Animal-Genome cDNA OVR01_0092_E11


Search to RefSeqBP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= OVR01_0092_E11
         (2271 letters)

Database: RefSeqBP 
           33,508 sequences; 16,112,626 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|XP_614740.2| PREDICTED: similar to LanC-like protein 2 (Test...   588   e-168
Alignment   gi|XP_612082.2| PREDICTED: similar to LanC-like protein 1 (40 k...   489   e-138
Alignment   gi|XP_611101.2| PREDICTED: similar to LanC-like protein 2 (Test...   242   1e-63
Alignment   gi|XP_597454.2| PREDICTED: similar to LanC lantibiotic syntheta...   182   8e-46

>ref|XP_614740.2| PREDICTED: similar to LanC-like protein 2 (Testis-specific
           adriamycin sensitivity protein), partial [Bos taurus]
          Length = 331

 Score =  588 bits (1517), Expect = e-168
 Identities = 288/326 (88%), Positives = 300/326 (92%)
 Frame = +3

Query: 3   SRRLWFQGDWDAEMEERAFPNPFPDYXXXXXXXXXXXXXXXXXLTPEELGLPFHSDGKII 182
           SRRL  Q   DA+ME+RAFPNPFPDY                 L+PEELGLPFHSDGKII
Sbjct: 6   SRRLKLQLGGDADMEDRAFPNPFPDYEAAAERQAEEPPCSRTPLSPEELGLPFHSDGKII 65

Query: 183 HNFTRRIQSKIKDLLQQMEEGLKTADPHDCSAYTGWTGIALLYLQLYRVTCDQNYLLRSL 362
           +NFTRRIQ+KIKDLLQQMEEGLKTADPHDCSAYTGWTGIALLYLQLYRVTCDQ+YLLRSL
Sbjct: 66  NNFTRRIQTKIKDLLQQMEEGLKTADPHDCSAYTGWTGIALLYLQLYRVTCDQSYLLRSL 125

Query: 363 DYVKRTLRNLNGRRVTFLCGDAGPLAVGAVVYHKLKSDGESQECITKLLQLQRTIVCRDS 542
           DYVKRTLRNLNGRRVTFLCGDAGPLAVGAVVYHKLKSD ESQECITKLLQLQRTIVCRDS
Sbjct: 126 DYVKRTLRNLNGRRVTFLCGDAGPLAVGAVVYHKLKSDCESQECITKLLQLQRTIVCRDS 185

Query: 543 DLPDELLFGRAGYLYALLYVNTEMGPGAVCESAIKEVVDAIIDSGKTLSKEERKAERCPL 722
           DLPDELL+GRAGYLYALLYVNTE+GPGAVCESAIKEVV+AII+SGK LSKEE+K ERCPL
Sbjct: 186 DLPDELLYGRAGYLYALLYVNTEIGPGAVCESAIKEVVNAIIESGKALSKEEKKVERCPL 245

Query: 723 LYQWHRKQYVGAAHGMAGIYYMLMQPAAKVDQETLTEMVKPSIDYMRHKRFRSGNYPSSL 902
           LYQWHRKQYVGAAHGMAGIYYMLMQPAAKVDQETLTEMVKPSIDYMRHKRFRSGNYPSSL
Sbjct: 246 LYQWHRKQYVGAAHGMAGIYYMLMQPAAKVDQETLTEMVKPSIDYMRHKRFRSGNYPSSL 305

Query: 903 SNETDRLVHWCHGAPGVIHTLMQAYK 980
           SNETDRLVHWCHGAPGVIH LMQA+K
Sbjct: 306 SNETDRLVHWCHGAPGVIHVLMQAHK 331


>ref|XP_612082.2| PREDICTED: similar to LanC-like protein 1 (40 kDa erythrocyte
            membrane protein) (p40) [Bos taurus]
          Length = 399

 Score =  489 bits (1259), Expect = e-138
 Identities = 228/421 (54%), Positives = 301/421 (71%)
 Frame = +3

Query: 42   MEERAFPNPFPDYXXXXXXXXXXXXXXXXXLTPEELGLPFHSDGKIIHNFTRRIQSKIKD 221
            M +RAFPNP+ DY                          F S G++   F++R+ +KI++
Sbjct: 1    MAQRAFPNPYADYNKSLAEGY------------------FDSAGRLTPEFSQRLNNKIRE 42

Query: 222  LLQQMEEGLKTADPHDCSAYTGWTGIALLYLQLYRVTCDQNYLLRSLDYVKRTLRNLNGR 401
            LLQQME GLK+ADP D + YTGW GIA+LYL LY V  D NYL  +  YVK++L +L+  
Sbjct: 43   LLQQMERGLKSADPRDSTVYTGWAGIAVLYLHLYDVFGDPNYLQMAHGYVKQSLNSLSKH 102

Query: 402  RVTFLCGDAGPLAVGAVVYHKLKSDGESQECITKLLQLQRTIVCRDSDLPDELLFGRAGY 581
             +TFLCGD GPLAV AVV+HK+ ++ +++ECIT+L+ L +     D   P E+L+GR GY
Sbjct: 103  SITFLCGDGGPLAVAAVVHHKMNNEKQAEECITRLIHLNKI----DPHAPSEMLYGRMGY 158

Query: 582  LYALLYVNTEMGPGAVCESAIKEVVDAIIDSGKTLSKEERKAERCPLLYQWHRKQYVGAA 761
            + ALL+VN   G   + +S I+++ + ++ SG+ L+++ R   + PL+Y+W+++ YVGAA
Sbjct: 159  ISALLFVNKNFGEEKIPQSHIQQICETVLTSGEDLARKRRFTGKTPLMYEWYQEYYVGAA 218

Query: 762  HGMAGIYYMLMQPAAKVDQETLTEMVKPSIDYMRHKRFRSGNYPSSLSNETDRLVHWCHG 941
            HG+AGIYY LMQP+ +V    L  +VKPS+DY+   +F SGNYP  + +  D L+HWCHG
Sbjct: 219  HGLAGIYYYLMQPSLQVSHAKLHNLVKPSVDYVCQLKFPSGNYPPCVDDSRDLLIHWCHG 278

Query: 942  APGVIHTLMQAYKVFKEEKYLRDAVECSDVIWQRGLLRKGYGICHGTAGNGYSFLSLYRL 1121
            APGVI+ L QAYKVFKEE+YL DA +C+DVIWQ GLL+KGYG+CHGTAGN Y+FLSLY L
Sbjct: 279  APGVIYMLTQAYKVFKEERYLNDAYQCADVIWQYGLLKKGYGLCHGTAGNAYAFLSLYSL 338

Query: 1122 TQDKKYLYRACKFAEWCLEYGAHGCRIPDRPYSLFEGMAGAIHFLSDILAPETARFPAFE 1301
            TQD KYLYRACKFAEWCL+YG HGCR PD P+SLFEGMAG I+FL+D+L P  ARFPAFE
Sbjct: 339  TQDAKYLYRACKFAEWCLDYGEHGCRTPDTPFSLFEGMAGTIYFLADLLVPTKARFPAFE 398

Query: 1302 L 1304
            L
Sbjct: 399  L 399


>ref|XP_611101.2| PREDICTED: similar to LanC-like protein 2 (Testis-specific adriamycin
            sensitivity protein), partial [Bos taurus]
          Length = 149

 Score =  242 bits (617), Expect = 1e-63
 Identities = 114/144 (79%), Positives = 121/144 (84%)
 Frame = +3

Query: 909  ETDRLVHWCHGAPGVIHTLMQAYKVFKEEKYLRDAVECSDVIWQRGLLRKGYGICHGTAG 1088
            + D    W    P     + +   VFKEEKYL+DAVECSDVIWQRGLLRKGYGICHGTAG
Sbjct: 6    DVDGRAVWNLPLPSTRVGVSELQPVFKEEKYLKDAVECSDVIWQRGLLRKGYGICHGTAG 65

Query: 1089 NGYSFLSLYRLTQDKKYLYRACKFAEWCLEYGAHGCRIPDRPYSLFEGMAGAIHFLSDIL 1268
            NGYSFLSLY +TQDKKYLYRACKFAEWCLEYGAHGCRIPDRPYSLFEGMAG IHFLSDIL
Sbjct: 66   NGYSFLSLYHITQDKKYLYRACKFAEWCLEYGAHGCRIPDRPYSLFEGMAGTIHFLSDIL 125

Query: 1269 APETARFPAFELGSSERDPKVQKD 1340
            APE +RFPAFEL SS+RD KVQKD
Sbjct: 126  APEASRFPAFELSSSQRDTKVQKD 149


>ref|XP_597454.2| PREDICTED: similar to LanC lantibiotic synthetase component C-like 3
            [Bos taurus]
          Length = 244

 Score =  182 bits (463), Expect = 8e-46
 Identities = 95/225 (42%), Positives = 140/225 (62%), Gaps = 4/225 (1%)
 Frame = +3

Query: 642  IKEVVDAIIDSGKTLSKEERKAERCPLLYQWHRKQYVGAAHGMAGIYYMLMQPAAKVDQE 821
            IK +  AI+DSGK  + ++RK    PL+Y ++  +Y+GAAHG++ I  ML+     +   
Sbjct: 22   IKSICQAILDSGKQYAMKKRKP--FPLMYSYYGTEYLGAAHGLSSILQMLLSYHEHLKPS 79

Query: 822  TLTEMVKPSIDYMRHKRFRSGNYPSSLSNETDR---LVHWCHGAPGVIHTLMQAYKVFKE 992
               E+V  S+D++  +  ++ N+P  L    +R   LVHWCHGAPG+ +   +AY V K+
Sbjct: 80   D-QELVWQSVDFLMEQE-QNCNWPPELGEAIERENELVHWCHGAPGIAYLFAKAYLVSKK 137

Query: 993  EKYLRDAVECSDVIWQRGLLRKGYGICHGTAGNGYSFLSLYRLTQDKKYLYRACKFAEWC 1172
             +YL   + C ++ WQ+GLL+KG GICHG AG+ Y FL LYRLT + KY+YRA +FAE+ 
Sbjct: 138  PQYLDTCIRCGELTWQKGLLKKGPGICHGVAGSAYVFLLLYRLTGNSKYIYRAQRFAEFL 197

Query: 1173 L-EYGAHGCRIPDRPYSLFEGMAGAIHFLSDILAPETARFPAFEL 1304
              E    G R+ +  YSL+EG +G + FL D+L P  A FP F +
Sbjct: 198  FTEEFKAGSRVLESIYSLYEGFSGTVCFLIDLLQPNQAEFPLFSV 242


  Database: RefSeqBP
    Posted date:  Aug 1, 2006  7:14 PM
  Number of letters in database: 16,112,626
  Number of sequences in database:  33,508
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 84,355,147
Number of Sequences: 33508
Number of extensions: 2399431
Number of successful extensions: 9129
Number of sequences better than 1.0e-05: 4
Number of HSP's better than  0.0 without gapping: 6741
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 9106
length of database: 16,112,626
effective HSP length: 109
effective length of database: 12,460,254
effective search space used: 8061784338
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqCP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= OVR01_0092_E11
         (2271 letters)

Database: RefSeqCP 
           33,732 sequences; 19,266,565 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|XP_540359.2| PREDICTED: similar to LanC-like protein 2 (Test...   754   0.0  
Alignment   gi|XP_536055.1| PREDICTED: similar to LanC-like protein 1 (40 k...   485   e-137
Alignment   gi|XP_548943.2| PREDICTED: similar to LanC lantibiotic syntheta...   211   2e-54

>ref|XP_540359.2| PREDICTED: similar to LanC-like protein 2 (Testis-specific adriamycin
            sensitivity protein) [Canis familiaris]
          Length = 452

 Score =  754 bits (1946), Expect = 0.0
 Identities = 360/386 (93%), Positives = 375/386 (97%)
 Frame = +3

Query: 174  KIIHNFTRRIQSKIKDLLQQMEEGLKTADPHDCSAYTGWTGIALLYLQLYRVTCDQNYLL 353
            +I+ NFT+RIQ+KIKDLLQQMEEGLKTADPHDCSAYTGWTGIALLYLQLYRVTCDQ YLL
Sbjct: 67   RIVQNFTKRIQTKIKDLLQQMEEGLKTADPHDCSAYTGWTGIALLYLQLYRVTCDQTYLL 126

Query: 354  RSLDYVKRTLRNLNGRRVTFLCGDAGPLAVGAVVYHKLKSDGESQECITKLLQLQRTIVC 533
            RSLDYVKRTLRNLNGRRVTFLCGDAGPLAVGAVVYHKLKSD ESQECITKLLQLQRTIVC
Sbjct: 127  RSLDYVKRTLRNLNGRRVTFLCGDAGPLAVGAVVYHKLKSDCESQECITKLLQLQRTIVC 186

Query: 534  RDSDLPDELLFGRAGYLYALLYVNTEMGPGAVCESAIKEVVDAIIDSGKTLSKEERKAER 713
            RDSDLPDELL+GRAGYLYALLY+NTE+GPG VCESAIKEVV AII+SGKTLS+EERKAER
Sbjct: 187  RDSDLPDELLYGRAGYLYALLYLNTEIGPGTVCESAIKEVVCAIIESGKTLSREERKAER 246

Query: 714  CPLLYQWHRKQYVGAAHGMAGIYYMLMQPAAKVDQETLTEMVKPSIDYMRHKRFRSGNYP 893
            CPLLYQWHRKQYVGAAHGMAGIYYMLMQPAAKVDQETLTEMVKPSIDY+RHKRFRSGNYP
Sbjct: 247  CPLLYQWHRKQYVGAAHGMAGIYYMLMQPAAKVDQETLTEMVKPSIDYVRHKRFRSGNYP 306

Query: 894  SSLSNETDRLVHWCHGAPGVIHTLMQAYKVFKEEKYLRDAVECSDVIWQRGLLRKGYGIC 1073
            SSLSNETDRLVHWCHGAPGVIH LMQAYKVFKEEKYL+DA+ECSDVIWQRGLLRKGYGIC
Sbjct: 307  SSLSNETDRLVHWCHGAPGVIHMLMQAYKVFKEEKYLKDAMECSDVIWQRGLLRKGYGIC 366

Query: 1074 HGTAGNGYSFLSLYRLTQDKKYLYRACKFAEWCLEYGAHGCRIPDRPYSLFEGMAGAIHF 1253
            HGTAGNGYSFLSLY LTQDKKYLYRACKFAEWCLEYGAHGCRIPDRPYSLFEGMAGAIHF
Sbjct: 367  HGTAGNGYSFLSLYHLTQDKKYLYRACKFAEWCLEYGAHGCRIPDRPYSLFEGMAGAIHF 426

Query: 1254 LSDILAPETARFPAFELGSSERDPKV 1331
            LSDILAPET+RFPAFEL   +RD K+
Sbjct: 427  LSDILAPETSRFPAFELAPPQRDRKI 452


>ref|XP_536055.1| PREDICTED: similar to LanC-like protein 1 (40 kDa erythrocyte
            membrane protein) (p40) [Canis familiaris]
          Length = 399

 Score =  485 bits (1249), Expect = e-137
 Identities = 225/421 (53%), Positives = 302/421 (71%)
 Frame = +3

Query: 42   MEERAFPNPFPDYXXXXXXXXXXXXXXXXXLTPEELGLPFHSDGKIIHNFTRRIQSKIKD 221
            M +RAFPNP+ D+                          F   G++   F++R+ +KI++
Sbjct: 1    MAQRAFPNPYADFNKSLAESY------------------FDCAGRLTPEFSQRLNNKIRE 42

Query: 222  LLQQMEEGLKTADPHDCSAYTGWTGIALLYLQLYRVTCDQNYLLRSLDYVKRTLRNLNGR 401
            LLQQME GLK+ADP D + YTGW GIALLYL LY V  D  YL  +  YVK++L +L  R
Sbjct: 43   LLQQMERGLKSADPRDSTVYTGWAGIALLYLHLYDVFGDPAYLQMAHGYVKQSLNSLTKR 102

Query: 402  RVTFLCGDAGPLAVGAVVYHKLKSDGESQECITKLLQLQRTIVCRDSDLPDELLFGRAGY 581
             +TFLCGDAGPLA+GAVVYHK+ ++ ++++CIT+L+ L +     D   P+E+L+GR GY
Sbjct: 103  SITFLCGDAGPLAIGAVVYHKMNNEKQAEDCITRLIHLNKI----DHHAPNEMLYGRMGY 158

Query: 582  LYALLYVNTEMGPGAVCESAIKEVVDAIIDSGKTLSKEERKAERCPLLYQWHRKQYVGAA 761
            +YALL+VN   G   + +S I+++ +A++ SG+ L+++     + PL+Y+W+++ YVGAA
Sbjct: 159  VYALLFVNKNFGVEKIPQSHIQQICEAVLTSGENLAQKRNFTAKTPLMYEWYQEYYVGAA 218

Query: 762  HGMAGIYYMLMQPAAKVDQETLTEMVKPSIDYMRHKRFRSGNYPSSLSNETDRLVHWCHG 941
            HG+AGIYY+LMQP+ +V    L  +VKPS+DY+   +F SGNYP  + +  D LVHWCHG
Sbjct: 219  HGLAGIYYLLMQPSLQVSHVKLHNLVKPSVDYVCQLKFPSGNYPPCVDDNRDLLVHWCHG 278

Query: 942  APGVIHTLMQAYKVFKEEKYLRDAVECSDVIWQRGLLRKGYGICHGTAGNGYSFLSLYRL 1121
            +PGVI+ L+QAYK F+ E YL DA +C+DVIW+ GLLRKGYG+CHGTAGN Y+FL+LY L
Sbjct: 279  SPGVIYMLIQAYKAFRGEHYLNDAHQCADVIWRYGLLRKGYGLCHGTAGNAYAFLTLYNL 338

Query: 1122 TQDKKYLYRACKFAEWCLEYGAHGCRIPDRPYSLFEGMAGAIHFLSDILAPETARFPAFE 1301
            TQD KYLYRACKFAEWCL+YG HGCR PD P+SLFEGMAG I+FL+D+L P  ARFPAFE
Sbjct: 339  TQDMKYLYRACKFAEWCLDYGEHGCRTPDTPFSLFEGMAGTIYFLADLLVPTKARFPAFE 398

Query: 1302 L 1304
            L
Sbjct: 399  L 399


>ref|XP_548943.2| PREDICTED: similar to LanC lantibiotic synthetase component C-like 3
            [Canis familiaris]
          Length = 420

 Score =  211 bits (537), Expect = 2e-54
 Identities = 123/309 (39%), Positives = 175/309 (56%), Gaps = 8/309 (2%)
 Frame = +3

Query: 402  RVTFLCGDAGPLAVGAVVYHKLKSDGESQECITKLLQLQRTIVCRDSDL----PDELLFG 569
            R  FL G AG  AV  +VYH L      Q  + K   L    VC          DEL  G
Sbjct: 117  RAAFLLGGAGVYAVATLVYHALGRSDYVQP-LGKFRAL--CAVCAPVSFLECGSDELFVG 173

Query: 570  RAGYLYALLYVNTEMGPGAVCESAIKEVVDAIIDSGKTLSKEERKAERCPLLYQWHRKQY 749
            RAGYL A L +  ++    +  + IK +  AI+DSGK  + ++RK    PL+Y ++  +Y
Sbjct: 174  RAGYLCAALVLKQKLAQEVLTPAQIKSICQAILDSGKQYAMKKRKP--FPLMYSYYGTEY 231

Query: 750  VGAAHGMAGIYYMLMQPAAKVDQETLTEMVKPSIDYMRHKRFRSGNYPSSLSNETDR--- 920
            +GAAHG++ I  ML+     +      E+V  S+D++  +  ++ N+P  L    +R   
Sbjct: 232  LGAAHGLSSILQMLLSYHEHLKPSD-QELVWQSVDFLMEQE-QNCNWPPELGEAIERENE 289

Query: 921  LVHWCHGAPGVIHTLMQAYKVFKEEKYLRDAVECSDVIWQRGLLRKGYGICHGTAGNGYS 1100
            LVHWCHGAPG+ +   +AY V K+ +YL   + C ++ WQ+GLL+KG GICHG AG+ Y 
Sbjct: 290  LVHWCHGAPGIAYLFAKAYLVSKKPQYLDTCIRCGELTWQKGLLKKGPGICHGVAGSAYV 349

Query: 1101 FLSLYRLTQDKKYLYRACKFAEWCL-EYGAHGCRIPDRPYSLFEGMAGAIHFLSDILAPE 1277
            FL LYRLT + KY+YRA +FAE+   E    G R+ +  YSL+EG +G + FL D+L P 
Sbjct: 350  FLLLYRLTGNSKYIYRAQRFAEFLFTEEFKAGSRVLESIYSLYEGFSGTVCFLIDLLQPN 409

Query: 1278 TARFPAFEL 1304
             A FP F +
Sbjct: 410  QAEFPLFSV 418


  Database: RefSeqCP
    Posted date:  Aug 1, 2006  9:25 PM
  Number of letters in database: 19,266,565
  Number of sequences in database:  33,732
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 98,799,721
Number of Sequences: 33732
Number of extensions: 2810232
Number of successful extensions: 10577
Number of sequences better than 1.0e-05: 3
Number of HSP's better than  0.0 without gapping: 7644
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 10548
length of database: 19,266,565
effective HSP length: 111
effective length of database: 15,522,313
effective search space used: 10011891885
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqHP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= OVR01_0092_E11
         (2271 letters)

Database: RefSeqHP 
           39,411 sequences; 17,774,539 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_061167.1| LanC lantibiotic synthetase component C-like 2 ...   789   0.0  
Alignment   gi|NP_006046.1| lanthionine synthetase C-like protein 1 [Homo s...   488   e-138
Alignment   gi|NP_940913.1| LanC lantibiotic synthetase component C-like 3 ...   175   1e-43

>ref|NP_061167.1| LanC lantibiotic synthetase component C-like 2 [Homo sapiens]
          Length = 450

 Score =  789 bits (2038), Expect = 0.0
 Identities = 378/445 (84%), Positives = 404/445 (90%), Gaps = 5/445 (1%)
 Frame = +3

Query: 3    SRRLWFQGDWDAEMEERAFPNPFPDYXXXXXXXXXXXXXXXXXL-----TPEELGLPFHS 167
            S+RL      +AEMEERAF NPFPDY                       T +E GLPFH 
Sbjct: 6    SKRLKLHLGGEAEMEERAFVNPFPDYEAAAGALLASGAAEETGCVRPPATTDEPGLPFHQ 65

Query: 168  DGKIIHNFTRRIQSKIKDLLQQMEEGLKTADPHDCSAYTGWTGIALLYLQLYRVTCDQNY 347
            DGKIIHNF RRIQ+KIKDLLQQMEEGLKTADPHDCSAYTGWTGIALLYLQLYRVTCDQ Y
Sbjct: 66   DGKIIHNFIRRIQTKIKDLLQQMEEGLKTADPHDCSAYTGWTGIALLYLQLYRVTCDQTY 125

Query: 348  LLRSLDYVKRTLRNLNGRRVTFLCGDAGPLAVGAVVYHKLKSDGESQECITKLLQLQRTI 527
            LLRSLDYVKRTLRNLNGRRVTFLCGDAGPLAVGAV+YHKL+SD ESQEC+TKLLQLQR++
Sbjct: 126  LLRSLDYVKRTLRNLNGRRVTFLCGDAGPLAVGAVIYHKLRSDCESQECVTKLLQLQRSV 185

Query: 528  VCRDSDLPDELLFGRAGYLYALLYVNTEMGPGAVCESAIKEVVDAIIDSGKTLSKEERKA 707
            VC++SDLPDELL+GRAGYLYALLY+NTE+GPG VCESAIKEVV+AII+SGKTLS+EERK 
Sbjct: 186  VCQESDLPDELLYGRAGYLYALLYLNTEIGPGTVCESAIKEVVNAIIESGKTLSREERKT 245

Query: 708  ERCPLLYQWHRKQYVGAAHGMAGIYYMLMQPAAKVDQETLTEMVKPSIDYMRHKRFRSGN 887
            ERCPLLYQWHRKQYVGAAHGMAGIYYMLMQPAAKVDQETLTEMVKPSIDY+RHK+FRSGN
Sbjct: 246  ERCPLLYQWHRKQYVGAAHGMAGIYYMLMQPAAKVDQETLTEMVKPSIDYVRHKKFRSGN 305

Query: 888  YPSSLSNETDRLVHWCHGAPGVIHTLMQAYKVFKEEKYLRDAVECSDVIWQRGLLRKGYG 1067
            YPSSLSNETDRLVHWCHGAPGVIH LMQAYKVFKEEKYL++A+ECSDVIWQRGLLRKGYG
Sbjct: 306  YPSSLSNETDRLVHWCHGAPGVIHMLMQAYKVFKEEKYLKEAMECSDVIWQRGLLRKGYG 365

Query: 1068 ICHGTAGNGYSFLSLYRLTQDKKYLYRACKFAEWCLEYGAHGCRIPDRPYSLFEGMAGAI 1247
            ICHGTAGNGYSFLSLYRLTQDKKYLYRACKFAEWCL+YGAHGCRIPDRPYSLFEGMAGAI
Sbjct: 366  ICHGTAGNGYSFLSLYRLTQDKKYLYRACKFAEWCLDYGAHGCRIPDRPYSLFEGMAGAI 425

Query: 1248 HFLSDILAPETARFPAFELGSSERD 1322
            HFLSD+L PET+RFPAFEL SS+RD
Sbjct: 426  HFLSDVLGPETSRFPAFELDSSKRD 450


>ref|NP_006046.1| lanthionine synthetase C-like protein 1 [Homo sapiens]
          Length = 399

 Score =  488 bits (1256), Expect = e-138
 Identities = 229/421 (54%), Positives = 303/421 (71%)
 Frame = +3

Query: 42   MEERAFPNPFPDYXXXXXXXXXXXXXXXXXLTPEELGLPFHSDGKIIHNFTRRIQSKIKD 221
            M +RAFPNP+ DY                          F + G++   F++R+ +KI++
Sbjct: 1    MAQRAFPNPYADYNKSLAEGY------------------FDAAGRLTPEFSQRLTNKIRE 42

Query: 222  LLQQMEEGLKTADPHDCSAYTGWTGIALLYLQLYRVTCDQNYLLRSLDYVKRTLRNLNGR 401
            LLQQME GLK+ADP D + YTGW GIA+LYL LY V  D  YL  +  YVK++L  L  R
Sbjct: 43   LLQQMERGLKSADPRDGTGYTGWAGIAVLYLHLYDVFGDPAYLQLAHGYVKQSLNCLTKR 102

Query: 402  RVTFLCGDAGPLAVGAVVYHKLKSDGESQECITKLLQLQRTIVCRDSDLPDELLFGRAGY 581
             +TFLCGDAGPLAV AV+YHK+ ++ ++++CIT+L+ L +     D   P+E+L+GR GY
Sbjct: 103  SITFLCGDAGPLAVAAVLYHKMNNEKQAEDCITRLIHLNKI----DPHAPNEMLYGRIGY 158

Query: 582  LYALLYVNTEMGPGAVCESAIKEVVDAIIDSGKTLSKEERKAERCPLLYQWHRKQYVGAA 761
            +YALL+VN   G   + +S I+++ + I+ SG+ L+++     + PL+Y+W+++ YVGAA
Sbjct: 159  IYALLFVNKNFGVEKIPQSHIQQICETILTSGENLARKRNFTAKSPLMYEWYQEYYVGAA 218

Query: 762  HGMAGIYYMLMQPAAKVDQETLTEMVKPSIDYMRHKRFRSGNYPSSLSNETDRLVHWCHG 941
            HG+AGIYY LMQP+ +V Q  L  +VKPS+DY+   +F SGNYP  + +  D LVHWCHG
Sbjct: 219  HGLAGIYYYLMQPSLQVSQGKLHSLVKPSVDYVCQLKFPSGNYPPCIGDNRDLLVHWCHG 278

Query: 942  APGVIHTLMQAYKVFKEEKYLRDAVECSDVIWQRGLLRKGYGICHGTAGNGYSFLSLYRL 1121
            APGVI+ L+QAYKVF+EEKYL DA +C+DVIWQ GLL+KGYG+CHG+AGN Y+FL+LY L
Sbjct: 279  APGVIYMLIQAYKVFREEKYLCDAYQCADVIWQYGLLKKGYGLCHGSAGNAYAFLTLYNL 338

Query: 1122 TQDKKYLYRACKFAEWCLEYGAHGCRIPDRPYSLFEGMAGAIHFLSDILAPETARFPAFE 1301
            TQD KYLYRACKFAEWCLEYG HGCR PD P+SLFEGMAG I+FL+D+L P  ARFPAFE
Sbjct: 339  TQDMKYLYRACKFAEWCLEYGEHGCRTPDTPFSLFEGMAGTIYFLADLLVPTKARFPAFE 398

Query: 1302 L 1304
            L
Sbjct: 399  L 399


>ref|NP_940913.1| LanC lantibiotic synthetase component C-like 3 [Homo sapiens]
          Length = 388

 Score =  175 bits (444), Expect = 1e-43
 Identities = 102/257 (39%), Positives = 145/257 (56%), Gaps = 7/257 (2%)
 Frame = +3

Query: 402  RVTFLCGDAGPLAVGAVVYHKLKSDGESQECITKLLQLQRTIVCRDSDL----PDELLFG 569
            R  FL G AG  AV  +VYH L      Q  + K   L    VC          DEL  G
Sbjct: 117  RAAFLLGGAGVYAVATLVYHALGRSDYVQP-LGKFRAL--CAVCAPVSFLECGSDELFVG 173

Query: 570  RAGYLYALLYVNTEMGPGAVCESAIKEVVDAIIDSGKTLSKEERKAERCPLLYQWHRKQY 749
            RAGYL A L +  ++    +  + IK +  AI+DSGK  + ++RK    PL+Y ++  +Y
Sbjct: 174  RAGYLCAALVLKQKLAQEVLTPAQIKSICQAILDSGKQYAIKKRKP--FPLMYSYYGTEY 231

Query: 750  VGAAHGMAGIYYMLMQPAAKVDQETLTEMVKPSIDYMRHKRFRSGNYPSSLSNETDR--- 920
            +GAAHG++ I  ML+     +      E+V  S+D++  +  ++ N+P  L    +R   
Sbjct: 232  LGAAHGLSSILQMLLSYHEHLKPSD-RELVWQSVDFLMEQE-QNCNWPPELGETIERENE 289

Query: 921  LVHWCHGAPGVIHTLMQAYKVFKEEKYLRDAVECSDVIWQRGLLRKGYGICHGTAGNGYS 1100
            LVHWCHGAPG+ +   +AY V K+ +YL   + C ++ WQ+GLL+KG GICHG AG+ Y 
Sbjct: 290  LVHWCHGAPGIAYLFAKAYLVSKKPQYLDTCIRCGELTWQKGLLKKGPGICHGVAGSAYV 349

Query: 1101 FLSLYRLTQDKKYLYRA 1151
            FL LYRLT + KY+YRA
Sbjct: 350  FLLLYRLTGNSKYIYRA 366


  Database: RefSeqHP
    Posted date:  Aug 2, 2006 12:57 AM
  Number of letters in database: 17,774,539
  Number of sequences in database:  39,411
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 96,153,637
Number of Sequences: 39411
Number of extensions: 2841397
Number of successful extensions: 10614
Number of sequences better than 1.0e-05: 3
Number of HSP's better than  0.0 without gapping: 7561
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 10563
length of database: 17,774,539
effective HSP length: 110
effective length of database: 13,439,329
effective search space used: 8681806534
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqSP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= OVR01_0092_E11
         (2271 letters)

Database: RefSeqSP 
           1040 sequences; 434,620 total letters

Searching...done

 ***** No hits found ******

  Database: RefSeqSP
    Posted date:  Aug 1, 2006  7:14 PM
  Number of letters in database: 434,620
  Number of sequences in database:  1040
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,233,895
Number of Sequences: 1040
Number of extensions: 60692
Number of successful extensions: 183
Number of sequences better than 1.0e-05: 0
Number of HSP's better than  0.0 without gapping: 154
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 182
length of database: 434,620
effective HSP length: 84
effective length of database: 347,260
effective search space used: 233358720
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqMP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= OVR01_0092_E11
         (2271 letters)

Database: RefSeqMP 
           45,328 sequences; 21,768,885 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_598498.1| LanC (bacterial lantibiotic synthetase componen...   759   0.0  
Alignment   gi|XP_984245.1| PREDICTED: similar to LanC (bacterial lantibiot...   538   e-153
Alignment   gi|NP_067270.1| LanC (bacterial lantibiotic synthetase componen...   486   e-137
Alignment   gi|NP_775590.1| LanC lantibiotic synthetase component C-like 3 ...   211   3e-54

>ref|NP_598498.1| LanC (bacterial lantibiotic synthetase component C)-like 2 [Mus
            musculus]
          Length = 450

 Score =  759 bits (1959), Expect = 0.0
 Identities = 365/446 (81%), Positives = 400/446 (89%), Gaps = 6/446 (1%)
 Frame = +3

Query: 3    SRRLWFQGDWDAEMEERAFPNPFPDYXXXXXXXXXXXXXXXXX------LTPEELGLPFH 164
            S+RL F    +AEMEER+FPNPFPDY                        T E+ GLPFH
Sbjct: 6    SKRLKFHLG-EAEMEERSFPNPFPDYEAAASAAGLAAGSAEETGRVCPLPTTEDPGLPFH 64

Query: 165  SDGKIIHNFTRRIQSKIKDLLQQMEEGLKTADPHDCSAYTGWTGIALLYLQLYRVTCDQN 344
             +GKI+ NF +RIQ+KIKDLLQQMEEGLKTADPHDCSAYTGWTGIALLYLQLYRVT DQ 
Sbjct: 65   PNGKIVPNFIKRIQTKIKDLLQQMEEGLKTADPHDCSAYTGWTGIALLYLQLYRVTGDQT 124

Query: 345  YLLRSLDYVKRTLRNLNGRRVTFLCGDAGPLAVGAVVYHKLKSDGESQECITKLLQLQRT 524
            YLLRSLDYVKRTLRNL+GRRVTFLCGDAGPLAVGAV+YHKLKS+ ESQECITKLLQ+ RT
Sbjct: 125  YLLRSLDYVKRTLRNLSGRRVTFLCGDAGPLAVGAVIYHKLKSECESQECITKLLQMHRT 184

Query: 525  IVCRDSDLPDELLFGRAGYLYALLYVNTEMGPGAVCESAIKEVVDAIIDSGKTLSKEERK 704
            IVC++S+LPDELL+GRAGYLYALLY+NTE+GPG V E+AIKEVV AII+SGK+LS+EERK
Sbjct: 185  IVCQESELPDELLYGRAGYLYALLYLNTEIGPGTVGETAIKEVVSAIIESGKSLSREERK 244

Query: 705  AERCPLLYQWHRKQYVGAAHGMAGIYYMLMQPAAKVDQETLTEMVKPSIDYMRHKRFRSG 884
            +ERCPLLYQWHRKQYVGAAHGMAGIYYMLMQP AKVDQETLTEMVKPSIDY+RHK+FRSG
Sbjct: 245  SERCPLLYQWHRKQYVGAAHGMAGIYYMLMQPEAKVDQETLTEMVKPSIDYVRHKKFRSG 304

Query: 885  NYPSSLSNETDRLVHWCHGAPGVIHTLMQAYKVFKEEKYLRDAVECSDVIWQRGLLRKGY 1064
            NYPSSLSNETDRLVHWCHGAPGVIH L+QAY+VFKEEKYL++A+ECSDVIWQRGLLRKGY
Sbjct: 305  NYPSSLSNETDRLVHWCHGAPGVIHVLLQAYQVFKEEKYLKEAMECSDVIWQRGLLRKGY 364

Query: 1065 GICHGTAGNGYSFLSLYRLTQDKKYLYRACKFAEWCLEYGAHGCRIPDRPYSLFEGMAGA 1244
            GICHGT+GNGYSFLSLYRLTQDKKYLYRACKFAEWCL+YGAHGCRIPDRPYSLFEGMAGA
Sbjct: 365  GICHGTSGNGYSFLSLYRLTQDKKYLYRACKFAEWCLDYGAHGCRIPDRPYSLFEGMAGA 424

Query: 1245 IHFLSDILAPETARFPAFELGSSERD 1322
            +HFLSDIL PETARFPAFELG  ++D
Sbjct: 425  VHFLSDILVPETARFPAFELGFLQKD 450


>ref|XP_984245.1| PREDICTED: similar to LanC (bacterial lantibiotic synthetase
            component C)-like 2 [Mus musculus]
          Length = 390

 Score =  538 bits (1387), Expect = e-153
 Identities = 286/446 (64%), Positives = 318/446 (71%), Gaps = 6/446 (1%)
 Frame = +3

Query: 3    SRRLWFQGDWDAEMEERAFPNPFPDYXXXXXXXXXXXXXXXXX------LTPEELGLPFH 164
            S+RL F    +AEMEER+FPNPFPDY                        T E+ GLPFH
Sbjct: 6    SKRLKFHLG-EAEMEERSFPNPFPDYEAAASAAGLAAGSAEETGRVCPLPTTEDPGLPFH 64

Query: 165  SDGKIIHNFTRRIQSKIKDLLQQMEEGLKTADPHDCSAYTGWTGIALLYLQLYRVTCDQN 344
             +GKI+ NF +RIQ+KIKDLLQQMEEGLKTADPHDCSAYTGWTGIALLYLQLYRVT DQ 
Sbjct: 65   PNGKIVPNFIKRIQTKIKDLLQQMEEGLKTADPHDCSAYTGWTGIALLYLQLYRVTGDQT 124

Query: 345  YLLRSLDYVKRTLRNLNGRRVTFLCGDAGPLAVGAVVYHKLKSDGESQECITKLLQLQRT 524
            YLLRSLDYVKRTLRNL+GRRVTFLCGDAGPLAVGAV+YHKLKS+ ESQECITKLLQ+ RT
Sbjct: 125  YLLRSLDYVKRTLRNLSGRRVTFLCGDAGPLAVGAVIYHKLKSECESQECITKLLQMHRT 184

Query: 525  IVCRDSDLPDELLFGRAGYLYALLYVNTEMGPGAVCESAIKEVVDAIIDSGKTLSKEERK 704
            IVC++S+LPDELL+GRAGYLYALLY+NTE+GPG V E+AIKEVV AII+SGK+LS+EERK
Sbjct: 185  IVCQESELPDELLYGRAGYLYALLYLNTEIGPGTVGETAIKEVVSAIIESGKSLSREERK 244

Query: 705  AERCPLLYQWHRKQYVGAAHGMAGIYYMLMQPAAKVDQETLTEMVKPSIDYMRHKRFRSG 884
            +ERCPLLYQWHRKQYVGAAHGMAGIYYMLMQP AKVDQETLTEMVKPSIDY+RHK+FRSG
Sbjct: 245  SERCPLLYQWHRKQYVGAAHGMAGIYYMLMQPEAKVDQETLTEMVKPSIDYVRHKKFRSG 304

Query: 885  NYPSSLSNETDRLVHWCHGAPGVIHTLMQAYKVFKEEKYLRDAVECSDVIWQRGLLRKGY 1064
            NYPSSLSNETDRLVHW                                            
Sbjct: 305  NYPSSLSNETDRLVHW-------------------------------------------- 320

Query: 1065 GICHGTAGNGYSFLSLYRLTQDKKYLYRACKFAEWCLEYGAHGCRIPDRPYSLFEGMAGA 1244
              CHG  G  +  L  Y+   +   LY                C +P R    F GMAGA
Sbjct: 321  --CHGAPGVIHVLLQAYQRL-NITLLYSIT-------------CVVPKRCTFCFAGMAGA 364

Query: 1245 IHFLSDILAPETARFPAFELGSSERD 1322
            +HFLSDIL PETARFPAFELG  ++D
Sbjct: 365  VHFLSDILVPETARFPAFELGFLQKD 390


>ref|NP_067270.1| LanC (bacterial lantibiotic synthetase component C)-like 1 [Mus
            musculus]
          Length = 399

 Score =  486 bits (1251), Expect = e-137
 Identities = 229/421 (54%), Positives = 304/421 (72%)
 Frame = +3

Query: 42   MEERAFPNPFPDYXXXXXXXXXXXXXXXXXLTPEELGLPFHSDGKIIHNFTRRIQSKIKD 221
            M +RAFPNP+ DY                          F S G++   F+ R+ +KI++
Sbjct: 1    MAQRAFPNPYADYNKSLAENY------------------FDSTGRLTPEFSHRLTNKIRE 42

Query: 222  LLQQMEEGLKTADPHDCSAYTGWTGIALLYLQLYRVTCDQNYLLRSLDYVKRTLRNLNGR 401
            LLQQME GLK+ADP D + YTGW GIA+LYL L+ V  D  YL  +  YVK++L  L+ R
Sbjct: 43   LLQQMERGLKSADPRDGTGYTGWAGIAVLYLHLHNVFGDPAYLQMAHSYVKQSLNCLSRR 102

Query: 402  RVTFLCGDAGPLAVGAVVYHKLKSDGESQECITKLLQLQRTIVCRDSDLPDELLFGRAGY 581
             +TFLCGDAGPLAV AV+YHK+ S+ +++ECIT+L+ L +     D  +P+E+L+GR GY
Sbjct: 103  SITFLCGDAGPLAVAAVLYHKMNSEKQAEECITRLIHLNKI----DPHVPNEMLYGRIGY 158

Query: 582  LYALLYVNTEMGPGAVCESAIKEVVDAIIDSGKTLSKEERKAERCPLLYQWHRKQYVGAA 761
            ++ALL+VN   G   + +S I+++ + I+ SG+ LS++   A + PL+Y+W+++ YVGAA
Sbjct: 159  IFALLFVNKNFGEEKIPQSHIQQICENILTSGENLSRKRNLAAKSPLMYEWYQEYYVGAA 218

Query: 762  HGMAGIYYMLMQPAAKVDQETLTEMVKPSIDYMRHKRFRSGNYPSSLSNETDRLVHWCHG 941
            HG+AGIYY LMQP+ +V+Q  L  +VKPS+D++   +F SGNYP  L +  D LVHWCHG
Sbjct: 219  HGLAGIYYYLMQPSLQVNQGKLHSLVKPSVDFVCRLKFPSGNYPPCLDDTRDLLVHWCHG 278

Query: 942  APGVIHTLMQAYKVFKEEKYLRDAVECSDVIWQRGLLRKGYGICHGTAGNGYSFLSLYRL 1121
            APGVI+ L+QAYKVFKEE+YL DA +C+DVIWQ GLL+KGYG+CHG AGN Y+FL+LY L
Sbjct: 279  APGVIYMLIQAYKVFKEERYLCDAQQCADVIWQYGLLKKGYGLCHGAAGNAYAFLALYNL 338

Query: 1122 TQDKKYLYRACKFAEWCLEYGAHGCRIPDRPYSLFEGMAGAIHFLSDILAPETARFPAFE 1301
            TQD KYLYRACKFAEWCL+YG HGCR  D P+SLFEGMAG I+FL+D+L P  A+FPAFE
Sbjct: 339  TQDLKYLYRACKFAEWCLDYGEHGCRTADTPFSLFEGMAGTIYFLADLLVPTKAKFPAFE 398

Query: 1302 L 1304
            L
Sbjct: 399  L 399


>ref|NP_775590.1| LanC lantibiotic synthetase component C-like 3 [Mus musculus]
          Length = 420

 Score =  211 bits (537), Expect = 3e-54
 Identities = 121/309 (39%), Positives = 176/309 (56%), Gaps = 8/309 (2%)
 Frame = +3

Query: 402  RVTFLCGDAGPLAVGAVVYHKLKSDGESQECITKLLQLQRTIVCRDSDL----PDELLFG 569
            R  FL G AG  AV  +VYH L      Q  + K   L    VC          DEL  G
Sbjct: 117  RAAFLLGGAGVYAVATLVYHALGRPDYVQP-LGKFRAL--CAVCAPVSFLDCGSDELFVG 173

Query: 570  RAGYLYALLYVNTEMGPGAVCESAIKEVVDAIIDSGKTLSKEERKAERCPLLYQWHRKQY 749
            RAGYL A L +  ++    +  + IK +  AI+DSGK  + ++RK    PL+Y ++  +Y
Sbjct: 174  RAGYLCAALVLKQKLAQEVLTPTQIKAICQAILDSGKQYALKKRKP--FPLMYSYYGTEY 231

Query: 750  VGAAHGMAGIYYMLMQPAAKVDQETLTEMVKPSIDYMRHKRFRSGNYPSSLSNETDR--- 920
            +GAAHG++ I  ML+     +      E+V+ S+D++  +  ++ N+P  L    +R   
Sbjct: 232  LGAAHGLSSILQMLLSYQEHLKPSD-RELVRQSVDFLMEQE-QNCNWPPELGETIERENE 289

Query: 921  LVHWCHGAPGVIHTLMQAYKVFKEEKYLRDAVECSDVIWQRGLLRKGYGICHGTAGNGYS 1100
            LVHWCHGAPG+ +   +AY + K+ +YL   + C ++ WQ+GLL+KG GICHG AG+ Y 
Sbjct: 290  LVHWCHGAPGIAYLFAKAYLISKKPQYLDTCIRCGELTWQKGLLKKGPGICHGVAGSAYV 349

Query: 1101 FLSLYRLTQDKKYLYRACKFAEWCL-EYGAHGCRIPDRPYSLFEGMAGAIHFLSDILAPE 1277
            FL LYRLT + KY+YRA +FA++   E    G R+ +  YSL+EG +G + FL D+L P 
Sbjct: 350  FLLLYRLTGNSKYIYRAQRFAQFLFTEEFKSGSRVLESIYSLYEGFSGTVCFLIDLLQPN 409

Query: 1278 TARFPAFEL 1304
             A FP F +
Sbjct: 410  QAEFPLFSV 418


  Database: RefSeqMP
    Posted date:  Aug 2, 2006 12:58 AM
  Number of letters in database: 21,768,885
  Number of sequences in database:  45,328
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 113,068,180
Number of Sequences: 45328
Number of extensions: 3197660
Number of successful extensions: 11941
Number of sequences better than 1.0e-05: 4
Number of HSP's better than  0.0 without gapping: 8702
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 11884
length of database: 21,768,885
effective HSP length: 111
effective length of database: 16,737,477
effective search space used: 10795672665
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)