFWGTRLLKKLFGWWFFKTPDEGAWTSVYAA 889
            L   L  +G+ VT     PGVV ++L RH      LL +LF   F KT  EGA TS++ A
Sbjct: 214  LAKRL--QGTGVTTYAVHPGVVRSELVRHSSL-LCLLWRLFS-PFVKTAREGAQTSLHCA 269

Query: 890  VSPALEGVGGRYLYNEKEAKSLAITYDPKLQRQLWARSCQMTGI 1021
            ++  LE + G+Y  + K         + K   +LW  SC++ GI
Sbjct: 270  LAEGLEPLSGKYFSDCKRTWVSPRARNNKTAERLWNVSCELLGI 313


>ref|NP_057110.2| androgen-regulated short-chain dehydrogenase/reductase 1 [Homo
            sapiens]
          Length = 318

 Score =  162 bits (409), Expect = 8e-40
 Identities = 105/284 (36%), Positives = 149/284 (52%)
 Frame = +2

Query: 170  PGRVAIVTGGTEGIGFATAKHLARLGMHVIIAGNNDSKAREAVRKIREETLNDKVEFLYC 349
            PG+V +VTG   GIG  TAK LA+ G  V +A  +  K     ++I+  T N +V     
Sbjct: 40   PGKVVVVTGANTGIGKETAKELAQRGARVYLACRDVEKGELVAKEIQTTTGNQQVLVRKL 99

Query: 350  DLASMKSIRQFVQKFKMKKIPLHVLVNNAGVMMVPQRETEDGFEEHFGVNYXXXXXXXXX 529
            DL+  KSIR F + F  ++  LHVL+NNAGVMM P  +T DGFE H GVN+         
Sbjct: 100  DLSDTKSIRAFAKGFLAEEKHLHVLINNAGVMMCPYSKTADGFEMHIGVNHLGHFLLTHL 159

Query: 530  XXXXXQASGSPGRSARVVTVSSATHYVGELDLDDLQSSGGYSPHGAYARSKLALVLFSHR 709
                 + S      +R+V VSS  H++G +   +LQ    Y+   AY  SKLA +LF+  
Sbjct: 160  LLEKLKESA----PSRIVNVSSLAHHLGRIHFHNLQGEKFYNAGLAYCHSKLANILFTQE 215

Query: 710  LQALLAAKGSPVTANVADPGVVNTDLYRHVFWGTRLLKKLFGWWFFKTPDEGAWTSVYAA 889
            L   L  KGS VT     PG V ++L RH  +  R +  LF  +F KTP +GA TS++ A
Sbjct: 216  LARRL--KGSGVTTYSVHPGTVQSELVRHSSF-MRWMWWLFS-FFIKTPQQGAQTSLHCA 271

Query: 890  VSPALEGVGGRYLYNEKEAKSLAITYDPKLQRQLWARSCQMTGI 1021
            ++  LE + G +  +   A       +  + R+LW  SC + G+
Sbjct: 272  LTEGLEILSGNHFSDCHVAWVSVQARNETIARRLWDVSCDLLGL 315


>ref|NP_057457.1| WW domain-containing oxidoreductase isoform 1 [Homo sapiens]
          Length = 414

 Score =  151 bits (381), Expect = 1e-36
 Identities = 108/285 (37%), Positives = 141/285 (49%), Gaps = 8/285 (2%)
 Frame = +2

Query: 173  GRVAIVTGGTEGIGFATAKHLARLGMHVIIAGNNDSKAREAVRKIREETLNDKVEFLYCD 352
            G+V +VTG   GIGF TAK  A  G HVI+A  N ++A EAV +I EE    KVE +  D
Sbjct: 124  GKVVVVTGANSGIGFETAKSFALHGAHVILACRNMARASEAVSRILEEWHKAKVEAMTLD 183

Query: 353  LASMKSIRQFVQKFKMKKIPLHVLVNNAGVMMVPQRETEDGFEEHFGVNYXXXXXXXXXX 532
            LA ++S++ F + FK K +PLHVLV NA    +P   T+DG E  F VN+          
Sbjct: 184  LALLRSVQHFAEAFKAKNVPLHVLVCNAATFALPWSLTKDGLETTFQVNHLGHFYLVQLL 243

Query: 533  XXXXQASGSPGRSARVVTVSSATH-------YVGELDLDDLQ-SSGGYSPHGAYARSKLA 688
                  S      ARV+ VSS +H        +G+LD   L  +   Y    AY RSKL 
Sbjct: 244  QDVLCRSA----PARVIVVSSESHRFTDINDSLGKLDFSRLSPTKNDYWAMLAYNRSKLC 299

Query: 689  LVLFSHRLQALLAAKGSPVTANVADPGVVNTDLYRHVFWGTRLLKKLFGWWFFKTPDEGA 868
             +LFS+ L   L+ +G  VT+N   PG +        +W   LL  L    F K+  +GA
Sbjct: 300  NILFSNELHRRLSPRG--VTSNAVHPGNMMYSNIHRSWWVYTLLFTL-ARPFTKSMQQGA 356

Query: 869  WTSVYAAVSPALEGVGGRYLYNEKEAKSLAITYDPKLQRQLWARS 1003
             T+VY A  P LEG+GG Y  N             +  R LWA S
Sbjct: 357  ATTVYCAAVPELEGLGGMYFNNCCRCMPSPEAQSEETARTLWALS 401


>ref|NP_612421.1| retinol dehydrogenase 13 (all-trans and 9-cis) [Homo sapiens]
          Length = 260

 Score =  149 bits (375), Expect = 7e-36
 Identities = 94/252 (37%), Positives = 129/252 (51%), Gaps = 5/252 (1%)
 Frame = +2

Query: 281  KAREAVRKIREETLNDKVEFLYCDLASMKSIRQFVQKFKMKKIPLHVLVNNAGVMMVPQR 460
            K   A + IR ETLN  V   + DLAS+KSIR+F  K   ++  + +L+NNAGVM  P  
Sbjct: 3    KCEAAAKDIRGETLNHHVNARHLDLASLKSIREFAAKIIEEEERVDILINNAGVMRCPHW 62

Query: 461  ETEDGFEEHFGVNYXXXXXXXXXXXXXXQASGSPGRSARVVTVSSATHYVGELDLDDLQ- 637
             TEDGFE  FGVN+              +AS      +R++ +SS  H  G +D DDL  
Sbjct: 63   TTEDGFEMQFGVNHLGHFLLTNLLLDKLKASA----PSRIINLSSLAHVAGHIDFDDLNW 118

Query: 638  SSGGYSPHGAYARSKLALVLFSHRLQALLAAKGSPVTANVADPGVVNTDLYRHV-FWGTR 814
             +  Y+   AY +SKLA+VLF+  L   L  +GS VT N   PGV  T+L RH    G+ 
Sbjct: 119  QTRKYNTKAAYCQSKLAIVLFTKELSRRL--QGSGVTVNALHPGVARTELGRHTGIHGST 176

Query: 815  LLKKLFG---WWFFKTPDEGAWTSVYAAVSPALEGVGGRYLYNEKEAKSLAITYDPKLQR 985
                  G   W   K+P+  A  S Y AV+  L  V G+Y    K+        D ++ R
Sbjct: 177  FSSTTLGPIFWLLVKSPELAAQPSTYLAVAEELADVSGKYFDGLKQKAPAPEAEDEEVAR 236

Query: 986  QLWARSCQMTGI 1021
            +LWA S ++ G+
Sbjct: 237  RLWAESARLVGL 248


>ref|NP_653284.1| hypothetical protein LOC147015 [Homo sapiens]
          Length = 327

 Score =  114 bits (285), Expect = 2e-25
 Identities = 96/311 (30%), Positives = 140/311 (45%), Gaps = 4/311 (1%)
 Frame = +2

Query: 221  TAKHLARLGMHVIIAGNNDSKAREAVRKIREETLNDKVEFLYCDLASMKSIRQFVQKFKM 400
            TA  LAR G  V++A  +  +   A   +R+E+ N++V F+  DLAS+ S+R F   F  
Sbjct: 2    TALELARRGARVVLACRSQERGEAAAFDLRQESGNNEVIFMALDLASLASVRAFATAFLS 61

Query: 401  KKIPLHVLVNNAGVMMVPQRETEDGFEEHFGVNYXXXXXXXXXXXXXXQASGSPGRSARV 580
             +  L +L++NAG+    +  T + F     VN+              +A       +RV
Sbjct: 62   SEPRLDILIHNAGISSCGR--TREAFNLLLRVNHIGPFLLTHLLLPCLKACA----PSRV 115

Query: 581  VTVSSATHYVGELDLDDLQSS--GGYSPHGAYARSKLALVLFSHRLQALLAAKGSPVTAN 754
            V V+SA H  G LD   L     G      AYA +KLA VLF+  L   L A G  VT  
Sbjct: 116  VVVASAAHCRGRLDFKRLDRPVVGWRQELRAYADTKLANVLFARELANQLEATG--VTCY 173

Query: 755  VADPGVVNTDLY-RHVFWGTRLLKKLFGWWFFKTPDEGAWTSVYAAVSPALEGVGGRYLY 931
             A PG VN++L+ RHV    R L +   W   + P  GA T +Y A+   +E + GRY  
Sbjct: 174  AAHPGPVNSELFLRHVPGWLRPLLRPLAWLVLRAPRGGAQTPLYCALQEGIEPLSGRYFA 233

Query: 932  NEKEAKSLAITYDPKLQRQLWARSCQMTGIADMTRDTLWG*RPRREDRVGPALAGASALD 1111
            N    +      D +   +LW  S ++ G+     D      P+ ED   P+       +
Sbjct: 234  NCHVEEVPPAARDDRAAHRLWEASKRLAGLGP-GEDAEPDEDPQSEDSEAPSSLSTPHPE 292

Query: 1112 RASASFP-PRP 1141
              + S P P P
Sbjct: 293  EPTVSQPYPSP 303


>ref|XP_371503.3| PREDICTED: similar to short-chain dehydrogenase/reductase 1 [Homo
           sapiens]
          Length = 891

 Score = 71.6 bits (174), Expect = 1e-12
 Identities = 40/111 (36%), Positives = 65/111 (58%), Gaps = 1/111 (0%)
 Frame = +2

Query: 173 GRVAIVTGGTEGIGFATAKHLARLGMHVIIAGNNDSKAREAVRKIREETLNDKVEFLYCD 352
           G++AIVTG   GIG   ++ LAR G  VI+   +    ++A+ +I+  + ++++     D
Sbjct: 602 GKIAIVTGANSGIGKVVSQDLARCGAQVILTCQSRECGQQALAEIQAASNSNRLLLGEVD 661

Query: 353 LASMKSIRQFVQKFKMKKIPLHVLVNNAGVM-MVPQRETEDGFEEHFGVNY 502
           L+SM SIR F ++   +   +H+LVNNAGV  M+P+  T  G +  F  NY
Sbjct: 662 LSSMTSIRSFARRLLQENPEIHLLVNNAGVSGMIPKTLTPGGLDLTFVTNY 712


>ref|XP_947127.1| PREDICTED: similar to short-chain dehydrogenase/reductase 1 [Homo
           sapiens]
          Length = 916

 Score = 71.6 bits (174), Expect = 1e-12
 Identities = 40/111 (36%), Positives = 65/111 (58%), Gaps = 1/111 (0%)
 Frame = +2

Query: 173 GRVAIVTGGTEGIGFATAKHLARLGMHVIIAGNNDSKAREAVRKIREETLNDKVEFLYCD 352
           G++AIVTG   GIG   ++ LAR G  VI+   +    ++A+ +I+  + ++++     D
Sbjct: 627 GKIAIVTGANSGIGKVVSQDLARCGAQVILTCQSRECGQQALAEIQAASNSNRLLLGEVD 686

Query: 353 LASMKSIRQFVQKFKMKKIPLHVLVNNAGVM-MVPQRETEDGFEEHFGVNY 502
           L+SM SIR F ++   +   +H+LVNNAGV  M+P+  T  G +  F  NY
Sbjct: 687 LSSMTSIRSFARRLLQENPEIHLLVNNAGVSGMIPKTLTPGGLDLTFVTNY 737


>ref|NP_005785.1| dehydrogenase/reductase (SDR family) member 2 isoform 2 [Homo
           sapiens]
          Length = 280

 Score = 62.8 bits (151), Expect = 7e-10
 Identities = 65/219 (29%), Positives = 87/219 (39%)
 Frame = +2

Query: 176 RVAIVTGGTEGIGFATAKHLARLGMHVIIAGNNDSKAREAVRKIREETLNDKVEFLYCDL 355
           RVA+VTG T GIGFA A+ LAR G HV+I+         A+ K++ E L+  V  + C +
Sbjct: 37  RVAVVTGSTSGIGFAIARRLARDGAHVVISSRKQQNVDRAMAKLQGEGLS--VAGIVCHV 94

Query: 356 ASMKSIRQFVQKFKMKKIPLHVLVNNAGVMMVPQRETEDGFEEHFGVNYXXXXXXXXXXX 535
              +   Q V K       +  LV +AGV   P   +  G  E                 
Sbjct: 95  GKAEDREQLVAKALEHCGGVDFLVCSAGVN--PLVGSTLGTSEQIWDKILSVNVKSPALL 152

Query: 536 XXXQASGSPGRSARVVTVSSATHYVGELDLDDLQSSGGYSPHGAYARSKLALVLFSHRLQ 715
                     R   V+ VSS   Y   + L            G Y  SK AL+  +  L 
Sbjct: 153 LSQLLPYMENRRGAVILVSSIAAYNPVVAL------------GVYNVSKTALLGLTRTLA 200

Query: 716 ALLAAKGSPVTANVADPGVVNTDLYRHVFWGTRLLKKLF 832
             LA K   +  N   PG++ TD +  VF G   L K F
Sbjct: 201 LELAPK--DIRVNCVVPGIIKTD-FSKVFHGNESLWKNF 236


  Database: RefSeqHP
    Posted date:  Aug 2, 2006 12:57 AM
  Number of letters in database: 17,774,539
  Number of sequences in database:  39,411
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 47,109,237
Number of Sequences: 39411
Number of extensions: 1320266
Number of successful extensions: 9178
Number of sequences better than 1.0e-05: 10
Number of HSP's better than  0.0 without gapping: 6007
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 9033
length of database: 17,774,539
effective HSP length: 105
effective length of database: 13,636,384
effective search space used: 4663643328
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqMP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= LVRM1_0187_E10
         (1343 letters)

Database: RefSeqMP 
           45,328 sequences; 21,768,885 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_001028498.1| dehydrogenase/reductase (SDR family) X chrom...   345   5e-95
Alignment   gi|NP_076186.1| alcohol dehydrogenase PAN2 [Mus musculus]            184   2e-46
Alignment   gi|NP_780581.1| retinol dehydrogenase 13 (all-trans and 9-cis) ...   178   1e-44
Alignment   gi|NP_084293.1| retinol dehydrogenase 12 [Mus musculus]              172   7e-43
Alignment   gi|NP_067532.2| short-chain dehydrogenase/reductase 1 [Mus musc...   165   9e-41
Alignment   gi|NP_062519.2| WW-domain oxidoreductase [Mus musculus]              151   2e-36
Alignment   gi|NP_899109.1| hypothetical protein LOC70451 [Mus musculus]         100   5e-21
Alignment   gi|NP_082066.1| dehydrogenase/reductase member 2 [Mus musculus]       60   7e-09
Alignment   gi|XP_487442.1| PREDICTED: similar to Carbonyl reductase [NADPH...    58   2e-08
Alignment   gi|XP_989090.1| PREDICTED: similar to Carbonyl reductase [NADPH...    58   2e-08

>ref|NP_001028498.1| dehydrogenase/reductase (SDR family) X chromosome [Mus musculus]
          Length = 335

 Score =  345 bits (886), Expect = 5e-95
 Identities = 172/303 (56%), Positives = 216/303 (71%)
 Frame = +2

Query: 110  LAQLLRRCRGGFAEPVFPPQPGRVAIVTGGTEGIGFATAKHLARLGMHVIIAGNNDSKAR 289
            LAQLLRR RG F  PV PPQPGRVAIVTG T GIG +TA+ LARLGM V++AGN++ + +
Sbjct: 22   LAQLLRRLRGDFRPPVLPPQPGRVAIVTGATAGIGRSTARQLARLGMCVVVAGNDEHRGQ 81

Query: 290  EAVRKIREETLNDKVEFLYCDLASMKSIRQFVQKFKMKKIPLHVLVNNAGVMMVPQRETE 469
            E V  IR E  +D+  FL  DLAS+ S+R F + F+   +PLH+LVNNAGVM+ P+ ETE
Sbjct: 82   EVVSSIRAEMGSDRAHFLPLDLASLASVRGFARDFQALGLPLHLLVNNAGVMLEPRAETE 141

Query: 470  DGFEEHFGVNYXXXXXXXXXXXXXXQASGSPGRSARVVTVSSATHYVGELDLDDLQSSGG 649
            DGFE H GVN+              +ASG+ GR +RVVTV SATHYVG +D+ DL     
Sbjct: 142  DGFERHLGVNFLGHFLLTLLLLPALRASGAEGRGSRVVTVGSATHYVGTVDMADLHGRHA 201

Query: 650  YSPHGAYARSKLALVLFSHRLQALLAAKGSPVTANVADPGVVNTDLYRHVFWGTRLLKKL 829
            YSP+ AYA+SKLAL LF+ +LQ +L A+G PVT+N+ADPGVV+T+LYRH  W  R  K+ 
Sbjct: 202  YSPYAAYAQSKLALALFALQLQRILDARGDPVTSNMADPGVVDTELYRHAGWVLRTAKRF 261

Query: 830  FGWWFFKTPDEGAWTSVYAAVSPALEGVGGRYLYNEKEAKSLAITYDPKLQRQLWARSCQ 1009
             GW  FK+P+EGAWT VYAA +P LEGVGGRYL +E EA+ L    D +LQR+LWA   +
Sbjct: 262  LGWLVFKSPEEGAWTLVYAAAAPELEGVGGRYLRDEAEAEPLGTARDQELQRRLWAEGLR 321

Query: 1010 MTG 1018
            +TG
Sbjct: 322  LTG 324


>ref|NP_076186.1| alcohol dehydrogenase PAN2 [Mus musculus]
          Length = 334

 Score =  184 bits (466), Expect = 2e-46
 Identities = 115/295 (38%), Positives = 161/295 (54%), Gaps = 12/295 (4%)
 Frame = +2

Query: 173  GRVAIVTGGTEGIGFATAKHLARLGMHVIIAGNNDSKAREAVRKIREETL---------- 322
            G+  ++TG   G+G ATA  L RLG  VI+   + ++A EA  ++R+E            
Sbjct: 44   GKTVLITGANSGLGRATAAELLRLGARVIMGCRDRARAEEAAGQLRQELCQAGGAGPDGT 103

Query: 323  NDKVEFLYCDLASMKSIRQFVQKFKMKKIPLHVLVNNAGVMMVPQRETEDGFEEHFGVNY 502
            + ++     DLAS++S+R F Q+   ++  L VL+NNAGV   P  +TEDGFE  FGVN+
Sbjct: 104  DGQLVVKELDLASLRSVRAFCQELLQEEPRLDVLINNAGVFHCPYTKTEDGFEMQFGVNH 163

Query: 503  XXXXXXXXXXXXXXQASGSPGRSARVVTVSSATHYVGELDLDDLQSSGGYSPHGAYARSK 682
                          ++S      +R+V VSS  +  GE++ +DL S   Y+    Y+RSK
Sbjct: 164  LGHFLLTNLLLGLLKSSAP----SRIVVVSSKLYKYGEINFEDLNSEQSYNKSFCYSRSK 219

Query: 683  LALVLFSHRLQALLAAKGSPVTANVADPGVVNTDLYRHVFWG--TRLLKKLFGWWFFKTP 856
            LA +LF+  L   L  +G+ VT NV  PG+V T+L RH+      R L  L  W FFKTP
Sbjct: 220  LANILFTRELARRL--EGTNVTVNVLHPGIVRTNLGRHIHIPLLARPLFNLVSWAFFKTP 277

Query: 857  DEGAWTSVYAAVSPALEGVGGRYLYNEKEAKSLAITYDPKLQRQLWARSCQMTGI 1021
             EGA TS+Y A SP +EGV GRY  + KE + L    D  + R+LW  S  M GI
Sbjct: 278  LEGAQTSIYLACSPDVEGVSGRYFGDCKEEELLPKAMDESVARKLWDISEVMVGI 332


>ref|NP_780581.1| retinol dehydrogenase 13 (all-trans and 9-cis) [Mus musculus]
          Length = 334

 Score =  178 bits (452), Expect = 1e-44
 Identities = 123/313 (39%), Positives = 158/313 (50%), Gaps = 11/313 (3%)
 Frame = +2

Query: 119  LLRRCRGGFAEPVFPPQPGRVAIVTGGTEGIGFATAKHLARLGMHVIIAGNNDSKAREAV 298
            LL+    G A P     PG+  IVTG   GIG  TA  LA+ G +VI+A  +  K   A 
Sbjct: 20   LLKDYVAGGACPSKATIPGKTVIVTGANTGIGKQTALELAKRGGNVILACRDMEKCEVAA 79

Query: 299  RKIREETLNDKVEFLYCDLASMKSIRQFVQKFKMKKIPLHVLVNNAGVMMVPQRETEDGF 478
            + IR ETLN +V     DLAS+KSIR+F +K   ++  + +LVNNA VM  P   TEDGF
Sbjct: 80   KDIRGETLNPRVRAERLDLASLKSIREFARKVIKEEERVDILVNNAAVMRCPHWTTEDGF 139

Query: 479  EEHFGVNYXXXXXXXXXXXXXXQASGSPGRSARVVTVSSATHYVGELDLDDLQ-SSGGYS 655
            E  FGVNY              +AS      +R++ +SS  H  G +D +DL      Y 
Sbjct: 140  EMQFGVNYLGHFLLTNLLLDKLKASA----PSRIINLSSLAHVAGHIDFEDLNWQMKKYD 195

Query: 656  PHGAYARSKLALVLF----SHRLQALLAAKGSPVTANVADPGVVNTDLYRH------VFW 805
               AY +SKLA+VLF    SHRLQ      GS VT N   PGV  T+L RH       F 
Sbjct: 196  TKAAYCQSKLAVVLFTKELSHRLQ------GSGVTVNALHPGVARTELGRHTGMHNSAFS 249

Query: 806  GTRLLKKLFGWWFFKTPDEGAWTSVYAAVSPALEGVGGRYLYNEKEAKSLAITYDPKLQR 985
            G  L    F W  FK+P   A  S Y AV+  LE V G+Y    +E        D ++ R
Sbjct: 250  GFML--GPFFWLLFKSPQLAAQPSTYLAVAEELENVSGKYFDGLREKAPSPEAEDEEVAR 307

Query: 986  QLWARSCQMTGIA 1024
            +LW  S ++ G+A
Sbjct: 308  RLWTESARLVGLA 320


>ref|NP_084293.1| retinol dehydrogenase 12 [Mus musculus]
          Length = 316

 Score =  172 bits (436), Expect = 7e-43
 Identities = 109/284 (38%), Positives = 155/284 (54%)
 Frame = +2

Query: 170  PGRVAIVTGGTEGIGFATAKHLARLGMHVIIAGNNDSKAREAVRKIREETLNDKVEFLYC 349
            PG+V ++TG   GIG  TA+ LAR G  V IA  +  K   A  +IR +T N +V     
Sbjct: 38   PGKVVVITGANTGIGKETARELARRGARVYIACRDVLKGESAASEIRADTKNSQVLVRKL 97

Query: 350  DLASMKSIRQFVQKFKMKKIPLHVLVNNAGVMMVPQRETEDGFEEHFGVNYXXXXXXXXX 529
            DL+  KSIR F ++F  ++  LH+L+NNAGVMM P  +T DGFE HFGVN+         
Sbjct: 98   DLSDTKSIRAFAERFLAEEKKLHILINNAGVMMCPYSKTTDGFETHFGVNHLGHFLLTYL 157

Query: 530  XXXXXQASGSPGRSARVVTVSSATHYVGELDLDDLQSSGGYSPHGAYARSKLALVLFSHR 709
                 + S      ARVV +SS  H +G++   DLQ    Y    AY  SKLA +LF+  
Sbjct: 158  LLERLKESA----PARVVNLSSIAHLIGKIRFHDLQGQKRYCSAFAYGHSKLANLLFTRE 213

Query: 710  LQALLAAKGSPVTANVADPGVVNTDLYRHVFWGTRLLKKLFGWWFFKTPDEGAWTSVYAA 889
            L   L  +G+ VTA    PGVV +++ R+ +    LL +LF   FFK+  +GA TS++ A
Sbjct: 214  LAKRL--QGTGVTAYAVHPGVVLSEITRNSYL-LCLLWRLFS-PFFKSTSQGAQTSLHCA 269

Query: 890  VSPALEGVGGRYLYNEKEAKSLAITYDPKLQRQLWARSCQMTGI 1021
            ++  LE + G+Y  + K     +   + K   +LW  SC++ GI
Sbjct: 270  LAEDLEPLSGKYFSDCKRMWVSSRARNKKTAERLWNVSCELLGI 313


>ref|NP_067532.2| short-chain dehydrogenase/reductase 1 [Mus musculus]
          Length = 316

 Score =  165 bits (418), Expect = 9e-41
 Identities = 111/287 (38%), Positives = 155/287 (54%), Gaps = 3/287 (1%)
 Frame = +2

Query: 170  PGRVAIVTGGTEGIGFATAKHLARLGMHVIIAGNNDSKAREAVRKIREETLNDKVEFLYC 349
            PG+VAIVTG   GIG  TAK LA+ G  V +A  +  K   A R+I+  T N +V     
Sbjct: 37   PGKVAIVTGANTGIGKETAKDLAQRGARVYLACRDVDKGELAAREIQAVTGNSQVFVRKL 96

Query: 350  DLASMKSIRQFVQKFKMKKIPLHVLVNNAGVMMVPQRETEDGFEEHFGVNYXXXXXXXXX 529
            DLA  KSIR F + F  ++  LH+L+NNAGVMM P  +T DGFE H GVN+         
Sbjct: 97   DLADTKSIRAFAKDFLAEEKHLHLLINNAGVMMCPYSKTADGFEMHIGVNHLGHFLLTHL 156

Query: 530  XXXXXQASGSPGRSARVVTVSSATHYVGELDLDDLQSSGGYSPHGAYARSKLALVLFSHR 709
                 + S      +R+V +SS  H++G +   +LQ    YS   AY  SKLA +LF+  
Sbjct: 157  LLEKLKESA----PSRIVNLSSLGHHLGRIHFHNLQGEKFYSAGLAYCHSKLANILFTKE 212

Query: 710  LQALLAAKGSPVTANVADPGVVNTDLYRHVFWGTRLLKKLFGWWFFKTPDEGAWTSVYAA 889
            L   L  KGS VT     PG V+++L R+     R L +LF + F KTP EGA TS+Y A
Sbjct: 213  LAKRL--KGSGVTTYSVHPGTVHSELTRYSSI-MRWLWQLF-FVFIKTPQEGAQTSLYCA 268

Query: 890  VSPALEGVGGRYLYNEKEAKSLAITYDPK---LQRQLWARSCQMTGI 1021
            ++  LE + G +     + +   ++Y  +   + R+LW  SC + G+
Sbjct: 269  LTEGLESLSGSHF---SDCQLAWVSYQGRNEIIARRLWDVSCDLLGL 312


>ref|NP_062519.2| WW-domain oxidoreductase [Mus musculus]
          Length = 414

 Score =  151 bits (381), Expect = 2e-36
 Identities = 112/285 (39%), Positives = 143/285 (50%), Gaps = 8/285 (2%)
 Frame = +2

Query: 173  GRVAIVTGGTEGIGFATAKHLARLGMHVIIAGNNDSKAREAVRKIREETLNDKVEFLYCD 352
            G+V +VTG   GIGF TAK  A  G HVI+A  N S+A EAV +I EE    KVE +  D
Sbjct: 124  GKVVLVTGANSGIGFETAKSFALHGAHVILACRNLSRASEAVSRILEEWHKAKVEAMTLD 183

Query: 353  LASMKSIRQFVQKFKMKKIPLHVLVNNAGVMMVPQRETEDGFEEHFGVNYXXXXXXXXXX 532
            LA ++S++ F + FK K + LHVLV NAG   +P   T+DG E  F VN+          
Sbjct: 184  LAVLRSVQHFAEAFKAKNVSLHVLVCNAGTFALPWGLTKDGLETTFQVNHLGHFYLVQLL 243

Query: 533  XXXXQASGSPGRSARVVTVSSATHYV-------GELDLDDLQ-SSGGYSPHGAYARSKLA 688
                  S SP   ARV+ VSS +H         G+LDL  L      Y    AY RSKL 
Sbjct: 244  QDVLCRS-SP---ARVIVVSSESHRFTDINDSSGKLDLSRLSPPRSDYWAMLAYNRSKLC 299

Query: 689  LVLFSHRLQALLAAKGSPVTANVADPGVVNTDLYRHVFWGTRLLKKLFGWWFFKTPDEGA 868
             +LFS+ L   L+ +G  VT+N   PG +         W  +LL  L    F K+  +GA
Sbjct: 300  NILFSNELHRRLSPRG--VTSNAVHPGNMMYSAIHRNSWVYKLLFTL-ARPFTKSMQQGA 356

Query: 869  WTSVYAAVSPALEGVGGRYLYNEKEAKSLAITYDPKLQRQLWARS 1003
             T+VY AV+P LEG+GG Y  N             +  R LW  S
Sbjct: 357  ATTVYCAVAPELEGLGGMYFNNCCRCLPSEEAQSEETARALWELS 401


>ref|NP_899109.1| hypothetical protein LOC70451 [Mus musculus]
          Length = 260

 Score =  100 bits (248), Expect = 5e-21
 Identities = 77/225 (34%), Positives = 110/225 (48%), Gaps = 3/225 (1%)
 Frame = +2

Query: 173 GRVAIVTGGTEGIGFATAKHLARLGMHVIIAGNNDSKAREAVRKIREETLNDKVEFLYCD 352
           GR  +VTG   GIG  TA  LAR G  V++A  +  +   A   +R+E+ N++V F+  D
Sbjct: 36  GRTVVVTGANSGIGKMTALELARRGARVVLACRSRERGEAAAFDLRQESGNNEVIFMALD 95

Query: 353 LASMKSIRQFVQKFKMKKIPLHVLVNNAGVMMVPQRETEDGFEEHFGVNYXXXXXXXXXX 532
           LAS+ S++ F   F   +  L VL++NAG+    +  T + F     VN+          
Sbjct: 96  LASLASVQAFATAFLSSEPRLDVLIHNAGISSCGR--TRETFNLLLRVNHVGPFLLTHLL 153

Query: 533 XXXXQASGSPGRSARVVTVSSATHYVGELDLD--DLQSSGGYSPHGAYARSKLALVLFSH 706
               ++       +RVV VSSA H  G LD    D    G      AYA SKLA VLF+ 
Sbjct: 154 LPRLRSCA----PSRVVIVSSAAHRRGRLDFTRLDCPVVGWQQELRAYADSKLANVLFAR 209

Query: 707 RLQALLAAKGSPVTANVADPGVVNTDLY-RHVFWGTRLLKKLFGW 838
            L   L  +G+ VT   A PG VN++L+ RH+    R + +   W
Sbjct: 210 ELATQL--EGTGVTCYAAHPGPVNSELFLRHLRGWLRPILRPLAW 252


>ref|NP_082066.1| dehydrogenase/reductase member 2 [Mus musculus]
          Length = 282

 Score = 59.7 bits (143), Expect = 7e-09
 Identities = 60/207 (28%), Positives = 84/207 (40%), Gaps = 3/207 (1%)
 Frame = +2

Query: 173 GRVAIVTGGTEGIGFATAKHLARLGMHVIIAGNNDSKAREAVRKIREETLNDKVEFLYCD 352
           G+VA++TG T GIGFA A+ LA+ G HV+I+        EAV  ++EE L+  V    C 
Sbjct: 37  GKVAVITGSTRGIGFAIARRLAQDGAHVVISSRKQENVDEAVTILKEEGLS--VTGTMCH 94

Query: 353 LASMKSIRQFVQKFKMKKIPLHVLVNNAGVMMV---PQRETEDGFEEHFGVNYXXXXXXX 523
           +   +  +  V         +  LV  AGV  +       +E  +++   VN        
Sbjct: 95  VGKAEDRQHLVTTALKHSGGIDFLVCVAGVNPLVGSTLGASEQIWDKILDVNVKSPALLL 154

Query: 524 XXXXXXXQASGSPGRSARVVTVSSATHYVGELDLDDLQSSGGYSPHGAYARSKLALVLFS 703
                  +      R   VV VSS   YV    L            G Y  SK AL+   
Sbjct: 155 SKVLPYMENR----RGGSVVLVSSGVAYVPVPKL------------GVYNTSKTALLGLC 198

Query: 704 HRLQALLAAKGSPVTANVADPGVVNTD 784
             L   LA KG  +  N   PG++ TD
Sbjct: 199 KSLAVELAPKG--IRVNCLVPGIIKTD 223


>ref|XP_487442.1| PREDICTED: similar to Carbonyl reductase [NADPH] 1 (NADPH-dependent
           carbonyl reductase 1) [Mus musculus]
          Length = 277

 Score = 58.2 bits (139), Expect = 2e-08
 Identities = 75/288 (26%), Positives = 117/288 (40%), Gaps = 34/288 (11%)
 Frame = +2

Query: 176 RVAIVTGGTEGIGFATAKHLA-RLGMHVIIAGNNDSKAREAVRKIREETLNDKVEFL-YC 349
           RVA+VTGG +GIGF   + L  +    V++   ++++   AV+K++ E LN +   L   
Sbjct: 6   RVALVTGGNKGIGFEIIRDLCQKFSGDVVLTARDEARGCAAVQKLQAEGLNPRFHQLDID 65

Query: 350 DLASMKSIRQFVQKFKMKKIPLHVLVNNAGVMMVPQRETEDGFEEHFGVNYXXXXXXXXX 529
           D  S+ ++R F+ K   +   L VLVNNAG+      + +D    H              
Sbjct: 66  DPQSIHALRDFLLK---EYKGLDVLVNNAGIAF----KVDDPTPFHIKGEVTMKTNFFGT 118

Query: 530 XXXXXQASGSPGRSARVVTVSS------------------ATHYVGELDLDDLQS----- 640
                +         RVV VSS                   +  + E +L  L +     
Sbjct: 119 RDVCKEMLPLIKPQGRVVNVSSMVSLSALKDCSPELQQKFRSETITEEELVGLMNKYVED 178

Query: 641 --SGGYS----PHGAYARSKLALVLFSHRLQALL--AAKGSPVTANVADPGVVNTDLYRH 796
              G Y     P+ AY  SK+ + + S  L   L    +G  +  N   PG V TD    
Sbjct: 179 AKKGVYVKEDWPNSAYEVSKIGVTVLSRILARKLNEQRRGDKILLNACCPGWVRTD---- 234

Query: 797 VFWGTRLLKKLFGWWFFKTPDEGAWTSVY-AAVSPALEGVGGRYLYNE 937
                     + G    K+P+EGA T VY A + P  EG  G+++ ++
Sbjct: 235 ----------MTGPQATKSPEEGAETPVYLALLPPDAEGPHGQFVQDK 272


>ref|XP_989090.1| PREDICTED: similar to Carbonyl reductase [NADPH] 1 (NADPH-dependent
           carbonyl reductase 1) [Mus musculus]
          Length = 277

 Score = 58.2 bits (139), Expect = 2e-08
 Identities = 75/288 (26%), Positives = 117/288 (40%), Gaps = 34/288 (11%)
 Frame = +2

Query: 176 RVAIVTGGTEGIGFATAKHLA-RLGMHVIIAGNNDSKAREAVRKIREETLNDKVEFL-YC 349
           RVA+VTGG +GIGF   + L  +    V++   ++++   AV+K++ E LN +   L   
Sbjct: 6   RVALVTGGNKGIGFEIIRDLCQKFSGDVVLTARDEARGCAAVQKLQAEGLNPRFHQLDID 65

Query: 350 DLASMKSIRQFVQKFKMKKIPLHVLVNNAGVMMVPQRETEDGFEEHFGVNYXXXXXXXXX 529
           D  S+ ++R F+ K   +   L VLVNNAG+      + +D    H              
Sbjct: 66  DPQSIHALRDFLLK---EYKGLDVLVNNAGIAF----KVDDPTPFHIKGEVTMKTNFFGT 118

Query: 530 XXXXXQASGSPGRSARVVTVSS------------------ATHYVGELDLDDLQS----- 640
                +         RVV VSS                   +  + E +L  L +     
Sbjct: 119 RDVCKEMLPLIKPQGRVVNVSSMVSLSALKDCSPELQQKFRSETITEEELVGLMNKYVED 178

Query: 641 --SGGYS----PHGAYARSKLALVLFSHRLQALL--AAKGSPVTANVADPGVVNTDLYRH 796
              G Y     P+ AY  SK+ + + S  L   L    +G  +  N   PG V TD    
Sbjct: 179 AKKGVYVKEDWPNSAYEVSKIGVTVLSRILARKLNEQRRGDKILLNACCPGWVRTD---- 234

Query: 797 VFWGTRLLKKLFGWWFFKTPDEGAWTSVY-AAVSPALEGVGGRYLYNE 937
                     + G    K+P+EGA T VY A + P  EG  G+++ ++
Sbjct: 235 ----------MTGPQATKSPEEGAETPVYLALLPPDAEGPHGQFVQDK 272


  Database: RefSeqMP
    Posted date:  Aug 2, 2006 12:58 AM
  Number of letters in database: 21,768,885
  Number of sequences in database:  45,328
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 54,644,887
Number of Sequences: 45328
Number of extensions: 1442054
Number of successful extensions: 9237
Number of sequences better than 1.0e-05: 10
Number of HSP's better than  0.0 without gapping: 6344
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 9083
length of database: 21,768,885
effective HSP length: 107
effective length of database: 16,918,789
effective search space used: 5752388260
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)