Animal-Genome cDNA OVRM1_0055_H01


Search to RefSeqBP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= OVRM1_0055_H01
         (2008 letters)

Database: RefSeqBP 
           33,508 sequences; 16,112,626 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|XP_614740.2| PREDICTED: similar to LanC-like protein 2 (Test...   598   e-171
Alignment   gi|XP_612082.2| PREDICTED: similar to LanC-like protein 1 (40 k...   489   e-138
Alignment   gi|XP_611101.2| PREDICTED: similar to LanC-like protein 2 (Test...   242   9e-64
Alignment   gi|XP_597454.2| PREDICTED: similar to LanC lantibiotic syntheta...   181   2e-45

>ref|XP_614740.2| PREDICTED: similar to LanC-like protein 2 (Testis-specific adriamycin
            sensitivity protein), partial [Bos taurus]
          Length = 331

 Score =  598 bits (1542), Expect = e-171
 Identities = 293/331 (88%), Positives = 305/331 (92%)
 Frame = +3

Query: 291  MGETISRRLWFQGDWDAEMEERAFPNPFPDYXXXXXXXXXXXXXXXXXLTPEELGLPFHS 470
            MGET+SRRL  Q   DA+ME+RAFPNPFPDY                 L+PEELGLPFHS
Sbjct: 1    MGETMSRRLKLQLGGDADMEDRAFPNPFPDYEAAAERQAEEPPCSRTPLSPEELGLPFHS 60

Query: 471  DGKIIHNFTRRIQSKIKDLLQQMEEGLKTADPHDCSAYTGWTGIALLYLQLYRVTCDQNY 650
            DGKII+NFTRRIQ+KIKDLLQQMEEGLKTADPHDCSAYTGWTGIALLYLQLYRVTCDQ+Y
Sbjct: 61   DGKIINNFTRRIQTKIKDLLQQMEEGLKTADPHDCSAYTGWTGIALLYLQLYRVTCDQSY 120

Query: 651  LLRSLDYVKRTLRNLNGRRVTFLCGDAGPLAVGAVVYHKLKSDGESQECITKLLQLQRTI 830
            LLRSLDYVKRTLRNLNGRRVTFLCGDAGPLAVGAVVYHKLKSD ESQECITKLLQLQRTI
Sbjct: 121  LLRSLDYVKRTLRNLNGRRVTFLCGDAGPLAVGAVVYHKLKSDCESQECITKLLQLQRTI 180

Query: 831  VCRDSDLPDELLFGRAGYLYALLYVNTEMGPGAVCESAIKEVVDAIIESGKTLSKEERKA 1010
            VCRDSDLPDELL+GRAGYLYALLYVNTE+GPGAVCESAIKEVV+AIIESGK LSKEE+K 
Sbjct: 181  VCRDSDLPDELLYGRAGYLYALLYVNTEIGPGAVCESAIKEVVNAIIESGKALSKEEKKV 240

Query: 1011 ERCPLLYQWHRKQYVGAAHGMAGIYYMLMQPAAKVDQETLTEMVKPSIDYMRHKRFRSGN 1190
            ERCPLLYQWHRKQYVGAAHGMAGIYYMLMQPAAKVDQETLTEMVKPSIDYMRHKRFRSGN
Sbjct: 241  ERCPLLYQWHRKQYVGAAHGMAGIYYMLMQPAAKVDQETLTEMVKPSIDYMRHKRFRSGN 300

Query: 1191 YPSSLSNETDRLVHWCHGAPGVIHTLMQAYK 1283
            YPSSLSNETDRLVHWCHGAPGVIH LMQA+K
Sbjct: 301  YPSSLSNETDRLVHWCHGAPGVIHVLMQAHK 331


>ref|XP_612082.2| PREDICTED: similar to LanC-like protein 1 (40 kDa erythrocyte
            membrane protein) (p40) [Bos taurus]
          Length = 399

 Score =  489 bits (1259), Expect = e-138
 Identities = 228/421 (54%), Positives = 301/421 (71%)
 Frame = +3

Query: 345  MEERAFPNPFPDYXXXXXXXXXXXXXXXXXLTPEELGLPFHSDGKIIHNFTRRIQSKIKD 524
            M +RAFPNP+ DY                          F S G++   F++R+ +KI++
Sbjct: 1    MAQRAFPNPYADYNKSLAEGY------------------FDSAGRLTPEFSQRLNNKIRE 42

Query: 525  LLQQMEEGLKTADPHDCSAYTGWTGIALLYLQLYRVTCDQNYLLRSLDYVKRTLRNLNGR 704
            LLQQME GLK+ADP D + YTGW GIA+LYL LY V  D NYL  +  YVK++L +L+  
Sbjct: 43   LLQQMERGLKSADPRDSTVYTGWAGIAVLYLHLYDVFGDPNYLQMAHGYVKQSLNSLSKH 102

Query: 705  RVTFLCGDAGPLAVGAVVYHKLKSDGESQECITKLLQLQRTIVCRDSDLPDELLFGRAGY 884
             +TFLCGD GPLAV AVV+HK+ ++ +++ECIT+L+ L +     D   P E+L+GR GY
Sbjct: 103  SITFLCGDGGPLAVAAVVHHKMNNEKQAEECITRLIHLNKI----DPHAPSEMLYGRMGY 158

Query: 885  LYALLYVNTEMGPGAVCESAIKEVVDAIIESGKTLSKEERKAERCPLLYQWHRKQYVGAA 1064
            + ALL+VN   G   + +S I+++ + ++ SG+ L+++ R   + PL+Y+W+++ YVGAA
Sbjct: 159  ISALLFVNKNFGEEKIPQSHIQQICETVLTSGEDLARKRRFTGKTPLMYEWYQEYYVGAA 218

Query: 1065 HGMAGIYYMLMQPAAKVDQETLTEMVKPSIDYMRHKRFRSGNYPSSLSNETDRLVHWCHG 1244
            HG+AGIYY LMQP+ +V    L  +VKPS+DY+   +F SGNYP  + +  D L+HWCHG
Sbjct: 219  HGLAGIYYYLMQPSLQVSHAKLHNLVKPSVDYVCQLKFPSGNYPPCVDDSRDLLIHWCHG 278

Query: 1245 APGVIHTLMQAYKVFKEEKYLRDAVECSDVIWQRGLLRKGYGICHGTAGNGYSFLSLYRL 1424
            APGVI+ L QAYKVFKEE+YL DA +C+DVIWQ GLL+KGYG+CHGTAGN Y+FLSLY L
Sbjct: 279  APGVIYMLTQAYKVFKEERYLNDAYQCADVIWQYGLLKKGYGLCHGTAGNAYAFLSLYSL 338

Query: 1425 TQDKKYLYRACKFAEWCLEYGAHGCRIPDRPYSLFEGMAGAIHFLSDILAPETARFPAFE 1604
            TQD KYLYRACKFAEWCL+YG HGCR PD P+SLFEGMAG I+FL+D+L P  ARFPAFE
Sbjct: 339  TQDAKYLYRACKFAEWCLDYGEHGCRTPDTPFSLFEGMAGTIYFLADLLVPTKARFPAFE 398

Query: 1605 L 1607
            L
Sbjct: 399  L 399


>ref|XP_611101.2| PREDICTED: similar to LanC-like protein 2 (Testis-specific adriamycin
            sensitivity protein), partial [Bos taurus]
          Length = 149

 Score =  242 bits (617), Expect = 9e-64
 Identities = 114/144 (79%), Positives = 121/144 (84%)
 Frame = +3

Query: 1212 ETDRLVHWCHGAPGVIHTLMQAYKVFKEEKYLRDAVECSDVIWQRGLLRKGYGICHGTAG 1391
            + D    W    P     + +   VFKEEKYL+DAVECSDVIWQRGLLRKGYGICHGTAG
Sbjct: 6    DVDGRAVWNLPLPSTRVGVSELQPVFKEEKYLKDAVECSDVIWQRGLLRKGYGICHGTAG 65

Query: 1392 NGYSFLSLYRLTQDKKYLYRACKFAEWCLEYGAHGCRIPDRPYSLFEGMAGAIHFLSDIL 1571
            NGYSFLSLY +TQDKKYLYRACKFAEWCLEYGAHGCRIPDRPYSLFEGMAG IHFLSDIL
Sbjct: 66   NGYSFLSLYHITQDKKYLYRACKFAEWCLEYGAHGCRIPDRPYSLFEGMAGTIHFLSDIL 125

Query: 1572 APETARFPAFELGSSERDPKVQKD 1643
            APE +RFPAFEL SS+RD KVQKD
Sbjct: 126  APEASRFPAFELSSSQRDTKVQKD 149


>ref|XP_597454.2| PREDICTED: similar to LanC lantibiotic synthetase component C-like 3
            [Bos taurus]
          Length = 244

 Score =  181 bits (459), Expect = 2e-45
 Identities = 94/225 (41%), Positives = 140/225 (62%), Gaps = 4/225 (1%)
 Frame = +3

Query: 945  IKEVVDAIIESGKTLSKEERKAERCPLLYQWHRKQYVGAAHGMAGIYYMLMQPAAKVDQE 1124
            IK +  AI++SGK  + ++RK    PL+Y ++  +Y+GAAHG++ I  ML+     +   
Sbjct: 22   IKSICQAILDSGKQYAMKKRKP--FPLMYSYYGTEYLGAAHGLSSILQMLLSYHEHLKPS 79

Query: 1125 TLTEMVKPSIDYMRHKRFRSGNYPSSLSNETDR---LVHWCHGAPGVIHTLMQAYKVFKE 1295
               E+V  S+D++  +  ++ N+P  L    +R   LVHWCHGAPG+ +   +AY V K+
Sbjct: 80   D-QELVWQSVDFLMEQE-QNCNWPPELGEAIERENELVHWCHGAPGIAYLFAKAYLVSKK 137

Query: 1296 EKYLRDAVECSDVIWQRGLLRKGYGICHGTAGNGYSFLSLYRLTQDKKYLYRACKFAEWC 1475
             +YL   + C ++ WQ+GLL+KG GICHG AG+ Y FL LYRLT + KY+YRA +FAE+ 
Sbjct: 138  PQYLDTCIRCGELTWQKGLLKKGPGICHGVAGSAYVFLLLYRLTGNSKYIYRAQRFAEFL 197

Query: 1476 L-EYGAHGCRIPDRPYSLFEGMAGAIHFLSDILAPETARFPAFEL 1607
              E    G R+ +  YSL+EG +G + FL D+L P  A FP F +
Sbjct: 198  FTEEFKAGSRVLESIYSLYEGFSGTVCFLIDLLQPNQAEFPLFSV 242


  Database: RefSeqBP
    Posted date:  Aug 1, 2006  7:14 PM
  Number of letters in database: 16,112,626
  Number of sequences in database:  33,508
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 73,236,282
Number of Sequences: 33508
Number of extensions: 2118485
Number of successful extensions: 12977
Number of sequences better than 1.0e-05: 4
Number of HSP's better than  0.0 without gapping: 7808
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 12858
length of database: 16,112,626
effective HSP length: 108
effective length of database: 12,493,762
effective search space used: 6996506720
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqCP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= OVRM1_0055_H01
         (2008 letters)

Database: RefSeqCP 
           33,732 sequences; 19,266,565 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|XP_540359.2| PREDICTED: similar to LanC-like protein 2 (Test...   755   0.0  
Alignment   gi|XP_536055.1| PREDICTED: similar to LanC-like protein 1 (40 k...   485   e-137
Alignment   gi|XP_548943.2| PREDICTED: similar to LanC lantibiotic syntheta...   209   6e-54

>ref|XP_540359.2| PREDICTED: similar to LanC-like protein 2 (Testis-specific adriamycin
            sensitivity protein) [Canis familiaris]
          Length = 452

 Score =  755 bits (1949), Expect = 0.0
 Identities = 361/386 (93%), Positives = 375/386 (97%)
 Frame = +3

Query: 477  KIIHNFTRRIQSKIKDLLQQMEEGLKTADPHDCSAYTGWTGIALLYLQLYRVTCDQNYLL 656
            +I+ NFT+RIQ+KIKDLLQQMEEGLKTADPHDCSAYTGWTGIALLYLQLYRVTCDQ YLL
Sbjct: 67   RIVQNFTKRIQTKIKDLLQQMEEGLKTADPHDCSAYTGWTGIALLYLQLYRVTCDQTYLL 126

Query: 657  RSLDYVKRTLRNLNGRRVTFLCGDAGPLAVGAVVYHKLKSDGESQECITKLLQLQRTIVC 836
            RSLDYVKRTLRNLNGRRVTFLCGDAGPLAVGAVVYHKLKSD ESQECITKLLQLQRTIVC
Sbjct: 127  RSLDYVKRTLRNLNGRRVTFLCGDAGPLAVGAVVYHKLKSDCESQECITKLLQLQRTIVC 186

Query: 837  RDSDLPDELLFGRAGYLYALLYVNTEMGPGAVCESAIKEVVDAIIESGKTLSKEERKAER 1016
            RDSDLPDELL+GRAGYLYALLY+NTE+GPG VCESAIKEVV AIIESGKTLS+EERKAER
Sbjct: 187  RDSDLPDELLYGRAGYLYALLYLNTEIGPGTVCESAIKEVVCAIIESGKTLSREERKAER 246

Query: 1017 CPLLYQWHRKQYVGAAHGMAGIYYMLMQPAAKVDQETLTEMVKPSIDYMRHKRFRSGNYP 1196
            CPLLYQWHRKQYVGAAHGMAGIYYMLMQPAAKVDQETLTEMVKPSIDY+RHKRFRSGNYP
Sbjct: 247  CPLLYQWHRKQYVGAAHGMAGIYYMLMQPAAKVDQETLTEMVKPSIDYVRHKRFRSGNYP 306

Query: 1197 SSLSNETDRLVHWCHGAPGVIHTLMQAYKVFKEEKYLRDAVECSDVIWQRGLLRKGYGIC 1376
            SSLSNETDRLVHWCHGAPGVIH LMQAYKVFKEEKYL+DA+ECSDVIWQRGLLRKGYGIC
Sbjct: 307  SSLSNETDRLVHWCHGAPGVIHMLMQAYKVFKEEKYLKDAMECSDVIWQRGLLRKGYGIC 366

Query: 1377 HGTAGNGYSFLSLYRLTQDKKYLYRACKFAEWCLEYGAHGCRIPDRPYSLFEGMAGAIHF 1556
            HGTAGNGYSFLSLY LTQDKKYLYRACKFAEWCLEYGAHGCRIPDRPYSLFEGMAGAIHF
Sbjct: 367  HGTAGNGYSFLSLYHLTQDKKYLYRACKFAEWCLEYGAHGCRIPDRPYSLFEGMAGAIHF 426

Query: 1557 LSDILAPETARFPAFELGSSERDPKV 1634
            LSDILAPET+RFPAFEL   +RD K+
Sbjct: 427  LSDILAPETSRFPAFELAPPQRDRKI 452


>ref|XP_536055.1| PREDICTED: similar to LanC-like protein 1 (40 kDa erythrocyte
            membrane protein) (p40) [Canis familiaris]
          Length = 399

 Score =  485 bits (1249), Expect = e-137
 Identities = 225/421 (53%), Positives = 302/421 (71%)
 Frame = +3

Query: 345  MEERAFPNPFPDYXXXXXXXXXXXXXXXXXLTPEELGLPFHSDGKIIHNFTRRIQSKIKD 524
            M +RAFPNP+ D+                          F   G++   F++R+ +KI++
Sbjct: 1    MAQRAFPNPYADFNKSLAESY------------------FDCAGRLTPEFSQRLNNKIRE 42

Query: 525  LLQQMEEGLKTADPHDCSAYTGWTGIALLYLQLYRVTCDQNYLLRSLDYVKRTLRNLNGR 704
            LLQQME GLK+ADP D + YTGW GIALLYL LY V  D  YL  +  YVK++L +L  R
Sbjct: 43   LLQQMERGLKSADPRDSTVYTGWAGIALLYLHLYDVFGDPAYLQMAHGYVKQSLNSLTKR 102

Query: 705  RVTFLCGDAGPLAVGAVVYHKLKSDGESQECITKLLQLQRTIVCRDSDLPDELLFGRAGY 884
             +TFLCGDAGPLA+GAVVYHK+ ++ ++++CIT+L+ L +     D   P+E+L+GR GY
Sbjct: 103  SITFLCGDAGPLAIGAVVYHKMNNEKQAEDCITRLIHLNKI----DHHAPNEMLYGRMGY 158

Query: 885  LYALLYVNTEMGPGAVCESAIKEVVDAIIESGKTLSKEERKAERCPLLYQWHRKQYVGAA 1064
            +YALL+VN   G   + +S I+++ +A++ SG+ L+++     + PL+Y+W+++ YVGAA
Sbjct: 159  VYALLFVNKNFGVEKIPQSHIQQICEAVLTSGENLAQKRNFTAKTPLMYEWYQEYYVGAA 218

Query: 1065 HGMAGIYYMLMQPAAKVDQETLTEMVKPSIDYMRHKRFRSGNYPSSLSNETDRLVHWCHG 1244
            HG+AGIYY+LMQP+ +V    L  +VKPS+DY+   +F SGNYP  + +  D LVHWCHG
Sbjct: 219  HGLAGIYYLLMQPSLQVSHVKLHNLVKPSVDYVCQLKFPSGNYPPCVDDNRDLLVHWCHG 278

Query: 1245 APGVIHTLMQAYKVFKEEKYLRDAVECSDVIWQRGLLRKGYGICHGTAGNGYSFLSLYRL 1424
            +PGVI+ L+QAYK F+ E YL DA +C+DVIW+ GLLRKGYG+CHGTAGN Y+FL+LY L
Sbjct: 279  SPGVIYMLIQAYKAFRGEHYLNDAHQCADVIWRYGLLRKGYGLCHGTAGNAYAFLTLYNL 338

Query: 1425 TQDKKYLYRACKFAEWCLEYGAHGCRIPDRPYSLFEGMAGAIHFLSDILAPETARFPAFE 1604
            TQD KYLYRACKFAEWCL+YG HGCR PD P+SLFEGMAG I+FL+D+L P  ARFPAFE
Sbjct: 339  TQDMKYLYRACKFAEWCLDYGEHGCRTPDTPFSLFEGMAGTIYFLADLLVPTKARFPAFE 398

Query: 1605 L 1607
            L
Sbjct: 399  L 399


>ref|XP_548943.2| PREDICTED: similar to LanC lantibiotic synthetase component C-like 3
            [Canis familiaris]
          Length = 420

 Score =  209 bits (533), Expect = 6e-54
 Identities = 122/309 (39%), Positives = 175/309 (56%), Gaps = 8/309 (2%)
 Frame = +3

Query: 705  RVTFLCGDAGPLAVGAVVYHKLKSDGESQECITKLLQLQRTIVCRDSDL----PDELLFG 872
            R  FL G AG  AV  +VYH L      Q  + K   L    VC          DEL  G
Sbjct: 117  RAAFLLGGAGVYAVATLVYHALGRSDYVQP-LGKFRAL--CAVCAPVSFLECGSDELFVG 173

Query: 873  RAGYLYALLYVNTEMGPGAVCESAIKEVVDAIIESGKTLSKEERKAERCPLLYQWHRKQY 1052
            RAGYL A L +  ++    +  + IK +  AI++SGK  + ++RK    PL+Y ++  +Y
Sbjct: 174  RAGYLCAALVLKQKLAQEVLTPAQIKSICQAILDSGKQYAMKKRKP--FPLMYSYYGTEY 231

Query: 1053 VGAAHGMAGIYYMLMQPAAKVDQETLTEMVKPSIDYMRHKRFRSGNYPSSLSNETDR--- 1223
            +GAAHG++ I  ML+     +      E+V  S+D++  +  ++ N+P  L    +R   
Sbjct: 232  LGAAHGLSSILQMLLSYHEHLKPSD-QELVWQSVDFLMEQE-QNCNWPPELGEAIERENE 289

Query: 1224 LVHWCHGAPGVIHTLMQAYKVFKEEKYLRDAVECSDVIWQRGLLRKGYGICHGTAGNGYS 1403
            LVHWCHGAPG+ +   +AY V K+ +YL   + C ++ WQ+GLL+KG GICHG AG+ Y 
Sbjct: 290  LVHWCHGAPGIAYLFAKAYLVSKKPQYLDTCIRCGELTWQKGLLKKGPGICHGVAGSAYV 349

Query: 1404 FLSLYRLTQDKKYLYRACKFAEWCL-EYGAHGCRIPDRPYSLFEGMAGAIHFLSDILAPE 1580
            FL LYRLT + KY+YRA +FAE+   E    G R+ +  YSL+EG +G + FL D+L P 
Sbjct: 350  FLLLYRLTGNSKYIYRAQRFAEFLFTEEFKAGSRVLESIYSLYEGFSGTVCFLIDLLQPN 409

Query: 1581 TARFPAFEL 1607
             A FP F +
Sbjct: 410  QAEFPLFSV 418


  Database: RefSeqCP
    Posted date:  Aug 1, 2006  9:25 PM
  Number of letters in database: 19,266,565
  Number of sequences in database:  33,732
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 85,881,610
Number of Sequences: 33732
Number of extensions: 2496512
Number of successful extensions: 15615
Number of sequences better than 1.0e-05: 3
Number of HSP's better than  0.0 without gapping: 8724
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 15453
length of database: 19,266,565
effective HSP length: 110
effective length of database: 15,556,045
effective search space used: 8680273110
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqHP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= OVRM1_0055_H01
         (2008 letters)

Database: RefSeqHP 
           39,411 sequences; 17,774,539 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_061167.1| LanC lantibiotic synthetase component C-like 2 ...   799   0.0  
Alignment   gi|NP_006046.1| lanthionine synthetase C-like protein 1 [Homo s...   488   e-138
Alignment   gi|NP_940913.1| LanC lantibiotic synthetase component C-like 3 ...   174   3e-43

>ref|NP_061167.1| LanC lantibiotic synthetase component C-like 2 [Homo sapiens]
          Length = 450

 Score =  799 bits (2063), Expect = 0.0
 Identities = 383/450 (85%), Positives = 409/450 (90%), Gaps = 5/450 (1%)
 Frame = +3

Query: 291  MGETISRRLWFQGDWDAEMEERAFPNPFPDYXXXXXXXXXXXXXXXXXL-----TPEELG 455
            MGET+S+RL      +AEMEERAF NPFPDY                       T +E G
Sbjct: 1    MGETMSKRLKLHLGGEAEMEERAFVNPFPDYEAAAGALLASGAAEETGCVRPPATTDEPG 60

Query: 456  LPFHSDGKIIHNFTRRIQSKIKDLLQQMEEGLKTADPHDCSAYTGWTGIALLYLQLYRVT 635
            LPFH DGKIIHNF RRIQ+KIKDLLQQMEEGLKTADPHDCSAYTGWTGIALLYLQLYRVT
Sbjct: 61   LPFHQDGKIIHNFIRRIQTKIKDLLQQMEEGLKTADPHDCSAYTGWTGIALLYLQLYRVT 120

Query: 636  CDQNYLLRSLDYVKRTLRNLNGRRVTFLCGDAGPLAVGAVVYHKLKSDGESQECITKLLQ 815
            CDQ YLLRSLDYVKRTLRNLNGRRVTFLCGDAGPLAVGAV+YHKL+SD ESQEC+TKLLQ
Sbjct: 121  CDQTYLLRSLDYVKRTLRNLNGRRVTFLCGDAGPLAVGAVIYHKLRSDCESQECVTKLLQ 180

Query: 816  LQRTIVCRDSDLPDELLFGRAGYLYALLYVNTEMGPGAVCESAIKEVVDAIIESGKTLSK 995
            LQR++VC++SDLPDELL+GRAGYLYALLY+NTE+GPG VCESAIKEVV+AIIESGKTLS+
Sbjct: 181  LQRSVVCQESDLPDELLYGRAGYLYALLYLNTEIGPGTVCESAIKEVVNAIIESGKTLSR 240

Query: 996  EERKAERCPLLYQWHRKQYVGAAHGMAGIYYMLMQPAAKVDQETLTEMVKPSIDYMRHKR 1175
            EERK ERCPLLYQWHRKQYVGAAHGMAGIYYMLMQPAAKVDQETLTEMVKPSIDY+RHK+
Sbjct: 241  EERKTERCPLLYQWHRKQYVGAAHGMAGIYYMLMQPAAKVDQETLTEMVKPSIDYVRHKK 300

Query: 1176 FRSGNYPSSLSNETDRLVHWCHGAPGVIHTLMQAYKVFKEEKYLRDAVECSDVIWQRGLL 1355
            FRSGNYPSSLSNETDRLVHWCHGAPGVIH LMQAYKVFKEEKYL++A+ECSDVIWQRGLL
Sbjct: 301  FRSGNYPSSLSNETDRLVHWCHGAPGVIHMLMQAYKVFKEEKYLKEAMECSDVIWQRGLL 360

Query: 1356 RKGYGICHGTAGNGYSFLSLYRLTQDKKYLYRACKFAEWCLEYGAHGCRIPDRPYSLFEG 1535
            RKGYGICHGTAGNGYSFLSLYRLTQDKKYLYRACKFAEWCL+YGAHGCRIPDRPYSLFEG
Sbjct: 361  RKGYGICHGTAGNGYSFLSLYRLTQDKKYLYRACKFAEWCLDYGAHGCRIPDRPYSLFEG 420

Query: 1536 MAGAIHFLSDILAPETARFPAFELGSSERD 1625
            MAGAIHFLSD+L PET+RFPAFEL SS+RD
Sbjct: 421  MAGAIHFLSDVLGPETSRFPAFELDSSKRD 450


>ref|NP_006046.1| lanthionine synthetase C-like protein 1 [Homo sapiens]
          Length = 399

 Score =  488 bits (1256), Expect = e-138
 Identities = 229/421 (54%), Positives = 303/421 (71%)
 Frame = +3

Query: 345  MEERAFPNPFPDYXXXXXXXXXXXXXXXXXLTPEELGLPFHSDGKIIHNFTRRIQSKIKD 524
            M +RAFPNP+ DY                          F + G++   F++R+ +KI++
Sbjct: 1    MAQRAFPNPYADYNKSLAEGY------------------FDAAGRLTPEFSQRLTNKIRE 42

Query: 525  LLQQMEEGLKTADPHDCSAYTGWTGIALLYLQLYRVTCDQNYLLRSLDYVKRTLRNLNGR 704
            LLQQME GLK+ADP D + YTGW GIA+LYL LY V  D  YL  +  YVK++L  L  R
Sbjct: 43   LLQQMERGLKSADPRDGTGYTGWAGIAVLYLHLYDVFGDPAYLQLAHGYVKQSLNCLTKR 102

Query: 705  RVTFLCGDAGPLAVGAVVYHKLKSDGESQECITKLLQLQRTIVCRDSDLPDELLFGRAGY 884
             +TFLCGDAGPLAV AV+YHK+ ++ ++++CIT+L+ L +     D   P+E+L+GR GY
Sbjct: 103  SITFLCGDAGPLAVAAVLYHKMNNEKQAEDCITRLIHLNKI----DPHAPNEMLYGRIGY 158

Query: 885  LYALLYVNTEMGPGAVCESAIKEVVDAIIESGKTLSKEERKAERCPLLYQWHRKQYVGAA 1064
            +YALL+VN   G   + +S I+++ + I+ SG+ L+++     + PL+Y+W+++ YVGAA
Sbjct: 159  IYALLFVNKNFGVEKIPQSHIQQICETILTSGENLARKRNFTAKSPLMYEWYQEYYVGAA 218

Query: 1065 HGMAGIYYMLMQPAAKVDQETLTEMVKPSIDYMRHKRFRSGNYPSSLSNETDRLVHWCHG 1244
            HG+AGIYY LMQP+ +V Q  L  +VKPS+DY+   +F SGNYP  + +  D LVHWCHG
Sbjct: 219  HGLAGIYYYLMQPSLQVSQGKLHSLVKPSVDYVCQLKFPSGNYPPCIGDNRDLLVHWCHG 278

Query: 1245 APGVIHTLMQAYKVFKEEKYLRDAVECSDVIWQRGLLRKGYGICHGTAGNGYSFLSLYRL 1424
            APGVI+ L+QAYKVF+EEKYL DA +C+DVIWQ GLL+KGYG+CHG+AGN Y+FL+LY L
Sbjct: 279  APGVIYMLIQAYKVFREEKYLCDAYQCADVIWQYGLLKKGYGLCHGSAGNAYAFLTLYNL 338

Query: 1425 TQDKKYLYRACKFAEWCLEYGAHGCRIPDRPYSLFEGMAGAIHFLSDILAPETARFPAFE 1604
            TQD KYLYRACKFAEWCLEYG HGCR PD P+SLFEGMAG I+FL+D+L P  ARFPAFE
Sbjct: 339  TQDMKYLYRACKFAEWCLEYGEHGCRTPDTPFSLFEGMAGTIYFLADLLVPTKARFPAFE 398

Query: 1605 L 1607
            L
Sbjct: 399  L 399


>ref|NP_940913.1| LanC lantibiotic synthetase component C-like 3 [Homo sapiens]
          Length = 388

 Score =  174 bits (440), Expect = 3e-43
 Identities = 101/257 (39%), Positives = 145/257 (56%), Gaps = 7/257 (2%)
 Frame = +3

Query: 705  RVTFLCGDAGPLAVGAVVYHKLKSDGESQECITKLLQLQRTIVCRDSDL----PDELLFG 872
            R  FL G AG  AV  +VYH L      Q  + K   L    VC          DEL  G
Sbjct: 117  RAAFLLGGAGVYAVATLVYHALGRSDYVQP-LGKFRAL--CAVCAPVSFLECGSDELFVG 173

Query: 873  RAGYLYALLYVNTEMGPGAVCESAIKEVVDAIIESGKTLSKEERKAERCPLLYQWHRKQY 1052
            RAGYL A L +  ++    +  + IK +  AI++SGK  + ++RK    PL+Y ++  +Y
Sbjct: 174  RAGYLCAALVLKQKLAQEVLTPAQIKSICQAILDSGKQYAIKKRKP--FPLMYSYYGTEY 231

Query: 1053 VGAAHGMAGIYYMLMQPAAKVDQETLTEMVKPSIDYMRHKRFRSGNYPSSLSNETDR--- 1223
            +GAAHG++ I  ML+     +      E+V  S+D++  +  ++ N+P  L    +R   
Sbjct: 232  LGAAHGLSSILQMLLSYHEHLKPSD-RELVWQSVDFLMEQE-QNCNWPPELGETIERENE 289

Query: 1224 LVHWCHGAPGVIHTLMQAYKVFKEEKYLRDAVECSDVIWQRGLLRKGYGICHGTAGNGYS 1403
            LVHWCHGAPG+ +   +AY V K+ +YL   + C ++ WQ+GLL+KG GICHG AG+ Y 
Sbjct: 290  LVHWCHGAPGIAYLFAKAYLVSKKPQYLDTCIRCGELTWQKGLLKKGPGICHGVAGSAYV 349

Query: 1404 FLSLYRLTQDKKYLYRA 1454
            FL LYRLT + KY+YRA
Sbjct: 350  FLLLYRLTGNSKYIYRA 366


  Database: RefSeqHP
    Posted date:  Aug 2, 2006 12:57 AM
  Number of letters in database: 17,774,539
  Number of sequences in database:  39,411
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 83,740,812
Number of Sequences: 39411
Number of extensions: 2540535
Number of successful extensions: 15926
Number of sequences better than 1.0e-05: 3
Number of HSP's better than  0.0 without gapping: 8895
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 15754
length of database: 17,774,539
effective HSP length: 109
effective length of database: 13,478,740
effective search space used: 7534615660
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqSP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= OVRM1_0055_H01
         (2008 letters)

Database: RefSeqSP 
           1040 sequences; 434,620 total letters

Searching...done

 ***** No hits found ******

  Database: RefSeqSP
    Posted date:  Aug 1, 2006  7:14 PM
  Number of letters in database: 434,620
  Number of sequences in database:  1040
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,908,958
Number of Sequences: 1040
Number of extensions: 51964
Number of successful extensions: 218
Number of sequences better than 1.0e-05: 0
Number of HSP's better than  0.0 without gapping: 154
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 217
length of database: 434,620
effective HSP length: 83
effective length of database: 348,300
effective search space used: 203755500
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqMP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= OVRM1_0055_H01
         (2008 letters)

Database: RefSeqMP 
           45,328 sequences; 21,768,885 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_598498.1| LanC (bacterial lantibiotic synthetase componen...   768   0.0  
Alignment   gi|XP_984245.1| PREDICTED: similar to LanC (bacterial lantibiot...   548   e-156
Alignment   gi|NP_067270.1| LanC (bacterial lantibiotic synthetase componen...   486   e-137
Alignment   gi|NP_775590.1| LanC lantibiotic synthetase component C-like 3 ...   209   7e-54

>ref|NP_598498.1| LanC (bacterial lantibiotic synthetase component C)-like 2 [Mus
            musculus]
          Length = 450

 Score =  768 bits (1984), Expect = 0.0
 Identities = 370/451 (82%), Positives = 405/451 (89%), Gaps = 6/451 (1%)
 Frame = +3

Query: 291  MGETISRRLWFQGDWDAEMEERAFPNPFPDYXXXXXXXXXXXXXXXXX------LTPEEL 452
            MGET+S+RL F    +AEMEER+FPNPFPDY                        T E+ 
Sbjct: 1    MGETMSKRLKFHLG-EAEMEERSFPNPFPDYEAAASAAGLAAGSAEETGRVCPLPTTEDP 59

Query: 453  GLPFHSDGKIIHNFTRRIQSKIKDLLQQMEEGLKTADPHDCSAYTGWTGIALLYLQLYRV 632
            GLPFH +GKI+ NF +RIQ+KIKDLLQQMEEGLKTADPHDCSAYTGWTGIALLYLQLYRV
Sbjct: 60   GLPFHPNGKIVPNFIKRIQTKIKDLLQQMEEGLKTADPHDCSAYTGWTGIALLYLQLYRV 119

Query: 633  TCDQNYLLRSLDYVKRTLRNLNGRRVTFLCGDAGPLAVGAVVYHKLKSDGESQECITKLL 812
            T DQ YLLRSLDYVKRTLRNL+GRRVTFLCGDAGPLAVGAV+YHKLKS+ ESQECITKLL
Sbjct: 120  TGDQTYLLRSLDYVKRTLRNLSGRRVTFLCGDAGPLAVGAVIYHKLKSECESQECITKLL 179

Query: 813  QLQRTIVCRDSDLPDELLFGRAGYLYALLYVNTEMGPGAVCESAIKEVVDAIIESGKTLS 992
            Q+ RTIVC++S+LPDELL+GRAGYLYALLY+NTE+GPG V E+AIKEVV AIIESGK+LS
Sbjct: 180  QMHRTIVCQESELPDELLYGRAGYLYALLYLNTEIGPGTVGETAIKEVVSAIIESGKSLS 239

Query: 993  KEERKAERCPLLYQWHRKQYVGAAHGMAGIYYMLMQPAAKVDQETLTEMVKPSIDYMRHK 1172
            +EERK+ERCPLLYQWHRKQYVGAAHGMAGIYYMLMQP AKVDQETLTEMVKPSIDY+RHK
Sbjct: 240  REERKSERCPLLYQWHRKQYVGAAHGMAGIYYMLMQPEAKVDQETLTEMVKPSIDYVRHK 299

Query: 1173 RFRSGNYPSSLSNETDRLVHWCHGAPGVIHTLMQAYKVFKEEKYLRDAVECSDVIWQRGL 1352
            +FRSGNYPSSLSNETDRLVHWCHGAPGVIH L+QAY+VFKEEKYL++A+ECSDVIWQRGL
Sbjct: 300  KFRSGNYPSSLSNETDRLVHWCHGAPGVIHVLLQAYQVFKEEKYLKEAMECSDVIWQRGL 359

Query: 1353 LRKGYGICHGTAGNGYSFLSLYRLTQDKKYLYRACKFAEWCLEYGAHGCRIPDRPYSLFE 1532
            LRKGYGICHGT+GNGYSFLSLYRLTQDKKYLYRACKFAEWCL+YGAHGCRIPDRPYSLFE
Sbjct: 360  LRKGYGICHGTSGNGYSFLSLYRLTQDKKYLYRACKFAEWCLDYGAHGCRIPDRPYSLFE 419

Query: 1533 GMAGAIHFLSDILAPETARFPAFELGSSERD 1625
            GMAGA+HFLSDIL PETARFPAFELG  ++D
Sbjct: 420  GMAGAVHFLSDILVPETARFPAFELGFLQKD 450


>ref|XP_984245.1| PREDICTED: similar to LanC (bacterial lantibiotic synthetase
            component C)-like 2 [Mus musculus]
          Length = 390

 Score =  548 bits (1412), Expect = e-156
 Identities = 291/451 (64%), Positives = 323/451 (71%), Gaps = 6/451 (1%)
 Frame = +3

Query: 291  MGETISRRLWFQGDWDAEMEERAFPNPFPDYXXXXXXXXXXXXXXXXX------LTPEEL 452
            MGET+S+RL F    +AEMEER+FPNPFPDY                        T E+ 
Sbjct: 1    MGETMSKRLKFHLG-EAEMEERSFPNPFPDYEAAASAAGLAAGSAEETGRVCPLPTTEDP 59

Query: 453  GLPFHSDGKIIHNFTRRIQSKIKDLLQQMEEGLKTADPHDCSAYTGWTGIALLYLQLYRV 632
            GLPFH +GKI+ NF +RIQ+KIKDLLQQMEEGLKTADPHDCSAYTGWTGIALLYLQLYRV
Sbjct: 60   GLPFHPNGKIVPNFIKRIQTKIKDLLQQMEEGLKTADPHDCSAYTGWTGIALLYLQLYRV 119

Query: 633  TCDQNYLLRSLDYVKRTLRNLNGRRVTFLCGDAGPLAVGAVVYHKLKSDGESQECITKLL 812
            T DQ YLLRSLDYVKRTLRNL+GRRVTFLCGDAGPLAVGAV+YHKLKS+ ESQECITKLL
Sbjct: 120  TGDQTYLLRSLDYVKRTLRNLSGRRVTFLCGDAGPLAVGAVIYHKLKSECESQECITKLL 179

Query: 813  QLQRTIVCRDSDLPDELLFGRAGYLYALLYVNTEMGPGAVCESAIKEVVDAIIESGKTLS 992
            Q+ RTIVC++S+LPDELL+GRAGYLYALLY+NTE+GPG V E+AIKEVV AIIESGK+LS
Sbjct: 180  QMHRTIVCQESELPDELLYGRAGYLYALLYLNTEIGPGTVGETAIKEVVSAIIESGKSLS 239

Query: 993  KEERKAERCPLLYQWHRKQYVGAAHGMAGIYYMLMQPAAKVDQETLTEMVKPSIDYMRHK 1172
            +EERK+ERCPLLYQWHRKQYVGAAHGMAGIYYMLMQP AKVDQETLTEMVKPSIDY+RHK
Sbjct: 240  REERKSERCPLLYQWHRKQYVGAAHGMAGIYYMLMQPEAKVDQETLTEMVKPSIDYVRHK 299

Query: 1173 RFRSGNYPSSLSNETDRLVHWCHGAPGVIHTLMQAYKVFKEEKYLRDAVECSDVIWQRGL 1352
            +FRSGNYPSSLSNETDRLVHW                                       
Sbjct: 300  KFRSGNYPSSLSNETDRLVHW--------------------------------------- 320

Query: 1353 LRKGYGICHGTAGNGYSFLSLYRLTQDKKYLYRACKFAEWCLEYGAHGCRIPDRPYSLFE 1532
                   CHG  G  +  L  Y+   +   LY                C +P R    F 
Sbjct: 321  -------CHGAPGVIHVLLQAYQRL-NITLLYSIT-------------CVVPKRCTFCFA 359

Query: 1533 GMAGAIHFLSDILAPETARFPAFELGSSERD 1625
            GMAGA+HFLSDIL PETARFPAFELG  ++D
Sbjct: 360  GMAGAVHFLSDILVPETARFPAFELGFLQKD 390


>ref|NP_067270.1| LanC (bacterial lantibiotic synthetase component C)-like 1 [Mus
            musculus]
          Length = 399

 Score =  486 bits (1251), Expect = e-137
 Identities = 229/421 (54%), Positives = 304/421 (72%)
 Frame = +3

Query: 345  MEERAFPNPFPDYXXXXXXXXXXXXXXXXXLTPEELGLPFHSDGKIIHNFTRRIQSKIKD 524
            M +RAFPNP+ DY                          F S G++   F+ R+ +KI++
Sbjct: 1    MAQRAFPNPYADYNKSLAENY------------------FDSTGRLTPEFSHRLTNKIRE 42

Query: 525  LLQQMEEGLKTADPHDCSAYTGWTGIALLYLQLYRVTCDQNYLLRSLDYVKRTLRNLNGR 704
            LLQQME GLK+ADP D + YTGW GIA+LYL L+ V  D  YL  +  YVK++L  L+ R
Sbjct: 43   LLQQMERGLKSADPRDGTGYTGWAGIAVLYLHLHNVFGDPAYLQMAHSYVKQSLNCLSRR 102

Query: 705  RVTFLCGDAGPLAVGAVVYHKLKSDGESQECITKLLQLQRTIVCRDSDLPDELLFGRAGY 884
             +TFLCGDAGPLAV AV+YHK+ S+ +++ECIT+L+ L +     D  +P+E+L+GR GY
Sbjct: 103  SITFLCGDAGPLAVAAVLYHKMNSEKQAEECITRLIHLNKI----DPHVPNEMLYGRIGY 158

Query: 885  LYALLYVNTEMGPGAVCESAIKEVVDAIIESGKTLSKEERKAERCPLLYQWHRKQYVGAA 1064
            ++ALL+VN   G   + +S I+++ + I+ SG+ LS++   A + PL+Y+W+++ YVGAA
Sbjct: 159  IFALLFVNKNFGEEKIPQSHIQQICENILTSGENLSRKRNLAAKSPLMYEWYQEYYVGAA 218

Query: 1065 HGMAGIYYMLMQPAAKVDQETLTEMVKPSIDYMRHKRFRSGNYPSSLSNETDRLVHWCHG 1244
            HG+AGIYY LMQP+ +V+Q  L  +VKPS+D++   +F SGNYP  L +  D LVHWCHG
Sbjct: 219  HGLAGIYYYLMQPSLQVNQGKLHSLVKPSVDFVCRLKFPSGNYPPCLDDTRDLLVHWCHG 278

Query: 1245 APGVIHTLMQAYKVFKEEKYLRDAVECSDVIWQRGLLRKGYGICHGTAGNGYSFLSLYRL 1424
            APGVI+ L+QAYKVFKEE+YL DA +C+DVIWQ GLL+KGYG+CHG AGN Y+FL+LY L
Sbjct: 279  APGVIYMLIQAYKVFKEERYLCDAQQCADVIWQYGLLKKGYGLCHGAAGNAYAFLALYNL 338

Query: 1425 TQDKKYLYRACKFAEWCLEYGAHGCRIPDRPYSLFEGMAGAIHFLSDILAPETARFPAFE 1604
            TQD KYLYRACKFAEWCL+YG HGCR  D P+SLFEGMAG I+FL+D+L P  A+FPAFE
Sbjct: 339  TQDLKYLYRACKFAEWCLDYGEHGCRTADTPFSLFEGMAGTIYFLADLLVPTKAKFPAFE 398

Query: 1605 L 1607
            L
Sbjct: 399  L 399


>ref|NP_775590.1| LanC lantibiotic synthetase component C-like 3 [Mus musculus]
          Length = 420

 Score =  209 bits (533), Expect = 7e-54
 Identities = 120/309 (38%), Positives = 176/309 (56%), Gaps = 8/309 (2%)
 Frame = +3

Query: 705  RVTFLCGDAGPLAVGAVVYHKLKSDGESQECITKLLQLQRTIVCRDSDL----PDELLFG 872
            R  FL G AG  AV  +VYH L      Q  + K   L    VC          DEL  G
Sbjct: 117  RAAFLLGGAGVYAVATLVYHALGRPDYVQP-LGKFRAL--CAVCAPVSFLDCGSDELFVG 173

Query: 873  RAGYLYALLYVNTEMGPGAVCESAIKEVVDAIIESGKTLSKEERKAERCPLLYQWHRKQY 1052
            RAGYL A L +  ++    +  + IK +  AI++SGK  + ++RK    PL+Y ++  +Y
Sbjct: 174  RAGYLCAALVLKQKLAQEVLTPTQIKAICQAILDSGKQYALKKRKP--FPLMYSYYGTEY 231

Query: 1053 VGAAHGMAGIYYMLMQPAAKVDQETLTEMVKPSIDYMRHKRFRSGNYPSSLSNETDR--- 1223
            +GAAHG++ I  ML+     +      E+V+ S+D++  +  ++ N+P  L    +R   
Sbjct: 232  LGAAHGLSSILQMLLSYQEHLKPSD-RELVRQSVDFLMEQE-QNCNWPPELGETIERENE 289

Query: 1224 LVHWCHGAPGVIHTLMQAYKVFKEEKYLRDAVECSDVIWQRGLLRKGYGICHGTAGNGYS 1403
            LVHWCHGAPG+ +   +AY + K+ +YL   + C ++ WQ+GLL+KG GICHG AG+ Y 
Sbjct: 290  LVHWCHGAPGIAYLFAKAYLISKKPQYLDTCIRCGELTWQKGLLKKGPGICHGVAGSAYV 349

Query: 1404 FLSLYRLTQDKKYLYRACKFAEWCL-EYGAHGCRIPDRPYSLFEGMAGAIHFLSDILAPE 1580
            FL LYRLT + KY+YRA +FA++   E    G R+ +  YSL+EG +G + FL D+L P 
Sbjct: 350  FLLLYRLTGNSKYIYRAQRFAQFLFTEEFKSGSRVLESIYSLYEGFSGTVCFLIDLLQPN 409

Query: 1581 TARFPAFEL 1607
             A FP F +
Sbjct: 410  QAEFPLFSV 418


  Database: RefSeqMP
    Posted date:  Aug 2, 2006 12:58 AM
  Number of letters in database: 21,768,885
  Number of sequences in database:  45,328
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 97,545,619
Number of Sequences: 45328
Number of extensions: 2793321
Number of successful extensions: 16451
Number of sequences better than 1.0e-05: 4
Number of HSP's better than  0.0 without gapping: 9533
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 16299
length of database: 21,768,885
effective HSP length: 110
effective length of database: 16,782,805
effective search space used: 9364805190
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)